--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Dec 09 20:59:50 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/442/Zasp66-PI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1306.37 -1329.16
2 -1305.53 -1330.75
--------------------------------------
TOTAL -1305.86 -1330.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.444227 0.011605 0.261739 0.666272 0.429258 1224.47 1300.84 1.000
r(A<->C){all} 0.027604 0.000330 0.000031 0.062834 0.024025 896.01 919.87 1.000
r(A<->G){all} 0.232289 0.005979 0.098468 0.385381 0.223423 390.59 612.71 1.000
r(A<->T){all} 0.120904 0.002830 0.022085 0.223053 0.114900 580.43 583.37 1.000
r(C<->G){all} 0.016864 0.000219 0.000014 0.046095 0.013064 906.67 953.09 1.000
r(C<->T){all} 0.353792 0.008648 0.178064 0.530277 0.348018 292.34 400.46 1.000
r(G<->T){all} 0.248547 0.005582 0.116603 0.400646 0.244688 613.98 648.02 1.000
pi(A){all} 0.282877 0.000303 0.248506 0.315433 0.282114 1215.62 1266.11 1.000
pi(C){all} 0.314354 0.000316 0.279639 0.348046 0.314162 1210.96 1286.99 1.001
pi(G){all} 0.226806 0.000249 0.194368 0.255550 0.226801 937.05 1095.29 1.000
pi(T){all} 0.175963 0.000201 0.149332 0.204586 0.175491 1195.07 1263.91 1.000
alpha{1,2} 0.114375 0.000793 0.067296 0.171206 0.109706 1127.65 1294.31 1.000
alpha{3} 1.625997 0.428499 0.598230 2.914526 1.527999 1174.48 1270.62 1.001
pinvar{all} 0.756703 0.001424 0.678591 0.821768 0.758687 1228.50 1364.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1255.827239
Model 2: PositiveSelection -1255.827239
Model 0: one-ratio -1261.868916
Model 3: discrete -1255.462558
Model 7: beta -1255.471314
Model 8: beta&w>1 -1255.471088
Model 0 vs 1 12.083353999999872
Model 2 vs 1 0.0
Model 8 vs 7 4.519999997683044E-4
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPASAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSSYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGN
AAPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKQTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=215
C1 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C2 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C3 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C4 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C5 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C6 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C7 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
C8 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C9 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C10 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C11 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
************************************************:*
C1 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C2 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C3 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C4 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C5 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C6 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C7 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C8 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C9 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
C10 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C11 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
**************************************:***********
C1 NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
C2 NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
C3 NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
C4 NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
C5 NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
C6 NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
C7 NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
C8 NSPIGLYSNSNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSSYGQ
C9 NSPIGLYSNHNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
C10 NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGN
C11 NSPIGLYSNNNIEDTIRSTVPYKQTVQYDPRNSDTYRAIQEEGGYSNYGQ
********* *************:*********:************.**:
C1 SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C2 SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C3 SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C4 SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C5 SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C6 SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C7 SSPQEVTIPVQTKVYQPNRLVPGKKPASAPVSRPPYNVVNTHDENIRQSG
C8 SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C9 SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C10 AAPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
C11 SSPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
::**********:*************.***********************
C1 SFNRLMYSVIGATEY
C2 SFNRLMYSVIGATEY
C3 SFNRLMYSVIGATEY
C4 SFNRLMYSVIGATEY
C5 SFNRLMYSVIGATEY
C6 SFNRLMYSVIGATEY
C7 SFNRLMYSVIGATEY
C8 SFNRLMYSVIGATEY
C9 SFNRLMYSVIGATEY
C10 SFNRLMYSVIGATEY
C11 SFNRLMYSVIGATEY
***************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 215 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 215 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [23650]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [23650]--->[23650]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/442/Zasp66-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.604 Mb, Max= 31.248 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPASAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSSYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGN
AAPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKQTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
FORMAT of file /tmp/tmp3808768206463226299aln Not Supported[FATAL:T-COFFEE]
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPASAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSSYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGN
AAPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKQTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:215 S:100 BS:215
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 99.53 C1 C4 99.53
TOP 3 0 99.53 C4 C1 99.53
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 99.53 C1 C6 99.53
TOP 5 0 99.53 C6 C1 99.53
BOT 0 6 98.60 C1 C7 98.60
TOP 6 0 98.60 C7 C1 98.60
BOT 0 7 98.60 C1 C8 98.60
TOP 7 0 98.60 C8 C1 98.60
BOT 0 8 99.07 C1 C9 99.07
TOP 8 0 99.07 C9 C1 99.07
BOT 0 9 97.67 C1 C10 97.67
TOP 9 0 97.67 C10 C1 97.67
BOT 0 10 98.60 C1 C11 98.60
TOP 10 0 98.60 C11 C1 98.60
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 99.53 C2 C4 99.53
TOP 3 1 99.53 C4 C2 99.53
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 99.53 C2 C6 99.53
TOP 5 1 99.53 C6 C2 99.53
BOT 1 6 98.60 C2 C7 98.60
TOP 6 1 98.60 C7 C2 98.60
BOT 1 7 98.60 C2 C8 98.60
TOP 7 1 98.60 C8 C2 98.60
BOT 1 8 99.07 C2 C9 99.07
TOP 8 1 99.07 C9 C2 99.07
BOT 1 9 97.67 C2 C10 97.67
TOP 9 1 97.67 C10 C2 97.67
BOT 1 10 98.60 C2 C11 98.60
TOP 10 1 98.60 C11 C2 98.60
BOT 2 3 99.53 C3 C4 99.53
TOP 3 2 99.53 C4 C3 99.53
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 99.53 C3 C6 99.53
TOP 5 2 99.53 C6 C3 99.53
BOT 2 6 98.60 C3 C7 98.60
TOP 6 2 98.60 C7 C3 98.60
BOT 2 7 98.60 C3 C8 98.60
TOP 7 2 98.60 C8 C3 98.60
BOT 2 8 99.07 C3 C9 99.07
TOP 8 2 99.07 C9 C3 99.07
BOT 2 9 97.67 C3 C10 97.67
TOP 9 2 97.67 C10 C3 97.67
BOT 2 10 98.60 C3 C11 98.60
TOP 10 2 98.60 C11 C3 98.60
BOT 3 4 99.53 C4 C5 99.53
TOP 4 3 99.53 C5 C4 99.53
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 99.07 C4 C7 99.07
TOP 6 3 99.07 C7 C4 99.07
BOT 3 7 99.07 C4 C8 99.07
TOP 7 3 99.07 C8 C4 99.07
BOT 3 8 98.60 C4 C9 98.60
TOP 8 3 98.60 C9 C4 98.60
BOT 3 9 98.14 C4 C10 98.14
TOP 9 3 98.14 C10 C4 98.14
BOT 3 10 99.07 C4 C11 99.07
TOP 10 3 99.07 C11 C4 99.07
BOT 4 5 99.53 C5 C6 99.53
TOP 5 4 99.53 C6 C5 99.53
BOT 4 6 98.60 C5 C7 98.60
TOP 6 4 98.60 C7 C5 98.60
BOT 4 7 98.60 C5 C8 98.60
TOP 7 4 98.60 C8 C5 98.60
BOT 4 8 99.07 C5 C9 99.07
TOP 8 4 99.07 C9 C5 99.07
BOT 4 9 97.67 C5 C10 97.67
TOP 9 4 97.67 C10 C5 97.67
BOT 4 10 98.60 C5 C11 98.60
TOP 10 4 98.60 C11 C5 98.60
BOT 5 6 99.07 C6 C7 99.07
TOP 6 5 99.07 C7 C6 99.07
BOT 5 7 99.07 C6 C8 99.07
TOP 7 5 99.07 C8 C6 99.07
BOT 5 8 98.60 C6 C9 98.60
TOP 8 5 98.60 C9 C6 98.60
BOT 5 9 98.14 C6 C10 98.14
TOP 9 5 98.14 C10 C6 98.14
BOT 5 10 99.07 C6 C11 99.07
TOP 10 5 99.07 C11 C6 99.07
BOT 6 7 98.14 C7 C8 98.14
TOP 7 6 98.14 C8 C7 98.14
BOT 6 8 97.67 C7 C9 97.67
TOP 8 6 97.67 C9 C7 97.67
BOT 6 9 97.21 C7 C10 97.21
TOP 9 6 97.21 C10 C7 97.21
BOT 6 10 98.14 C7 C11 98.14
TOP 10 6 98.14 C11 C7 98.14
BOT 7 8 98.14 C8 C9 98.14
TOP 8 7 98.14 C9 C8 98.14
BOT 7 9 97.21 C8 C10 97.21
TOP 9 7 97.21 C10 C8 97.21
BOT 7 10 98.14 C8 C11 98.14
TOP 10 7 98.14 C11 C8 98.14
BOT 8 9 96.74 C9 C10 96.74
TOP 9 8 96.74 C10 C9 96.74
BOT 8 10 97.67 C9 C11 97.67
TOP 10 8 97.67 C11 C9 97.67
BOT 9 10 98.14 C10 C11 98.14
TOP 10 9 98.14 C11 C10 98.14
AVG 0 C1 * 99.16
AVG 1 C2 * 99.16
AVG 2 C3 * 99.16
AVG 3 C4 * 99.21
AVG 4 C5 * 99.16
AVG 5 C6 * 99.21
AVG 6 C7 * 98.37
AVG 7 C8 * 98.42
AVG 8 C9 * 98.37
AVG 9 C10 * 97.63
AVG 10 C11 * 98.47
TOT TOT * 98.76
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C2 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C3 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C4 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C5 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C6 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C7 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C8 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C9 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA
C10 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA
C11 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
********************************:**************.**
C1 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C2 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C3 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C4 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C5 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C6 GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC
C7 GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC
C8 GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC
C9 GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC
C10 GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC
C11 GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC
********* *****.***** ***** ***** ***** ******** *
C1 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C2 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C3 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C4 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C5 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C6 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C7 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC
C8 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C9 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC
C10 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C11 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
******************************* ************** ***
C1 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C2 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C3 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C4 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C5 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C6 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C7 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C8 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA
C9 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C10 TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C11 TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA
************** ********.************** ***********
C1 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C2 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C3 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C4 CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
C5 CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
C6 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
C7 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
C8 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C9 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C10 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C11 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
*************************** ******** *************
C1 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C2 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C3 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C4 AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C5 AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C6 AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C7 AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C8 AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C9 AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC
C10 AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C11 AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
**** ******** ** ************** ******************
C1 AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C2 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C3 AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C4 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C5 AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
C6 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C7 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C8 AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG
C9 AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG
C10 AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
C11 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
******** ** *****.*********..*********************
C1 ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C2 ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C3 ATCCACAGTTCCTTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C4 ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C5 ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C6 ATCTACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C7 ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C8 ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C9 ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C10 ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
C11 ATCCACAGTTCCCTATAAGCAAACTGTCCAGTACGATCCCAGGAACAGCG
*** ******** ******.******************************
C1 AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
C2 AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
C3 AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
C4 ACACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
C5 AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
C6 ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG
C7 ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG
C8 ATACCTACAGAGCCATTCAAGAGGAGGGCGGCTACAGCAGCTATGGCCAA
C9 AAACCTACAGAGCCATCCAAGAGGAGGGCGGCTACAGCAACTATGGCCAG
C10 ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTACGGCAAT
C11 ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG
* ************** *****.****************.*** ***.*
C1 TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C2 TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C3 TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C4 TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C5 TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C6 TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C7 TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C8 TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C9 TCCTCGCCACAGGAGGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
C10 GCCGCGCCACAGGAAGTAACCATACCTGTGCAGACTAGGGTCTATCAGCC
C11 TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAGGGTCTATCAGCC
** **********.**.*****:*************.************
C1 CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
C2 CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
C3 CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
C4 CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
C5 CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
C6 GAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
C7 GAATAGATTGGTTCCAGGAAAGAAACCAGCTTCAGCGCCAGTATCCCGGC
C8 CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
C9 CAATAGATTGGTTCCAGGAAAGAAACCAGTTTCAGCGCCAGTATCCCGGC
C10 CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
C11 CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
**************************** :*******************
C1 CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
C2 CGCCGTACAATGTGGTAAACACCCATGATGAGAACATACGCCAGAGCGGC
C3 CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
C4 CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
C5 CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
C6 CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
C7 CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
C8 CGCCGTACAATGTGGTAAACACCCACGACGAGAACATACGCCAGAGCGGC
C9 CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
C10 CGCCGTACAATGTGGTAAACACCCATGATGAGAACATACGCCAGAGCGGC
C11 CGCCGTACAATGTGGTAAACACCCACGACGAGAACATACGCCAGAGCGGC
************************* ** *********************
C1 TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC
C2 TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC
C3 TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC
C4 TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
C5 TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
C6 TCCTTCAATCGTCTCATGTACAGCGTCATTGGTGCCACCGAGTAC
C7 TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
C8 TCTTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
C9 TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
C10 TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAATAC
C11 TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
** *********************** **************.***
>C1
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC
>C2
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCATGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC
>C3
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCTTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC
>C4
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
ACACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
>C5
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA
TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
>C6
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCTACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG
TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC
GAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTCATTGGTGCCACCGAGTAC
>C7
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG
TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC
GAATAGATTGGTTCCAGGAAAGAAACCAGCTTCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
>C8
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG
ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
ATACCTACAGAGCCATTCAAGAGGAGGGCGGCTACAGCAGCTATGGCCAA
TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGACGAGAACATACGCCAGAGCGGC
TCTTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
>C9
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA
GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG
ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
AAACCTACAGAGCCATCCAAGAGGAGGGCGGCTACAGCAACTATGGCCAG
TCCTCGCCACAGGAGGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTTTCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
>C10
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA
GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG
ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTACGGCAAT
GCCGCGCCACAGGAAGTAACCATACCTGTGCAGACTAGGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCATGATGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAATAC
>C11
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCCTATAAGCAAACTGTCCAGTACGATCCCAGGAACAGCG
ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG
TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAGGGTCTATCAGCC
CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC
CGCCGTACAATGTGGTAAACACCCACGACGAGAACATACGCCAGAGCGGC
TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPASAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSSYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGN
AAPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPYKQTVQYDPRNSDTYRAIQEEGGYSNYGQ
SSPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
SFNRLMYSVIGATEY
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 645 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481316563
Setting output file names to "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1902834499
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3280031110
Seed = 467321814
Swapseed = 1481316563
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 8 unique site patterns
Division 2 has 7 unique site patterns
Division 3 has 38 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -2312.078520 -- -24.640631
Chain 2 -- -2316.061243 -- -24.640631
Chain 3 -- -2317.737549 -- -24.640631
Chain 4 -- -2314.264294 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -2300.961089 -- -24.640631
Chain 2 -- -2296.853234 -- -24.640631
Chain 3 -- -2306.512907 -- -24.640631
Chain 4 -- -2302.773877 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-2312.079] (-2316.061) (-2317.738) (-2314.264) * [-2300.961] (-2296.853) (-2306.513) (-2302.774)
500 -- (-1359.381) [-1352.707] (-1366.886) (-1379.359) * (-1351.312) (-1368.900) (-1357.921) [-1350.183] -- 0:00:00
1000 -- [-1339.266] (-1344.178) (-1338.912) (-1352.032) * (-1358.982) (-1336.608) (-1367.174) [-1339.805] -- 0:00:00
1500 -- [-1325.175] (-1339.068) (-1327.201) (-1341.554) * (-1349.233) [-1323.747] (-1346.671) (-1336.891) -- 0:00:00
2000 -- (-1338.346) (-1316.961) [-1316.064] (-1340.773) * (-1333.088) (-1325.828) (-1354.611) [-1327.404] -- 0:08:19
2500 -- (-1327.157) [-1315.701] (-1318.531) (-1338.706) * (-1333.567) (-1317.187) (-1326.824) [-1332.799] -- 0:06:39
3000 -- (-1333.525) (-1325.309) [-1310.347] (-1331.507) * (-1330.808) (-1322.701) (-1338.510) [-1318.145] -- 0:05:32
3500 -- (-1322.743) (-1334.332) [-1314.548] (-1319.209) * (-1329.231) (-1324.625) [-1319.745] (-1322.931) -- 0:04:44
4000 -- (-1315.939) (-1328.349) [-1320.972] (-1322.739) * (-1323.284) (-1328.119) (-1325.467) [-1315.708] -- 0:04:09
4500 -- (-1331.958) (-1323.649) [-1312.320] (-1316.609) * (-1320.501) (-1334.668) [-1314.488] (-1321.223) -- 0:03:41
5000 -- (-1329.802) (-1314.186) [-1312.215] (-1321.368) * (-1328.583) (-1314.918) [-1308.454] (-1320.162) -- 0:03:19
Average standard deviation of split frequencies: 0.093299
5500 -- (-1327.229) (-1324.249) (-1318.083) [-1322.320] * (-1323.130) (-1330.446) (-1312.796) [-1314.693] -- 0:03:00
6000 -- (-1317.529) [-1311.700] (-1308.146) (-1320.556) * (-1320.377) (-1321.939) (-1315.115) [-1315.541] -- 0:05:31
6500 -- (-1313.115) (-1312.650) [-1310.071] (-1315.107) * [-1311.543] (-1333.534) (-1324.083) (-1317.833) -- 0:05:05
7000 -- [-1319.906] (-1312.007) (-1315.829) (-1318.306) * (-1318.020) (-1325.519) [-1319.194] (-1313.194) -- 0:04:43
7500 -- (-1340.327) [-1315.457] (-1315.193) (-1341.106) * (-1335.787) (-1313.919) (-1327.392) [-1312.804] -- 0:04:24
8000 -- (-1335.135) [-1314.231] (-1310.162) (-1326.322) * (-1331.440) (-1313.891) (-1317.435) [-1311.398] -- 0:04:08
8500 -- (-1333.068) (-1321.304) (-1312.645) [-1322.121] * (-1312.105) (-1314.115) (-1317.574) [-1310.181] -- 0:03:53
9000 -- (-1318.291) [-1313.721] (-1310.224) (-1323.035) * (-1312.956) (-1322.057) (-1320.688) [-1307.452] -- 0:03:40
9500 -- (-1332.231) (-1320.123) [-1318.596] (-1311.386) * (-1318.696) (-1307.790) (-1325.693) [-1318.247] -- 0:03:28
10000 -- (-1339.111) (-1327.745) (-1317.672) [-1306.368] * (-1309.939) (-1312.288) (-1334.230) [-1312.818] -- 0:04:57
Average standard deviation of split frequencies: 0.089912
10500 -- (-1320.701) (-1329.460) (-1314.850) [-1307.707] * (-1309.103) [-1315.348] (-1323.164) (-1318.347) -- 0:04:42
11000 -- (-1333.336) [-1315.607] (-1330.716) (-1312.636) * [-1314.938] (-1309.870) (-1337.422) (-1325.641) -- 0:04:29
11500 -- (-1320.184) (-1330.224) [-1319.719] (-1328.452) * (-1324.761) (-1316.740) (-1337.098) [-1316.145] -- 0:04:17
12000 -- (-1320.919) [-1307.531] (-1317.675) (-1330.744) * [-1314.286] (-1323.199) (-1329.323) (-1320.141) -- 0:04:07
12500 -- (-1327.349) [-1304.469] (-1324.929) (-1309.909) * [-1311.329] (-1313.107) (-1332.208) (-1313.361) -- 0:03:57
13000 -- (-1329.231) (-1311.017) (-1322.936) [-1312.552] * (-1328.719) [-1312.575] (-1319.976) (-1320.311) -- 0:03:47
13500 -- [-1317.519] (-1321.459) (-1315.577) (-1318.175) * [-1314.514] (-1320.186) (-1320.549) (-1328.523) -- 0:03:39
14000 -- (-1332.698) (-1312.450) (-1333.273) [-1314.916] * (-1320.752) [-1313.610] (-1305.917) (-1320.066) -- 0:04:41
14500 -- (-1329.177) [-1320.461] (-1324.950) (-1318.723) * (-1332.111) [-1316.168] (-1319.989) (-1308.499) -- 0:04:31
15000 -- (-1328.480) (-1320.823) (-1323.557) [-1303.717] * [-1312.053] (-1325.902) (-1323.721) (-1314.754) -- 0:04:22
Average standard deviation of split frequencies: 0.058926
15500 -- (-1327.753) (-1319.036) (-1332.044) [-1318.633] * (-1311.442) (-1315.118) (-1306.674) [-1316.324] -- 0:04:14
16000 -- [-1311.472] (-1318.725) (-1335.051) (-1322.538) * (-1316.628) [-1316.241] (-1324.550) (-1314.962) -- 0:04:06
16500 -- (-1318.970) [-1314.074] (-1325.518) (-1322.155) * (-1332.801) (-1321.795) [-1315.932] (-1310.991) -- 0:03:58
17000 -- (-1308.369) (-1326.759) [-1316.326] (-1311.334) * (-1321.224) (-1335.780) [-1311.219] (-1316.184) -- 0:03:51
17500 -- (-1317.088) (-1333.863) [-1314.534] (-1321.085) * (-1315.902) (-1317.252) [-1309.324] (-1326.651) -- 0:03:44
18000 -- (-1318.260) (-1317.881) [-1315.705] (-1320.943) * (-1319.107) (-1328.003) [-1326.331] (-1326.580) -- 0:04:32
18500 -- (-1304.597) (-1313.255) [-1314.493] (-1315.899) * [-1307.993] (-1319.894) (-1317.768) (-1334.321) -- 0:04:25
19000 -- (-1320.309) (-1312.739) (-1317.760) [-1312.552] * (-1323.804) (-1333.171) [-1320.072] (-1327.264) -- 0:04:18
19500 -- [-1308.665] (-1316.195) (-1321.104) (-1316.353) * (-1324.835) (-1315.031) (-1308.805) [-1318.309] -- 0:04:11
20000 -- (-1329.177) (-1326.703) [-1313.081] (-1314.997) * (-1317.560) (-1320.966) (-1325.109) [-1317.064] -- 0:04:05
Average standard deviation of split frequencies: 0.043636
20500 -- [-1316.538] (-1333.588) (-1322.217) (-1321.621) * (-1333.437) [-1312.228] (-1334.011) (-1328.261) -- 0:03:58
21000 -- (-1325.219) (-1329.902) (-1327.746) [-1315.009] * (-1324.890) [-1308.351] (-1338.350) (-1331.257) -- 0:03:53
21500 -- (-1324.161) [-1319.146] (-1316.749) (-1322.422) * [-1307.469] (-1309.640) (-1327.638) (-1315.023) -- 0:04:33
22000 -- (-1314.153) (-1323.378) [-1315.243] (-1318.923) * (-1319.763) [-1315.998] (-1331.589) (-1318.054) -- 0:04:26
22500 -- (-1320.541) (-1339.106) [-1317.302] (-1335.114) * [-1314.163] (-1324.638) (-1327.648) (-1322.315) -- 0:04:20
23000 -- (-1317.630) (-1325.846) (-1316.125) [-1309.418] * (-1311.248) [-1318.411] (-1320.997) (-1309.824) -- 0:04:14
23500 -- (-1317.409) [-1317.188] (-1325.183) (-1330.687) * [-1312.780] (-1319.342) (-1327.421) (-1322.539) -- 0:04:09
24000 -- [-1318.504] (-1321.662) (-1341.186) (-1319.320) * (-1320.851) [-1304.991] (-1328.816) (-1340.426) -- 0:04:04
24500 -- (-1316.848) (-1328.435) (-1321.538) [-1313.670] * (-1329.864) (-1308.945) [-1320.276] (-1336.983) -- 0:03:58
25000 -- [-1313.419] (-1332.492) (-1316.903) (-1313.583) * (-1329.691) [-1325.620] (-1318.952) (-1336.892) -- 0:03:54
Average standard deviation of split frequencies: 0.054393
25500 -- (-1317.302) (-1332.765) [-1308.989] (-1322.082) * (-1317.273) (-1311.366) [-1315.192] (-1324.178) -- 0:04:27
26000 -- [-1311.379] (-1322.041) (-1302.811) (-1323.745) * [-1305.410] (-1318.807) (-1328.172) (-1317.633) -- 0:04:22
26500 -- (-1326.925) (-1320.625) [-1310.398] (-1317.989) * (-1304.687) [-1310.594] (-1336.967) (-1313.725) -- 0:04:17
27000 -- (-1320.404) (-1319.227) [-1309.539] (-1315.521) * (-1322.471) (-1317.153) [-1318.756] (-1319.871) -- 0:04:12
27500 -- (-1321.345) (-1318.569) [-1320.306] (-1317.882) * [-1308.459] (-1307.182) (-1325.411) (-1325.964) -- 0:04:07
28000 -- (-1323.726) [-1307.026] (-1320.502) (-1311.452) * (-1327.379) [-1311.935] (-1316.571) (-1317.874) -- 0:04:03
28500 -- [-1310.823] (-1334.625) (-1316.042) (-1320.684) * (-1306.702) (-1312.605) (-1329.543) [-1310.545] -- 0:03:58
29000 -- (-1323.338) (-1322.364) (-1323.491) [-1311.894] * [-1308.037] (-1322.974) (-1329.488) (-1318.563) -- 0:03:54
29500 -- (-1323.676) [-1317.564] (-1320.132) (-1326.253) * [-1312.423] (-1318.337) (-1342.457) (-1320.724) -- 0:04:23
30000 -- (-1316.587) (-1333.984) (-1321.171) [-1306.855] * [-1310.744] (-1321.099) (-1319.456) (-1322.792) -- 0:04:18
Average standard deviation of split frequencies: 0.045475
30500 -- [-1316.810] (-1311.845) (-1320.282) (-1310.654) * (-1318.388) [-1314.503] (-1319.865) (-1317.317) -- 0:04:14
31000 -- [-1320.762] (-1323.535) (-1320.317) (-1310.595) * [-1317.973] (-1316.033) (-1314.486) (-1315.101) -- 0:04:10
31500 -- [-1307.296] (-1317.559) (-1325.273) (-1321.171) * (-1328.126) (-1324.846) [-1321.667] (-1308.144) -- 0:04:05
32000 -- [-1306.249] (-1324.790) (-1328.413) (-1317.890) * (-1327.085) [-1313.943] (-1314.199) (-1317.355) -- 0:04:02
32500 -- [-1315.239] (-1335.938) (-1332.382) (-1330.148) * (-1328.725) [-1314.031] (-1315.673) (-1312.263) -- 0:03:58
33000 -- (-1309.432) (-1328.769) [-1319.435] (-1325.172) * [-1311.236] (-1318.876) (-1331.568) (-1316.225) -- 0:03:54
33500 -- [-1318.690] (-1334.242) (-1308.518) (-1319.874) * [-1316.954] (-1327.140) (-1329.932) (-1316.670) -- 0:04:19
34000 -- (-1309.959) [-1319.699] (-1326.397) (-1315.245) * (-1332.771) (-1323.394) [-1309.796] (-1316.053) -- 0:04:15
34500 -- [-1311.398] (-1326.210) (-1319.669) (-1305.864) * (-1328.358) (-1322.651) [-1310.436] (-1317.597) -- 0:04:11
35000 -- (-1325.164) (-1317.069) [-1309.154] (-1318.373) * (-1323.127) [-1311.901] (-1317.613) (-1326.492) -- 0:04:08
Average standard deviation of split frequencies: 0.032425
35500 -- (-1317.038) (-1321.954) (-1314.333) [-1310.253] * (-1322.253) [-1315.022] (-1317.644) (-1336.265) -- 0:04:04
36000 -- (-1318.146) (-1329.365) [-1304.562] (-1317.735) * (-1322.081) (-1311.158) (-1316.079) [-1318.259] -- 0:04:01
36500 -- (-1324.268) (-1339.557) [-1310.736] (-1306.755) * (-1311.569) (-1326.148) (-1314.961) [-1310.703] -- 0:03:57
37000 -- [-1317.669] (-1327.108) (-1328.634) (-1313.615) * (-1310.522) (-1321.292) (-1319.944) [-1316.042] -- 0:03:54
37500 -- (-1315.629) (-1315.312) [-1314.466] (-1317.966) * (-1328.494) [-1321.141] (-1321.322) (-1312.147) -- 0:04:16
38000 -- (-1321.292) (-1323.463) (-1312.800) [-1305.964] * (-1318.712) (-1323.461) [-1308.504] (-1322.453) -- 0:04:13
38500 -- (-1310.887) (-1319.233) (-1314.695) [-1313.382] * (-1324.939) [-1308.462] (-1315.680) (-1319.790) -- 0:04:09
39000 -- (-1323.844) (-1314.769) [-1313.508] (-1321.929) * (-1324.972) (-1322.923) [-1319.925] (-1327.696) -- 0:04:06
39500 -- [-1311.370] (-1319.671) (-1319.316) (-1313.788) * [-1319.397] (-1328.482) (-1308.207) (-1317.159) -- 0:04:03
40000 -- (-1312.254) (-1311.650) [-1312.339] (-1323.329) * [-1306.263] (-1312.335) (-1306.248) (-1311.509) -- 0:04:00
Average standard deviation of split frequencies: 0.023184
40500 -- (-1314.604) [-1315.752] (-1319.569) (-1323.512) * (-1316.150) (-1323.432) [-1318.951] (-1314.896) -- 0:03:56
41000 -- (-1321.654) [-1314.222] (-1319.590) (-1331.844) * [-1305.799] (-1326.111) (-1309.311) (-1312.640) -- 0:03:53
41500 -- [-1319.358] (-1310.981) (-1318.324) (-1328.694) * [-1316.703] (-1329.657) (-1309.888) (-1319.635) -- 0:04:14
42000 -- (-1313.094) [-1302.458] (-1318.100) (-1319.600) * [-1309.857] (-1318.512) (-1319.930) (-1317.940) -- 0:04:10
42500 -- (-1317.383) (-1320.370) [-1321.893] (-1315.311) * [-1319.093] (-1321.822) (-1325.712) (-1324.837) -- 0:04:07
43000 -- (-1332.637) (-1319.601) (-1317.346) [-1327.154] * (-1318.460) [-1315.744] (-1320.678) (-1335.633) -- 0:04:04
43500 -- [-1312.281] (-1329.315) (-1318.890) (-1322.076) * (-1319.334) (-1315.331) [-1311.520] (-1318.023) -- 0:04:01
44000 -- (-1324.805) (-1322.952) [-1321.813] (-1320.324) * (-1311.992) (-1327.037) [-1318.907] (-1324.979) -- 0:03:59
44500 -- (-1317.464) [-1306.117] (-1315.577) (-1331.761) * (-1324.328) (-1315.962) (-1317.494) [-1314.465] -- 0:03:56
45000 -- (-1317.002) [-1317.144] (-1331.628) (-1322.038) * (-1322.783) (-1321.251) [-1316.337] (-1326.846) -- 0:03:53
Average standard deviation of split frequencies: 0.023615
45500 -- (-1316.744) [-1325.927] (-1313.139) (-1326.875) * [-1319.650] (-1322.781) (-1313.828) (-1325.036) -- 0:04:11
46000 -- [-1326.234] (-1323.291) (-1318.036) (-1337.647) * (-1329.288) [-1314.429] (-1319.394) (-1320.887) -- 0:04:08
46500 -- (-1328.994) (-1316.218) [-1314.260] (-1322.459) * (-1331.639) (-1329.495) (-1319.520) [-1308.576] -- 0:04:06
47000 -- [-1324.181] (-1324.011) (-1318.250) (-1328.934) * (-1311.540) (-1310.162) (-1323.507) [-1321.691] -- 0:04:03
47500 -- (-1320.211) (-1331.601) [-1311.644] (-1319.820) * (-1310.872) (-1333.469) [-1319.468] (-1320.219) -- 0:04:00
48000 -- [-1311.714] (-1314.623) (-1324.820) (-1320.982) * (-1323.535) (-1312.619) (-1320.412) [-1307.610] -- 0:03:58
48500 -- (-1327.950) [-1323.163] (-1307.929) (-1318.868) * (-1320.643) (-1313.496) (-1323.592) [-1313.216] -- 0:03:55
49000 -- (-1332.933) (-1322.118) [-1311.141] (-1314.390) * (-1319.651) [-1307.383] (-1320.429) (-1328.960) -- 0:04:12
49500 -- (-1331.543) (-1307.136) [-1315.125] (-1330.180) * (-1322.570) (-1319.875) (-1311.436) [-1308.397] -- 0:04:09
50000 -- (-1323.861) (-1314.013) (-1313.458) [-1321.040] * (-1311.925) (-1318.395) [-1311.396] (-1310.007) -- 0:04:06
Average standard deviation of split frequencies: 0.020823
50500 -- (-1309.833) [-1309.955] (-1315.865) (-1331.134) * (-1313.256) (-1322.270) (-1314.918) [-1307.041] -- 0:04:04
51000 -- (-1321.957) (-1306.281) [-1313.311] (-1331.697) * (-1317.670) (-1321.471) [-1309.375] (-1317.039) -- 0:04:01
51500 -- (-1320.315) (-1332.027) (-1317.233) [-1310.264] * (-1313.971) (-1322.308) [-1307.395] (-1321.114) -- 0:03:59
52000 -- (-1321.154) [-1308.966] (-1313.397) (-1325.123) * [-1317.355] (-1310.428) (-1311.245) (-1326.331) -- 0:03:57
52500 -- (-1316.151) (-1315.236) (-1319.983) [-1319.444] * (-1325.708) (-1321.634) (-1319.224) [-1310.275] -- 0:03:54
53000 -- (-1318.193) (-1322.377) (-1316.119) [-1317.804] * (-1316.049) (-1319.432) (-1310.557) [-1317.424] -- 0:04:10
53500 -- (-1327.113) [-1321.324] (-1306.714) (-1324.316) * (-1315.943) (-1315.497) (-1312.217) [-1319.387] -- 0:04:07
54000 -- (-1321.637) (-1313.773) (-1314.779) [-1316.821] * (-1324.026) (-1338.775) [-1321.494] (-1320.152) -- 0:04:05
54500 -- (-1314.365) (-1332.984) (-1312.322) [-1310.970] * (-1317.573) [-1311.960] (-1316.089) (-1329.647) -- 0:04:02
55000 -- (-1315.592) (-1311.391) [-1315.493] (-1306.407) * [-1319.319] (-1313.798) (-1330.468) (-1324.576) -- 0:04:00
Average standard deviation of split frequencies: 0.023341
55500 -- (-1313.053) [-1316.288] (-1318.827) (-1318.949) * [-1320.605] (-1317.354) (-1322.980) (-1319.781) -- 0:03:58
56000 -- (-1324.542) (-1311.744) [-1320.326] (-1320.608) * [-1303.088] (-1320.763) (-1319.913) (-1320.933) -- 0:03:56
56500 -- (-1331.789) (-1325.029) (-1307.798) [-1309.468] * [-1303.542] (-1320.916) (-1319.718) (-1332.098) -- 0:03:53
57000 -- (-1333.169) (-1318.221) [-1318.840] (-1319.832) * (-1318.394) [-1323.041] (-1325.880) (-1320.853) -- 0:04:08
57500 -- (-1333.093) (-1321.517) [-1315.755] (-1321.420) * (-1323.374) (-1324.014) (-1321.187) [-1323.518] -- 0:04:05
58000 -- (-1325.906) (-1318.702) (-1323.723) [-1316.051] * (-1328.185) (-1317.720) [-1311.031] (-1328.087) -- 0:04:03
58500 -- (-1314.236) (-1317.418) (-1314.127) [-1314.689] * (-1331.197) (-1328.520) [-1310.870] (-1322.706) -- 0:04:01
59000 -- (-1317.120) (-1332.638) [-1307.366] (-1321.865) * (-1336.168) [-1320.062] (-1325.655) (-1332.757) -- 0:03:59
59500 -- (-1323.440) (-1312.645) [-1310.426] (-1316.777) * (-1319.299) (-1308.146) [-1314.781] (-1329.651) -- 0:03:57
60000 -- (-1321.360) (-1327.190) (-1313.658) [-1316.389] * (-1326.997) (-1317.999) [-1313.273] (-1314.233) -- 0:03:55
Average standard deviation of split frequencies: 0.024791
60500 -- (-1321.290) (-1322.724) [-1322.032] (-1328.945) * (-1314.067) (-1319.367) (-1316.540) [-1317.074] -- 0:03:52
61000 -- [-1317.587] (-1318.643) (-1315.602) (-1318.525) * [-1322.167] (-1312.638) (-1314.441) (-1326.218) -- 0:04:06
61500 -- (-1317.452) [-1312.624] (-1310.814) (-1323.957) * (-1328.506) [-1312.788] (-1333.823) (-1322.392) -- 0:04:04
62000 -- (-1322.742) (-1312.100) [-1305.890] (-1318.532) * [-1303.754] (-1326.392) (-1304.752) (-1318.573) -- 0:04:02
62500 -- (-1322.119) [-1310.143] (-1319.629) (-1321.258) * (-1326.641) [-1320.210] (-1315.063) (-1330.361) -- 0:04:00
63000 -- (-1327.352) (-1323.043) (-1332.483) [-1309.584] * [-1315.264] (-1308.381) (-1323.780) (-1320.646) -- 0:03:57
63500 -- (-1311.857) [-1312.926] (-1318.674) (-1315.084) * (-1315.572) [-1306.003] (-1314.390) (-1318.880) -- 0:03:55
64000 -- (-1316.552) (-1309.640) [-1317.135] (-1316.998) * [-1318.246] (-1314.321) (-1318.140) (-1330.504) -- 0:03:54
64500 -- (-1328.972) [-1323.676] (-1319.009) (-1327.776) * [-1311.814] (-1334.017) (-1317.908) (-1327.912) -- 0:03:52
65000 -- (-1333.894) (-1322.594) [-1315.952] (-1318.747) * (-1330.914) [-1309.938] (-1328.220) (-1332.912) -- 0:04:04
Average standard deviation of split frequencies: 0.025465
65500 -- (-1313.635) [-1308.433] (-1319.659) (-1313.647) * (-1329.353) [-1338.917] (-1327.401) (-1324.742) -- 0:04:02
66000 -- (-1326.281) (-1313.408) [-1314.337] (-1314.421) * (-1328.223) (-1321.196) [-1315.936] (-1321.968) -- 0:04:00
66500 -- (-1321.887) (-1320.901) (-1323.331) [-1309.441] * (-1313.895) (-1323.755) [-1315.113] (-1315.971) -- 0:03:58
67000 -- (-1324.455) [-1312.725] (-1323.106) (-1333.826) * (-1333.483) [-1307.571] (-1315.263) (-1310.557) -- 0:03:56
67500 -- [-1323.146] (-1319.269) (-1312.472) (-1329.111) * (-1327.279) [-1311.227] (-1311.891) (-1332.976) -- 0:03:54
68000 -- (-1325.231) [-1316.376] (-1317.658) (-1330.344) * (-1324.397) [-1310.344] (-1321.260) (-1322.279) -- 0:03:53
68500 -- (-1316.624) (-1317.782) [-1310.123] (-1317.901) * (-1324.215) [-1308.952] (-1311.169) (-1319.462) -- 0:03:51
69000 -- (-1318.564) [-1317.724] (-1310.957) (-1326.668) * (-1330.142) (-1316.405) [-1309.113] (-1336.875) -- 0:04:02
69500 -- (-1320.202) (-1324.278) [-1308.277] (-1319.976) * (-1334.161) (-1321.525) (-1321.866) [-1318.216] -- 0:04:00
70000 -- (-1319.118) (-1338.246) [-1318.407] (-1320.882) * (-1312.986) [-1311.536] (-1326.392) (-1324.542) -- 0:03:59
Average standard deviation of split frequencies: 0.029715
70500 -- (-1329.686) (-1318.450) (-1313.190) [-1322.853] * (-1317.422) [-1312.182] (-1320.953) (-1312.711) -- 0:03:57
71000 -- (-1320.661) (-1319.134) (-1319.636) [-1326.771] * (-1330.040) (-1325.518) (-1313.324) [-1309.106] -- 0:03:55
71500 -- (-1308.917) (-1335.613) (-1324.167) [-1314.152] * (-1331.311) [-1320.581] (-1318.041) (-1322.393) -- 0:03:53
72000 -- [-1315.851] (-1321.948) (-1319.859) (-1320.618) * (-1319.060) [-1322.857] (-1317.192) (-1322.615) -- 0:03:52
72500 -- (-1321.809) (-1330.602) (-1337.884) [-1307.958] * (-1315.924) (-1327.069) [-1309.074] (-1308.348) -- 0:03:50
73000 -- (-1317.414) (-1332.096) (-1324.949) [-1313.047] * (-1320.550) (-1321.793) [-1307.916] (-1323.043) -- 0:04:01
73500 -- (-1319.493) (-1317.905) (-1315.790) [-1313.922] * (-1319.001) (-1316.099) (-1312.830) [-1314.134] -- 0:03:59
74000 -- [-1309.444] (-1328.938) (-1308.354) (-1319.288) * [-1316.288] (-1322.314) (-1311.902) (-1312.812) -- 0:03:57
74500 -- (-1314.668) (-1333.851) [-1309.946] (-1326.219) * [-1327.916] (-1306.572) (-1322.227) (-1321.738) -- 0:03:56
75000 -- (-1316.889) (-1318.450) [-1308.695] (-1323.820) * [-1321.848] (-1307.990) (-1324.053) (-1348.792) -- 0:03:54
Average standard deviation of split frequencies: 0.024811
75500 -- [-1318.181] (-1330.485) (-1326.244) (-1327.884) * [-1314.235] (-1324.154) (-1316.966) (-1342.624) -- 0:03:52
76000 -- [-1310.850] (-1318.876) (-1322.737) (-1318.382) * [-1311.120] (-1319.299) (-1309.079) (-1337.223) -- 0:03:51
76500 -- (-1312.065) (-1328.597) (-1319.047) [-1310.496] * (-1323.191) (-1334.231) [-1309.235] (-1319.634) -- 0:03:49
77000 -- (-1311.016) (-1321.662) [-1310.205] (-1320.742) * (-1327.203) [-1317.769] (-1306.872) (-1330.043) -- 0:03:59
77500 -- (-1322.111) [-1309.684] (-1309.205) (-1324.534) * (-1328.756) (-1327.993) (-1310.698) [-1314.022] -- 0:03:58
78000 -- (-1329.115) (-1316.353) [-1311.166] (-1313.227) * [-1313.655] (-1321.876) (-1325.935) (-1318.912) -- 0:03:56
78500 -- (-1325.660) (-1327.229) (-1321.110) [-1320.760] * (-1312.775) (-1326.079) (-1332.236) [-1314.786] -- 0:03:54
79000 -- [-1310.702] (-1305.244) (-1325.371) (-1327.875) * (-1320.437) [-1303.136] (-1333.790) (-1311.369) -- 0:03:53
79500 -- [-1309.719] (-1320.892) (-1308.677) (-1315.151) * (-1327.710) [-1302.846] (-1326.649) (-1318.817) -- 0:03:51
80000 -- (-1321.321) (-1322.257) (-1311.336) [-1302.175] * (-1312.759) (-1308.029) [-1324.199] (-1312.064) -- 0:03:50
Average standard deviation of split frequencies: 0.026032
80500 -- (-1336.712) [-1314.926] (-1325.122) (-1307.691) * (-1335.942) [-1309.810] (-1322.353) (-1320.813) -- 0:03:48
81000 -- (-1320.917) (-1320.116) (-1331.875) [-1314.876] * (-1311.133) (-1314.907) (-1333.976) [-1315.377] -- 0:03:58
81500 -- (-1318.250) (-1323.858) (-1323.014) [-1314.904] * [-1326.139] (-1322.711) (-1329.597) (-1325.580) -- 0:03:56
82000 -- [-1321.378] (-1313.228) (-1320.373) (-1319.049) * (-1314.020) [-1308.196] (-1318.224) (-1324.863) -- 0:03:55
82500 -- (-1318.942) (-1316.071) [-1313.889] (-1315.579) * [-1314.929] (-1320.780) (-1316.620) (-1324.191) -- 0:03:53
83000 -- (-1323.177) [-1313.876] (-1329.248) (-1325.613) * (-1324.961) (-1321.458) [-1315.066] (-1315.538) -- 0:03:52
83500 -- (-1321.955) (-1315.239) (-1318.965) [-1316.063] * [-1315.554] (-1312.361) (-1330.937) (-1321.244) -- 0:03:50
84000 -- [-1310.115] (-1321.998) (-1323.459) (-1322.156) * [-1315.788] (-1327.134) (-1333.920) (-1333.750) -- 0:03:49
84500 -- (-1312.132) (-1318.713) (-1323.265) [-1310.797] * (-1320.510) [-1312.365] (-1335.656) (-1320.300) -- 0:03:47
85000 -- (-1314.225) (-1321.266) (-1338.321) [-1321.806] * (-1316.753) (-1323.044) (-1323.233) [-1305.862] -- 0:03:56
Average standard deviation of split frequencies: 0.024417
85500 -- (-1315.306) (-1321.329) (-1335.580) [-1311.216] * (-1317.606) (-1316.992) (-1311.135) [-1306.146] -- 0:03:55
86000 -- [-1308.117] (-1317.827) (-1308.533) (-1308.236) * (-1319.967) (-1324.110) [-1310.728] (-1318.459) -- 0:03:53
86500 -- (-1318.785) (-1320.170) (-1313.642) [-1318.617] * [-1306.189] (-1316.828) (-1321.344) (-1307.068) -- 0:03:52
87000 -- (-1312.776) (-1335.641) [-1320.382] (-1328.131) * [-1309.214] (-1337.617) (-1316.540) (-1305.954) -- 0:03:50
87500 -- (-1335.668) (-1321.145) (-1325.331) [-1313.907] * (-1308.355) (-1324.876) (-1322.775) [-1305.727] -- 0:03:49
88000 -- (-1317.951) [-1318.224] (-1325.821) (-1326.202) * (-1318.941) (-1330.992) (-1326.136) [-1314.640] -- 0:03:48
88500 -- (-1313.337) [-1312.756] (-1338.293) (-1321.161) * (-1315.358) (-1324.597) [-1309.865] (-1314.916) -- 0:03:46
89000 -- (-1333.735) [-1319.659] (-1328.160) (-1310.165) * [-1312.077] (-1333.592) (-1330.181) (-1320.167) -- 0:03:55
89500 -- (-1314.555) [-1320.094] (-1321.084) (-1316.702) * (-1325.462) [-1304.556] (-1315.359) (-1320.437) -- 0:03:53
90000 -- (-1310.058) (-1327.654) (-1318.853) [-1307.684] * (-1320.977) (-1328.761) [-1308.770] (-1324.562) -- 0:03:52
Average standard deviation of split frequencies: 0.024815
90500 -- (-1326.541) (-1316.515) (-1314.859) [-1311.386] * (-1325.705) (-1308.987) (-1322.265) [-1308.221] -- 0:03:51
91000 -- (-1316.870) (-1319.053) (-1314.519) [-1309.423] * [-1313.688] (-1313.792) (-1331.579) (-1314.343) -- 0:03:49
91500 -- [-1311.748] (-1320.270) (-1316.742) (-1319.992) * (-1315.266) (-1315.414) (-1328.857) [-1321.042] -- 0:03:48
92000 -- [-1314.658] (-1333.308) (-1312.194) (-1306.441) * (-1318.633) (-1335.118) (-1317.974) [-1313.826] -- 0:03:47
92500 -- [-1317.940] (-1327.387) (-1324.254) (-1317.717) * [-1311.257] (-1322.185) (-1319.146) (-1333.127) -- 0:03:55
93000 -- (-1308.513) (-1327.210) (-1324.778) [-1312.727] * (-1316.004) [-1315.834] (-1324.587) (-1308.418) -- 0:03:54
93500 -- (-1318.917) [-1305.297] (-1319.698) (-1332.557) * (-1320.232) (-1317.330) (-1328.142) [-1316.065] -- 0:03:52
94000 -- (-1322.596) [-1310.112] (-1316.444) (-1320.580) * (-1313.612) [-1306.710] (-1325.721) (-1310.174) -- 0:03:51
94500 -- (-1318.912) [-1319.988] (-1314.937) (-1314.026) * [-1315.923] (-1315.823) (-1323.117) (-1321.214) -- 0:03:49
95000 -- (-1309.852) [-1308.582] (-1325.765) (-1320.955) * (-1319.976) (-1312.108) (-1319.363) [-1304.797] -- 0:03:48
Average standard deviation of split frequencies: 0.024106
95500 -- (-1315.440) [-1311.764] (-1311.564) (-1330.297) * (-1310.633) [-1309.312] (-1326.178) (-1315.899) -- 0:03:47
96000 -- (-1318.374) [-1307.832] (-1326.807) (-1322.998) * (-1335.066) [-1316.843] (-1327.699) (-1316.713) -- 0:03:46
96500 -- (-1324.447) [-1314.691] (-1314.186) (-1324.870) * (-1317.155) (-1318.805) (-1317.005) [-1308.769] -- 0:03:54
97000 -- (-1314.749) (-1319.125) [-1313.696] (-1338.006) * (-1320.894) [-1310.867] (-1332.466) (-1319.593) -- 0:03:52
97500 -- [-1316.572] (-1325.966) (-1317.625) (-1324.940) * (-1308.175) [-1318.140] (-1315.816) (-1323.554) -- 0:03:51
98000 -- (-1316.951) (-1320.851) [-1306.538] (-1327.882) * (-1322.816) (-1315.833) (-1320.568) [-1308.423] -- 0:03:50
98500 -- (-1322.820) (-1328.606) [-1306.433] (-1322.119) * (-1319.795) [-1315.209] (-1317.249) (-1325.788) -- 0:03:48
99000 -- [-1312.811] (-1322.993) (-1312.049) (-1325.435) * (-1331.254) (-1316.573) [-1311.191] (-1310.689) -- 0:03:47
99500 -- (-1330.424) (-1324.271) [-1308.863] (-1324.023) * [-1314.853] (-1325.616) (-1305.898) (-1318.196) -- 0:03:46
100000 -- [-1311.483] (-1336.307) (-1308.933) (-1321.754) * (-1323.289) [-1315.872] (-1321.675) (-1328.802) -- 0:03:45
Average standard deviation of split frequencies: 0.026458
100500 -- (-1316.010) (-1320.736) [-1314.341] (-1324.848) * (-1329.002) (-1321.683) (-1315.857) [-1308.829] -- 0:03:52
101000 -- [-1301.626] (-1314.791) (-1324.551) (-1317.620) * (-1318.608) (-1313.113) (-1305.035) [-1303.014] -- 0:03:51
101500 -- (-1317.994) (-1315.046) (-1315.229) [-1319.145] * (-1319.889) [-1313.178] (-1311.300) (-1312.397) -- 0:03:50
102000 -- (-1314.535) (-1316.150) [-1325.884] (-1328.373) * (-1311.733) (-1317.161) [-1310.320] (-1308.556) -- 0:03:48
102500 -- (-1314.221) [-1312.520] (-1313.073) (-1315.171) * (-1314.229) (-1323.003) (-1326.739) [-1310.344] -- 0:03:47
103000 -- (-1327.857) (-1314.927) (-1310.257) [-1311.007] * (-1327.883) (-1315.947) [-1310.014] (-1318.568) -- 0:03:46
103500 -- (-1348.325) (-1320.312) (-1311.699) [-1312.927] * (-1324.490) [-1316.529] (-1316.778) (-1331.561) -- 0:03:45
104000 -- (-1309.088) (-1324.233) (-1314.614) [-1313.199] * (-1318.837) (-1322.233) [-1309.380] (-1322.720) -- 0:03:44
104500 -- (-1319.945) (-1319.107) (-1325.516) [-1311.040] * [-1307.558] (-1322.132) (-1321.341) (-1312.573) -- 0:03:51
105000 -- (-1312.431) (-1333.638) [-1310.871] (-1320.200) * [-1306.666] (-1331.242) (-1324.328) (-1319.145) -- 0:03:50
Average standard deviation of split frequencies: 0.023507
105500 -- (-1316.018) (-1312.144) [-1314.488] (-1322.172) * (-1315.474) [-1326.463] (-1318.843) (-1318.545) -- 0:03:48
106000 -- [-1306.908] (-1321.055) (-1333.671) (-1320.734) * (-1327.452) (-1306.862) [-1308.853] (-1314.122) -- 0:03:47
106500 -- (-1312.443) (-1318.171) [-1307.545] (-1332.514) * (-1311.698) [-1321.543] (-1319.559) (-1322.543) -- 0:03:46
107000 -- [-1316.268] (-1308.692) (-1317.555) (-1311.887) * (-1317.258) [-1317.113] (-1313.149) (-1316.105) -- 0:03:45
107500 -- [-1311.216] (-1319.288) (-1321.870) (-1316.383) * (-1326.024) (-1316.024) (-1319.487) [-1312.525] -- 0:03:44
108000 -- (-1315.612) [-1321.118] (-1324.447) (-1319.238) * (-1333.739) (-1325.795) (-1316.938) [-1315.996] -- 0:03:43
108500 -- (-1336.656) [-1309.174] (-1312.729) (-1310.835) * (-1323.729) [-1320.350] (-1320.403) (-1316.037) -- 0:03:50
109000 -- (-1331.253) (-1317.387) (-1315.692) [-1311.074] * (-1333.789) [-1312.279] (-1316.716) (-1332.833) -- 0:03:48
109500 -- (-1329.300) [-1317.882] (-1314.681) (-1312.873) * (-1317.291) [-1314.388] (-1302.784) (-1328.414) -- 0:03:47
110000 -- (-1335.088) (-1312.751) [-1317.533] (-1315.678) * [-1322.052] (-1316.005) (-1316.116) (-1340.147) -- 0:03:46
Average standard deviation of split frequencies: 0.021907
110500 -- (-1325.810) (-1319.173) [-1314.129] (-1316.715) * (-1318.358) (-1329.109) [-1316.906] (-1335.911) -- 0:03:45
111000 -- (-1324.372) (-1323.852) (-1320.628) [-1309.763] * [-1306.765] (-1314.591) (-1314.891) (-1322.972) -- 0:03:44
111500 -- (-1324.721) (-1327.174) (-1314.267) [-1311.328] * (-1309.215) [-1313.123] (-1309.017) (-1329.317) -- 0:03:43
112000 -- (-1335.080) (-1335.780) (-1322.667) [-1305.442] * (-1313.082) (-1315.737) [-1312.613] (-1333.723) -- 0:03:42
112500 -- (-1333.137) (-1325.305) [-1312.031] (-1316.114) * [-1312.185] (-1319.471) (-1314.043) (-1321.612) -- 0:03:48
113000 -- (-1318.888) (-1330.312) [-1323.266] (-1324.119) * [-1320.253] (-1321.018) (-1319.626) (-1319.432) -- 0:03:47
113500 -- (-1330.648) (-1315.060) (-1331.399) [-1308.263] * (-1315.843) (-1314.426) (-1340.522) [-1312.456] -- 0:03:46
114000 -- (-1329.377) (-1311.813) [-1309.353] (-1330.449) * (-1327.379) [-1310.637] (-1330.399) (-1321.759) -- 0:03:45
114500 -- (-1320.770) (-1325.279) [-1310.101] (-1327.283) * [-1316.138] (-1313.084) (-1326.530) (-1312.962) -- 0:03:44
115000 -- (-1316.883) (-1319.214) [-1319.209] (-1317.354) * [-1308.197] (-1320.404) (-1317.350) (-1318.349) -- 0:03:43
Average standard deviation of split frequencies: 0.019352
115500 -- (-1330.346) [-1310.827] (-1317.221) (-1325.204) * (-1331.406) (-1313.034) (-1312.083) [-1314.073] -- 0:03:42
116000 -- (-1321.355) (-1312.281) [-1315.805] (-1326.083) * (-1318.095) (-1323.868) [-1317.288] (-1311.226) -- 0:03:48
116500 -- (-1342.399) (-1315.551) [-1312.749] (-1323.754) * (-1319.200) (-1327.610) (-1313.964) [-1312.457] -- 0:03:47
117000 -- (-1335.271) (-1307.692) [-1310.116] (-1315.534) * (-1319.559) [-1308.534] (-1335.394) (-1321.173) -- 0:03:46
117500 -- (-1328.746) (-1319.459) [-1325.221] (-1307.784) * (-1324.700) (-1313.095) [-1317.679] (-1331.524) -- 0:03:45
118000 -- (-1324.119) (-1329.454) [-1321.192] (-1312.976) * (-1323.452) (-1319.650) [-1303.115] (-1325.524) -- 0:03:44
118500 -- (-1313.734) (-1314.889) (-1331.336) [-1312.069] * [-1304.842] (-1323.256) (-1315.021) (-1328.391) -- 0:03:43
119000 -- (-1333.378) [-1314.353] (-1317.257) (-1318.057) * [-1316.038] (-1325.275) (-1314.289) (-1316.394) -- 0:03:42
119500 -- (-1331.472) [-1311.685] (-1322.174) (-1320.706) * (-1309.586) [-1313.975] (-1323.389) (-1333.026) -- 0:03:41
120000 -- (-1338.138) (-1307.231) [-1308.753] (-1309.956) * [-1317.544] (-1316.727) (-1322.161) (-1333.866) -- 0:03:47
Average standard deviation of split frequencies: 0.019178
120500 -- [-1329.086] (-1318.166) (-1322.678) (-1311.195) * (-1318.264) (-1330.978) [-1321.457] (-1318.142) -- 0:03:46
121000 -- (-1316.886) (-1331.764) (-1314.579) [-1327.755] * [-1315.487] (-1311.890) (-1307.965) (-1325.379) -- 0:03:45
121500 -- (-1320.564) (-1330.083) [-1311.798] (-1315.715) * (-1315.733) (-1313.025) (-1325.112) [-1317.479] -- 0:03:44
122000 -- (-1335.062) [-1309.960] (-1317.611) (-1314.088) * (-1325.472) (-1319.526) (-1323.943) [-1310.605] -- 0:03:43
122500 -- (-1334.614) (-1313.455) (-1327.281) [-1313.013] * (-1320.015) [-1313.847] (-1326.677) (-1313.684) -- 0:03:42
123000 -- (-1336.002) (-1321.125) (-1313.684) [-1315.762] * (-1322.191) (-1334.336) [-1306.758] (-1320.473) -- 0:03:41
123500 -- (-1322.217) (-1314.009) (-1325.601) [-1320.527] * (-1313.414) [-1324.912] (-1316.547) (-1336.791) -- 0:03:40
124000 -- (-1328.208) (-1316.102) [-1313.671] (-1319.503) * (-1317.337) (-1311.328) [-1313.528] (-1334.681) -- 0:03:46
124500 -- (-1318.530) [-1311.340] (-1327.672) (-1339.151) * (-1311.400) [-1312.104] (-1320.905) (-1337.473) -- 0:03:45
125000 -- (-1317.870) (-1316.593) (-1317.890) [-1312.611] * (-1319.039) [-1309.341] (-1315.331) (-1319.317) -- 0:03:44
Average standard deviation of split frequencies: 0.018707
125500 -- [-1316.799] (-1325.966) (-1321.781) (-1318.474) * [-1309.892] (-1316.650) (-1309.642) (-1321.117) -- 0:03:42
126000 -- (-1318.333) (-1318.528) [-1307.300] (-1322.215) * [-1310.446] (-1324.725) (-1308.506) (-1329.554) -- 0:03:41
126500 -- (-1318.754) (-1320.544) (-1320.354) [-1309.267] * (-1313.484) [-1312.484] (-1308.546) (-1313.064) -- 0:03:40
127000 -- (-1313.214) (-1317.479) [-1313.144] (-1313.623) * (-1313.432) [-1304.476] (-1317.125) (-1331.425) -- 0:03:39
127500 -- (-1311.777) (-1313.223) [-1316.838] (-1326.670) * (-1324.040) (-1314.515) [-1305.108] (-1309.782) -- 0:03:38
128000 -- (-1314.657) [-1309.044] (-1313.709) (-1322.274) * (-1326.177) (-1328.032) [-1308.668] (-1322.213) -- 0:03:44
128500 -- [-1304.183] (-1314.384) (-1310.888) (-1326.202) * [-1312.894] (-1353.380) (-1311.839) (-1321.139) -- 0:03:43
129000 -- (-1314.055) [-1325.021] (-1317.537) (-1314.622) * (-1322.011) [-1313.359] (-1322.242) (-1320.032) -- 0:03:42
129500 -- (-1320.333) (-1327.028) (-1308.860) [-1317.252] * [-1314.210] (-1315.055) (-1309.562) (-1308.997) -- 0:03:41
130000 -- [-1318.331] (-1333.078) (-1315.433) (-1335.575) * [-1306.486] (-1307.800) (-1316.664) (-1328.971) -- 0:03:40
Average standard deviation of split frequencies: 0.019350
130500 -- [-1321.118] (-1314.896) (-1321.144) (-1328.081) * [-1311.356] (-1323.520) (-1325.597) (-1331.269) -- 0:03:39
131000 -- (-1327.160) (-1322.073) (-1318.906) [-1314.987] * (-1314.307) (-1308.199) (-1322.509) [-1325.180] -- 0:03:38
131500 -- [-1314.088] (-1330.847) (-1309.431) (-1321.906) * [-1311.587] (-1317.376) (-1316.052) (-1323.762) -- 0:03:37
132000 -- (-1319.523) (-1331.876) (-1311.687) [-1318.999] * [-1308.812] (-1314.927) (-1318.001) (-1320.829) -- 0:03:43
132500 -- (-1334.560) [-1321.126] (-1316.735) (-1320.448) * (-1350.588) [-1306.322] (-1310.635) (-1326.333) -- 0:03:42
133000 -- [-1319.833] (-1319.459) (-1313.133) (-1330.322) * (-1334.489) [-1319.991] (-1314.113) (-1320.015) -- 0:03:41
133500 -- (-1327.427) [-1320.379] (-1322.837) (-1321.885) * (-1324.479) (-1304.132) [-1315.343] (-1324.932) -- 0:03:40
134000 -- (-1318.447) [-1315.053] (-1316.065) (-1315.549) * (-1334.465) (-1313.133) [-1314.453] (-1323.751) -- 0:03:39
134500 -- (-1348.353) [-1310.161] (-1323.309) (-1310.963) * (-1311.006) (-1312.114) [-1311.738] (-1315.814) -- 0:03:38
135000 -- (-1311.409) (-1329.813) (-1320.439) [-1317.254] * (-1320.973) (-1321.800) (-1319.456) [-1313.865] -- 0:03:37
Average standard deviation of split frequencies: 0.016701
135500 -- (-1315.998) (-1317.165) [-1317.664] (-1320.950) * [-1313.029] (-1324.962) (-1322.569) (-1325.932) -- 0:03:43
136000 -- (-1324.577) (-1325.061) [-1310.170] (-1315.231) * (-1325.944) [-1323.160] (-1331.179) (-1336.938) -- 0:03:42
136500 -- (-1325.079) [-1314.718] (-1325.981) (-1319.384) * (-1322.958) [-1307.772] (-1317.353) (-1326.916) -- 0:03:41
137000 -- [-1321.467] (-1321.050) (-1327.275) (-1317.598) * (-1317.702) [-1309.727] (-1321.319) (-1344.162) -- 0:03:40
137500 -- (-1320.547) [-1307.296] (-1326.966) (-1326.964) * (-1319.871) [-1314.238] (-1313.647) (-1329.117) -- 0:03:39
138000 -- (-1315.702) [-1309.895] (-1322.882) (-1313.457) * (-1325.525) (-1327.547) [-1315.405] (-1332.762) -- 0:03:38
138500 -- (-1324.129) (-1338.284) (-1327.614) [-1316.914] * (-1333.329) [-1314.792] (-1312.381) (-1308.695) -- 0:03:37
139000 -- (-1313.210) [-1308.130] (-1330.286) (-1315.560) * (-1334.640) [-1319.449] (-1321.396) (-1305.184) -- 0:03:36
139500 -- (-1323.433) [-1307.447] (-1320.032) (-1319.811) * (-1318.395) [-1314.087] (-1317.000) (-1331.130) -- 0:03:42
140000 -- (-1318.975) (-1334.750) (-1324.107) [-1330.263] * [-1316.291] (-1335.622) (-1313.982) (-1319.475) -- 0:03:41
Average standard deviation of split frequencies: 0.015080
140500 -- (-1321.741) [-1314.038] (-1325.941) (-1324.847) * [-1310.655] (-1338.971) (-1310.329) (-1314.933) -- 0:03:40
141000 -- (-1315.347) (-1318.862) (-1340.619) [-1329.073] * (-1313.789) (-1336.653) (-1314.998) [-1311.700] -- 0:03:39
141500 -- (-1323.023) [-1320.244] (-1320.432) (-1307.391) * (-1320.359) (-1328.973) [-1306.843] (-1316.682) -- 0:03:38
142000 -- (-1315.595) (-1321.804) [-1313.160] (-1322.473) * (-1326.341) [-1318.580] (-1313.744) (-1319.359) -- 0:03:37
142500 -- (-1313.730) [-1303.997] (-1329.509) (-1315.706) * [-1313.347] (-1322.206) (-1329.209) (-1318.778) -- 0:03:36
143000 -- (-1319.103) (-1317.589) [-1308.323] (-1314.235) * (-1308.105) (-1303.045) [-1318.389] (-1323.671) -- 0:03:35
143500 -- (-1313.659) (-1318.121) [-1305.139] (-1321.356) * (-1322.297) (-1318.429) (-1315.255) [-1314.342] -- 0:03:40
144000 -- (-1321.266) [-1309.409] (-1309.415) (-1330.621) * (-1328.157) (-1313.148) (-1318.329) [-1317.768] -- 0:03:39
144500 -- [-1312.582] (-1310.637) (-1328.599) (-1331.036) * (-1325.095) (-1314.545) [-1310.559] (-1333.399) -- 0:03:39
145000 -- (-1327.878) (-1315.232) [-1321.648] (-1324.501) * (-1320.040) [-1313.279] (-1318.857) (-1317.481) -- 0:03:38
Average standard deviation of split frequencies: 0.014530
145500 -- (-1313.306) (-1315.953) [-1314.780] (-1313.845) * (-1319.723) [-1314.360] (-1320.002) (-1318.061) -- 0:03:37
146000 -- (-1314.740) (-1326.037) (-1318.631) [-1309.944] * (-1320.827) (-1310.357) [-1314.253] (-1335.872) -- 0:03:36
146500 -- (-1318.949) [-1314.554] (-1326.319) (-1318.515) * (-1325.313) (-1311.994) (-1310.025) [-1311.482] -- 0:03:35
147000 -- (-1316.123) (-1338.011) (-1331.240) [-1312.476] * (-1320.464) [-1313.552] (-1321.678) (-1318.551) -- 0:03:34
147500 -- (-1315.945) (-1334.740) (-1314.102) [-1305.506] * [-1314.741] (-1318.372) (-1319.972) (-1330.762) -- 0:03:39
148000 -- (-1326.380) (-1330.859) [-1315.724] (-1313.205) * (-1320.732) [-1306.371] (-1333.504) (-1319.623) -- 0:03:38
148500 -- [-1323.930] (-1313.454) (-1321.833) (-1327.149) * [-1318.066] (-1322.148) (-1324.077) (-1330.464) -- 0:03:37
149000 -- (-1313.812) (-1315.425) (-1316.505) [-1320.952] * (-1320.654) [-1311.813] (-1327.720) (-1341.032) -- 0:03:37
149500 -- [-1322.615] (-1334.587) (-1325.149) (-1317.319) * (-1325.358) (-1316.558) [-1304.965] (-1317.180) -- 0:03:36
150000 -- (-1323.301) (-1318.394) [-1313.071] (-1311.843) * [-1314.947] (-1316.646) (-1317.516) (-1331.086) -- 0:03:35
Average standard deviation of split frequencies: 0.014506
150500 -- (-1325.651) [-1307.008] (-1317.855) (-1311.601) * (-1315.249) (-1316.033) [-1302.625] (-1330.835) -- 0:03:34
151000 -- (-1323.783) [-1308.263] (-1321.832) (-1309.108) * (-1324.682) (-1316.613) [-1315.780] (-1324.486) -- 0:03:33
151500 -- (-1322.015) [-1310.095] (-1320.591) (-1315.249) * (-1335.675) (-1313.872) [-1305.419] (-1326.087) -- 0:03:38
152000 -- (-1336.549) (-1313.945) (-1315.514) [-1307.457] * [-1321.411] (-1309.731) (-1324.765) (-1318.735) -- 0:03:37
152500 -- (-1332.755) (-1312.288) (-1317.563) [-1309.015] * (-1317.776) (-1306.559) [-1319.537] (-1309.194) -- 0:03:36
153000 -- (-1321.931) (-1322.932) (-1320.061) [-1306.321] * (-1334.705) (-1329.281) (-1315.430) [-1313.272] -- 0:03:35
153500 -- (-1328.959) [-1326.561] (-1323.066) (-1313.213) * (-1323.377) (-1324.083) (-1316.546) [-1311.057] -- 0:03:35
154000 -- (-1336.479) (-1318.064) (-1317.529) [-1321.387] * (-1321.285) [-1312.297] (-1317.038) (-1311.191) -- 0:03:34
154500 -- (-1324.309) (-1316.198) (-1321.825) [-1314.251] * (-1320.656) [-1307.895] (-1321.231) (-1314.469) -- 0:03:33
155000 -- (-1342.134) (-1320.204) (-1326.713) [-1310.138] * (-1314.744) (-1311.074) [-1312.205] (-1315.275) -- 0:03:32
Average standard deviation of split frequencies: 0.016817
155500 -- (-1317.132) (-1314.200) [-1318.370] (-1317.680) * (-1318.736) [-1313.019] (-1327.577) (-1339.356) -- 0:03:37
156000 -- (-1318.258) [-1313.354] (-1328.310) (-1316.503) * (-1323.023) (-1318.457) (-1317.715) [-1314.023] -- 0:03:36
156500 -- (-1314.816) (-1327.626) [-1318.541] (-1311.699) * [-1314.584] (-1322.737) (-1322.692) (-1312.938) -- 0:03:35
157000 -- (-1324.543) (-1326.460) (-1320.232) [-1313.545] * (-1312.045) (-1308.193) (-1319.203) [-1315.941] -- 0:03:34
157500 -- (-1323.211) (-1330.554) (-1327.944) [-1324.153] * (-1337.198) (-1311.290) (-1318.037) [-1323.671] -- 0:03:33
158000 -- (-1317.057) (-1324.203) [-1317.206] (-1316.782) * (-1314.857) (-1310.481) [-1317.338] (-1315.247) -- 0:03:33
158500 -- [-1307.084] (-1324.135) (-1314.181) (-1319.973) * (-1312.653) (-1316.844) [-1316.881] (-1328.178) -- 0:03:32
159000 -- (-1321.406) [-1323.993] (-1323.627) (-1313.095) * [-1316.006] (-1324.294) (-1313.666) (-1308.827) -- 0:03:31
159500 -- [-1313.770] (-1316.182) (-1315.360) (-1315.773) * (-1324.198) (-1320.635) (-1313.228) [-1307.851] -- 0:03:36
160000 -- (-1307.355) (-1312.956) [-1328.771] (-1337.248) * (-1341.985) [-1310.753] (-1329.380) (-1313.163) -- 0:03:35
Average standard deviation of split frequencies: 0.017071
160500 -- (-1326.944) (-1319.060) [-1317.423] (-1325.176) * (-1319.291) (-1332.275) (-1314.595) [-1307.113] -- 0:03:34
161000 -- (-1324.290) (-1318.599) (-1317.410) [-1321.226] * (-1321.351) (-1317.565) (-1323.256) [-1316.371] -- 0:03:33
161500 -- [-1312.275] (-1310.081) (-1314.700) (-1328.671) * (-1321.347) (-1322.023) (-1316.708) [-1314.680] -- 0:03:32
162000 -- (-1315.292) (-1319.306) (-1321.783) [-1301.904] * (-1327.572) (-1317.336) (-1327.929) [-1308.410] -- 0:03:32
162500 -- (-1326.418) (-1313.253) (-1315.471) [-1303.141] * [-1320.887] (-1317.205) (-1339.751) (-1315.975) -- 0:03:31
163000 -- [-1322.874] (-1318.025) (-1335.762) (-1312.590) * (-1349.751) (-1312.768) (-1319.161) [-1303.631] -- 0:03:30
163500 -- (-1328.474) (-1320.160) (-1311.539) [-1309.382] * (-1314.570) (-1326.786) (-1320.248) [-1308.957] -- 0:03:34
164000 -- (-1315.158) (-1319.341) [-1307.160] (-1320.016) * (-1336.061) (-1309.624) (-1315.616) [-1315.251] -- 0:03:34
164500 -- (-1324.024) [-1309.140] (-1323.176) (-1322.812) * (-1326.103) [-1312.643] (-1316.024) (-1317.418) -- 0:03:33
165000 -- (-1318.903) [-1315.056] (-1317.378) (-1334.859) * (-1315.328) (-1325.043) (-1317.109) [-1317.470] -- 0:03:32
Average standard deviation of split frequencies: 0.015877
165500 -- (-1315.644) (-1337.586) [-1316.979] (-1318.012) * [-1311.552] (-1306.164) (-1319.465) (-1310.402) -- 0:03:31
166000 -- (-1318.178) (-1327.671) (-1328.262) [-1305.327] * [-1317.618] (-1341.891) (-1309.065) (-1325.445) -- 0:03:31
166500 -- (-1313.655) (-1325.639) (-1323.710) [-1306.508] * (-1333.527) [-1309.892] (-1313.613) (-1313.562) -- 0:03:30
167000 -- (-1323.403) [-1313.572] (-1320.948) (-1309.107) * [-1320.158] (-1313.224) (-1337.536) (-1309.760) -- 0:03:34
167500 -- (-1310.835) (-1319.315) (-1313.204) [-1317.151] * (-1310.959) (-1312.859) (-1314.746) [-1309.672] -- 0:03:33
168000 -- (-1323.378) [-1307.848] (-1307.614) (-1311.617) * (-1308.951) (-1309.991) [-1327.780] (-1317.183) -- 0:03:32
168500 -- (-1324.921) (-1313.214) [-1315.134] (-1314.712) * (-1326.023) [-1315.732] (-1337.125) (-1311.488) -- 0:03:32
169000 -- (-1331.352) (-1314.758) (-1312.062) [-1311.631] * (-1316.010) (-1309.621) (-1335.735) [-1324.090] -- 0:03:31
169500 -- (-1312.507) (-1317.106) (-1311.805) [-1318.738] * (-1327.537) (-1322.345) (-1318.377) [-1301.143] -- 0:03:30
170000 -- (-1318.785) (-1310.206) (-1322.454) [-1319.137] * (-1331.645) (-1332.119) [-1321.320] (-1312.507) -- 0:03:29
Average standard deviation of split frequencies: 0.013450
170500 -- (-1317.800) (-1313.472) (-1312.205) [-1306.011] * (-1331.078) (-1324.697) [-1311.064] (-1311.825) -- 0:03:29
171000 -- [-1305.761] (-1307.512) (-1318.220) (-1323.485) * (-1324.473) [-1313.456] (-1311.294) (-1312.517) -- 0:03:33
171500 -- (-1319.254) [-1307.413] (-1321.653) (-1321.346) * (-1323.391) [-1309.621] (-1316.410) (-1315.464) -- 0:03:32
172000 -- (-1316.741) [-1316.358] (-1307.615) (-1312.439) * (-1308.807) (-1317.780) (-1322.785) [-1303.792] -- 0:03:31
172500 -- [-1311.086] (-1321.172) (-1321.136) (-1317.301) * (-1320.731) (-1318.886) (-1314.579) [-1322.730] -- 0:03:31
173000 -- (-1315.476) [-1312.709] (-1326.349) (-1318.115) * (-1322.885) [-1319.170] (-1313.112) (-1326.993) -- 0:03:30
173500 -- (-1317.707) (-1325.367) [-1314.864] (-1325.940) * [-1316.645] (-1317.128) (-1324.880) (-1310.876) -- 0:03:29
174000 -- (-1322.604) (-1335.690) (-1322.057) [-1315.830] * (-1323.620) (-1308.302) (-1327.889) [-1312.925] -- 0:03:28
174500 -- (-1318.496) (-1323.641) [-1318.581] (-1328.259) * (-1313.548) (-1314.712) (-1340.308) [-1307.177] -- 0:03:28
175000 -- (-1316.472) (-1304.807) (-1310.276) [-1314.970] * (-1315.237) [-1316.036] (-1319.621) (-1315.200) -- 0:03:32
Average standard deviation of split frequencies: 0.011878
175500 -- (-1318.572) (-1315.769) (-1318.778) [-1315.436] * (-1327.412) (-1328.566) (-1317.970) [-1313.248] -- 0:03:31
176000 -- (-1318.224) [-1315.583] (-1326.302) (-1325.950) * [-1309.766] (-1323.645) (-1319.145) (-1318.334) -- 0:03:30
176500 -- (-1325.329) [-1310.562] (-1318.293) (-1315.814) * [-1315.207] (-1326.314) (-1326.040) (-1325.667) -- 0:03:29
177000 -- (-1319.107) (-1314.957) (-1334.360) [-1324.289] * (-1318.211) (-1329.592) (-1325.440) [-1307.300] -- 0:03:29
177500 -- (-1328.140) [-1310.603] (-1316.915) (-1327.016) * (-1314.464) (-1316.014) [-1319.233] (-1325.465) -- 0:03:28
178000 -- (-1319.746) (-1316.740) (-1327.043) [-1312.227] * (-1311.168) (-1318.614) [-1320.816] (-1324.545) -- 0:03:27
178500 -- (-1308.436) (-1326.738) [-1319.812] (-1327.278) * [-1314.297] (-1317.981) (-1317.421) (-1326.561) -- 0:03:27
179000 -- (-1318.567) (-1330.602) [-1311.735] (-1333.475) * (-1312.901) (-1322.114) (-1321.461) [-1312.212] -- 0:03:30
179500 -- (-1318.010) (-1334.747) [-1316.303] (-1318.270) * (-1314.848) (-1318.507) (-1318.649) [-1312.590] -- 0:03:30
180000 -- (-1327.443) [-1317.074] (-1307.122) (-1313.524) * (-1323.684) (-1327.726) [-1319.023] (-1314.676) -- 0:03:29
Average standard deviation of split frequencies: 0.012809
180500 -- (-1330.977) (-1307.794) (-1307.399) [-1312.866] * [-1306.363] (-1329.469) (-1322.023) (-1311.437) -- 0:03:28
181000 -- (-1329.376) (-1314.661) (-1315.214) [-1315.692] * (-1311.598) (-1336.218) (-1319.404) [-1308.198] -- 0:03:28
181500 -- (-1319.899) (-1308.078) [-1307.383] (-1328.948) * [-1318.732] (-1317.370) (-1334.288) (-1319.639) -- 0:03:27
182000 -- (-1316.985) (-1321.665) (-1322.464) [-1308.981] * (-1320.878) (-1330.412) [-1317.114] (-1315.506) -- 0:03:26
182500 -- (-1323.259) (-1317.938) [-1310.573] (-1312.281) * (-1327.094) [-1331.789] (-1307.938) (-1319.359) -- 0:03:26
183000 -- (-1319.416) (-1321.028) [-1323.992] (-1321.355) * (-1307.399) [-1312.882] (-1318.148) (-1331.551) -- 0:03:29
183500 -- (-1332.702) (-1314.406) [-1320.184] (-1341.868) * (-1312.018) [-1313.240] (-1334.482) (-1317.551) -- 0:03:29
184000 -- (-1317.728) [-1324.587] (-1318.251) (-1328.306) * (-1320.282) (-1319.392) (-1327.512) [-1313.382] -- 0:03:28
184500 -- (-1323.182) (-1313.308) (-1327.388) [-1317.000] * (-1321.887) (-1324.425) [-1316.189] (-1317.124) -- 0:03:27
185000 -- (-1318.502) [-1316.386] (-1331.577) (-1318.534) * [-1309.253] (-1323.901) (-1331.968) (-1307.702) -- 0:03:27
Average standard deviation of split frequencies: 0.013018
185500 -- (-1318.838) (-1307.069) [-1315.104] (-1313.197) * (-1314.242) (-1323.830) (-1322.971) [-1309.964] -- 0:03:26
186000 -- (-1323.042) [-1315.497] (-1315.754) (-1341.630) * (-1319.691) (-1321.410) (-1327.890) [-1315.058] -- 0:03:25
186500 -- (-1310.555) (-1323.602) [-1310.313] (-1316.203) * (-1330.479) (-1315.581) [-1313.196] (-1308.663) -- 0:03:25
187000 -- (-1319.865) (-1310.317) [-1312.474] (-1326.137) * (-1346.682) (-1321.896) (-1319.440) [-1321.950] -- 0:03:28
187500 -- (-1322.275) [-1313.165] (-1315.378) (-1322.190) * (-1324.202) [-1322.393] (-1311.962) (-1327.333) -- 0:03:28
188000 -- [-1314.881] (-1329.703) (-1307.714) (-1328.731) * (-1317.035) (-1321.437) (-1319.119) [-1313.614] -- 0:03:27
188500 -- (-1322.262) (-1335.544) [-1311.577] (-1334.319) * (-1346.965) (-1311.324) [-1319.424] (-1317.757) -- 0:03:26
189000 -- [-1309.378] (-1327.541) (-1328.841) (-1317.836) * (-1314.791) (-1328.953) (-1315.261) [-1320.985] -- 0:03:25
189500 -- (-1313.543) [-1311.578] (-1326.298) (-1320.681) * (-1331.739) [-1315.835] (-1320.368) (-1311.028) -- 0:03:25
190000 -- (-1323.738) [-1309.139] (-1322.940) (-1328.453) * (-1315.520) [-1310.148] (-1323.021) (-1321.913) -- 0:03:24
Average standard deviation of split frequencies: 0.015172
190500 -- (-1320.686) (-1313.056) [-1316.975] (-1336.282) * (-1336.654) [-1310.729] (-1310.509) (-1321.654) -- 0:03:28
191000 -- (-1313.507) [-1307.828] (-1320.300) (-1324.552) * (-1333.500) [-1311.848] (-1312.304) (-1323.926) -- 0:03:27
191500 -- (-1317.184) [-1310.469] (-1325.472) (-1306.176) * (-1328.033) (-1320.907) [-1317.505] (-1333.393) -- 0:03:26
192000 -- (-1326.040) (-1310.310) [-1309.632] (-1319.135) * [-1318.512] (-1316.226) (-1327.524) (-1333.749) -- 0:03:26
192500 -- (-1319.855) [-1314.048] (-1313.786) (-1314.733) * (-1315.389) (-1314.347) (-1317.606) [-1315.752] -- 0:03:25
193000 -- (-1323.710) (-1322.366) (-1331.918) [-1316.344] * (-1325.797) (-1330.219) [-1314.291] (-1315.280) -- 0:03:24
193500 -- (-1333.313) [-1316.680] (-1333.542) (-1324.521) * [-1313.233] (-1320.348) (-1324.055) (-1316.624) -- 0:03:24
194000 -- [-1321.089] (-1320.623) (-1318.283) (-1324.268) * (-1321.605) (-1311.484) (-1315.405) [-1309.311] -- 0:03:23
194500 -- (-1334.868) (-1310.988) [-1311.477] (-1320.550) * (-1331.294) (-1310.291) (-1321.434) [-1314.059] -- 0:03:27
195000 -- (-1324.976) (-1317.290) [-1312.726] (-1326.238) * (-1334.242) [-1309.254] (-1321.925) (-1321.577) -- 0:03:26
Average standard deviation of split frequencies: 0.014316
195500 -- (-1330.316) (-1321.489) [-1308.942] (-1311.573) * (-1327.064) (-1321.309) (-1315.080) [-1318.953] -- 0:03:25
196000 -- [-1318.790] (-1323.352) (-1315.375) (-1314.329) * (-1318.399) [-1308.476] (-1313.310) (-1330.270) -- 0:03:25
196500 -- (-1328.155) (-1332.432) (-1312.226) [-1308.234] * (-1319.591) [-1306.312] (-1315.525) (-1333.221) -- 0:03:24
197000 -- (-1314.808) [-1316.507] (-1328.228) (-1325.049) * (-1317.962) (-1316.557) [-1311.298] (-1333.239) -- 0:03:23
197500 -- (-1328.748) (-1324.290) (-1325.184) [-1314.222] * [-1314.687] (-1313.228) (-1310.192) (-1327.766) -- 0:03:23
198000 -- (-1313.046) (-1337.871) (-1318.380) [-1317.265] * (-1319.498) [-1322.680] (-1317.161) (-1336.225) -- 0:03:22
198500 -- (-1332.701) (-1318.408) (-1314.583) [-1314.941] * (-1317.117) [-1310.764] (-1321.822) (-1314.852) -- 0:03:25
199000 -- (-1328.289) (-1312.215) (-1316.229) [-1313.103] * (-1317.856) (-1333.980) [-1321.625] (-1315.682) -- 0:03:25
199500 -- (-1318.646) (-1318.996) (-1333.570) [-1313.976] * (-1322.070) (-1320.949) [-1309.291] (-1326.335) -- 0:03:24
200000 -- [-1316.823] (-1324.253) (-1328.722) (-1315.268) * (-1322.267) [-1317.579] (-1320.592) (-1320.297) -- 0:03:24
Average standard deviation of split frequencies: 0.015773
200500 -- (-1330.279) (-1318.147) (-1327.343) [-1314.311] * [-1318.895] (-1322.010) (-1313.913) (-1310.425) -- 0:03:23
201000 -- (-1330.220) (-1322.464) [-1315.643] (-1326.359) * (-1339.443) [-1320.166] (-1314.517) (-1324.388) -- 0:03:22
201500 -- (-1330.640) (-1335.301) [-1315.320] (-1313.139) * (-1327.768) (-1316.263) [-1312.790] (-1317.687) -- 0:03:22
202000 -- (-1314.244) (-1335.482) [-1310.099] (-1322.763) * (-1318.304) (-1318.651) [-1307.530] (-1319.500) -- 0:03:25
202500 -- (-1329.598) (-1313.974) (-1319.130) [-1314.968] * (-1310.421) [-1312.255] (-1323.233) (-1328.339) -- 0:03:24
203000 -- (-1325.449) (-1319.679) (-1331.929) [-1315.728] * [-1312.084] (-1313.683) (-1317.322) (-1343.039) -- 0:03:24
203500 -- (-1324.011) (-1323.880) (-1336.868) [-1326.724] * [-1314.498] (-1319.912) (-1322.218) (-1321.979) -- 0:03:23
204000 -- (-1328.211) (-1317.947) [-1318.683] (-1315.365) * (-1312.412) [-1310.893] (-1321.193) (-1321.758) -- 0:03:22
204500 -- (-1324.816) (-1321.056) [-1313.646] (-1319.032) * (-1329.274) [-1311.407] (-1315.913) (-1321.214) -- 0:03:22
205000 -- [-1312.387] (-1344.645) (-1327.676) (-1319.406) * (-1312.650) [-1305.190] (-1314.221) (-1332.122) -- 0:03:21
Average standard deviation of split frequencies: 0.015707
205500 -- [-1311.300] (-1322.128) (-1325.258) (-1315.087) * [-1313.460] (-1312.384) (-1317.397) (-1323.602) -- 0:03:21
206000 -- (-1307.547) (-1315.464) (-1320.128) [-1324.738] * (-1319.389) (-1314.638) (-1341.058) [-1319.813] -- 0:03:24
206500 -- (-1311.878) (-1339.392) [-1313.806] (-1323.524) * (-1308.659) (-1321.894) (-1315.725) [-1313.751] -- 0:03:23
207000 -- (-1311.506) (-1323.337) (-1315.319) [-1310.122] * (-1312.891) [-1305.889] (-1324.253) (-1331.059) -- 0:03:23
207500 -- [-1324.346] (-1333.732) (-1328.633) (-1322.892) * (-1306.623) [-1310.785] (-1328.333) (-1342.054) -- 0:03:22
208000 -- (-1312.413) (-1319.945) [-1322.035] (-1335.792) * (-1314.390) (-1305.357) [-1307.136] (-1340.588) -- 0:03:21
208500 -- (-1310.062) [-1307.238] (-1332.443) (-1311.836) * (-1322.327) (-1312.177) [-1310.080] (-1325.983) -- 0:03:21
209000 -- [-1313.818] (-1327.310) (-1317.042) (-1313.590) * [-1314.056] (-1318.645) (-1311.451) (-1325.139) -- 0:03:20
209500 -- (-1309.172) (-1326.582) [-1309.190] (-1325.822) * [-1302.422] (-1316.617) (-1313.645) (-1314.969) -- 0:03:19
210000 -- (-1311.967) (-1322.243) (-1327.018) [-1314.230] * (-1321.821) (-1311.202) [-1315.088] (-1314.151) -- 0:03:23
Average standard deviation of split frequencies: 0.017582
210500 -- (-1311.697) (-1329.442) (-1318.321) [-1319.729] * (-1327.319) (-1319.409) (-1317.882) [-1305.097] -- 0:03:22
211000 -- (-1309.100) (-1328.550) [-1301.139] (-1324.402) * (-1326.278) (-1319.020) [-1313.647] (-1324.491) -- 0:03:21
211500 -- (-1316.733) (-1319.696) (-1322.761) [-1307.993] * (-1318.896) (-1333.775) (-1315.438) [-1308.593] -- 0:03:21
212000 -- (-1321.357) (-1334.637) [-1314.283] (-1321.882) * (-1319.927) (-1329.996) (-1316.181) [-1314.463] -- 0:03:20
212500 -- (-1320.349) (-1329.999) [-1314.000] (-1303.837) * (-1335.176) (-1327.681) (-1314.349) [-1316.578] -- 0:03:20
213000 -- (-1319.656) (-1318.381) [-1317.762] (-1319.325) * (-1314.722) (-1318.734) [-1312.013] (-1323.492) -- 0:03:19
213500 -- (-1326.466) (-1330.457) [-1315.897] (-1304.864) * (-1323.399) (-1328.030) [-1319.716] (-1312.473) -- 0:03:18
214000 -- (-1323.775) (-1354.701) (-1315.972) [-1310.586] * (-1336.373) (-1326.851) (-1323.799) [-1314.512] -- 0:03:22
214500 -- (-1317.128) (-1316.522) [-1318.390] (-1332.228) * (-1313.933) (-1319.027) [-1325.650] (-1345.022) -- 0:03:21
215000 -- (-1316.278) [-1321.761] (-1332.382) (-1325.178) * [-1311.176] (-1324.849) (-1319.937) (-1323.004) -- 0:03:20
Average standard deviation of split frequencies: 0.017261
215500 -- (-1313.381) (-1319.379) [-1318.259] (-1321.822) * [-1323.124] (-1315.709) (-1305.337) (-1315.257) -- 0:03:20
216000 -- [-1311.757] (-1336.449) (-1320.707) (-1328.429) * (-1323.450) [-1312.136] (-1319.625) (-1317.615) -- 0:03:19
216500 -- (-1313.016) (-1339.623) [-1310.269] (-1320.209) * (-1319.768) (-1326.813) [-1307.590] (-1310.544) -- 0:03:19
217000 -- [-1305.192] (-1326.566) (-1318.417) (-1325.712) * [-1306.223] (-1325.475) (-1333.890) (-1333.617) -- 0:03:18
217500 -- [-1308.881] (-1319.386) (-1324.282) (-1317.586) * [-1318.238] (-1342.874) (-1316.919) (-1320.297) -- 0:03:17
218000 -- (-1317.018) [-1315.593] (-1319.215) (-1332.971) * (-1322.191) [-1315.412] (-1324.908) (-1316.232) -- 0:03:20
218500 -- [-1306.887] (-1338.489) (-1318.367) (-1314.235) * (-1311.686) [-1315.172] (-1320.238) (-1326.813) -- 0:03:20
219000 -- (-1323.339) (-1314.266) (-1334.585) [-1308.175] * [-1310.569] (-1326.228) (-1318.254) (-1311.154) -- 0:03:19
219500 -- (-1319.263) [-1318.267] (-1314.807) (-1335.974) * (-1322.474) (-1332.213) [-1321.249] (-1315.161) -- 0:03:19
220000 -- (-1314.291) (-1323.214) [-1310.988] (-1316.389) * (-1312.619) (-1318.152) (-1313.469) [-1314.670] -- 0:03:18
Average standard deviation of split frequencies: 0.017867
220500 -- (-1313.947) [-1314.267] (-1315.502) (-1330.476) * [-1320.339] (-1324.038) (-1319.711) (-1316.139) -- 0:03:17
221000 -- [-1308.695] (-1329.399) (-1313.935) (-1313.867) * (-1337.529) (-1326.236) (-1320.456) [-1317.414] -- 0:03:17
221500 -- (-1313.225) (-1340.560) (-1324.529) [-1315.765] * (-1314.750) [-1311.630] (-1318.087) (-1323.274) -- 0:03:20
222000 -- (-1308.932) (-1326.625) [-1311.874] (-1328.265) * [-1313.858] (-1325.428) (-1316.661) (-1333.718) -- 0:03:19
222500 -- (-1314.198) (-1317.966) [-1306.630] (-1313.047) * (-1328.904) (-1329.401) [-1314.570] (-1333.998) -- 0:03:19
223000 -- (-1311.358) (-1318.497) [-1306.683] (-1330.204) * (-1319.917) [-1314.204] (-1316.746) (-1328.436) -- 0:03:18
223500 -- (-1320.760) (-1323.465) [-1315.741] (-1328.361) * (-1312.414) (-1317.053) (-1325.600) [-1322.104] -- 0:03:18
224000 -- (-1327.778) (-1325.640) [-1307.497] (-1316.506) * (-1335.228) (-1308.060) (-1334.900) [-1314.154] -- 0:03:17
224500 -- (-1333.724) (-1327.533) (-1316.276) [-1320.128] * (-1312.444) (-1309.495) (-1323.806) [-1307.720] -- 0:03:16
225000 -- [-1319.149] (-1323.436) (-1320.549) (-1327.268) * [-1313.119] (-1309.494) (-1317.378) (-1322.667) -- 0:03:16
Average standard deviation of split frequencies: 0.016687
225500 -- (-1313.794) [-1312.251] (-1328.268) (-1323.493) * [-1320.588] (-1327.327) (-1319.526) (-1312.665) -- 0:03:19
226000 -- (-1318.377) (-1312.099) [-1311.730] (-1315.725) * (-1321.130) (-1321.855) [-1314.561] (-1313.721) -- 0:03:18
226500 -- (-1317.662) (-1324.825) [-1313.990] (-1332.534) * (-1321.025) (-1308.665) (-1322.355) [-1316.786] -- 0:03:18
227000 -- (-1322.296) [-1306.826] (-1315.190) (-1329.149) * (-1333.859) (-1332.939) (-1315.734) [-1309.750] -- 0:03:17
227500 -- (-1326.340) [-1312.500] (-1321.200) (-1319.974) * (-1330.240) (-1320.367) [-1309.662] (-1323.864) -- 0:03:16
228000 -- (-1320.060) (-1317.657) [-1307.060] (-1319.831) * (-1328.932) (-1330.794) [-1321.581] (-1320.607) -- 0:03:16
228500 -- (-1325.558) (-1318.988) [-1310.532] (-1313.058) * [-1321.307] (-1330.563) (-1320.041) (-1319.595) -- 0:03:15
229000 -- [-1318.249] (-1328.292) (-1335.391) (-1327.483) * (-1320.204) [-1314.772] (-1325.341) (-1316.318) -- 0:03:15
229500 -- [-1311.801] (-1326.529) (-1313.568) (-1320.650) * (-1317.845) (-1322.196) (-1321.358) [-1315.251] -- 0:03:18
230000 -- [-1312.297] (-1311.008) (-1311.945) (-1330.419) * (-1328.873) (-1309.967) [-1310.997] (-1306.817) -- 0:03:17
Average standard deviation of split frequencies: 0.015792
230500 -- (-1327.508) [-1305.482] (-1312.808) (-1335.669) * (-1325.228) (-1316.772) (-1318.738) [-1312.394] -- 0:03:16
231000 -- (-1319.950) (-1312.446) [-1313.287] (-1325.033) * (-1319.593) (-1317.260) (-1318.605) [-1315.152] -- 0:03:16
231500 -- (-1328.444) (-1317.407) (-1318.460) [-1313.468] * (-1318.169) (-1318.927) (-1332.556) [-1304.383] -- 0:03:15
232000 -- (-1321.274) [-1323.587] (-1308.837) (-1323.032) * [-1314.290] (-1316.162) (-1329.409) (-1326.948) -- 0:03:15
232500 -- (-1327.677) [-1318.194] (-1323.080) (-1320.515) * [-1323.866] (-1314.412) (-1315.725) (-1323.275) -- 0:03:14
233000 -- (-1338.816) (-1313.570) (-1319.003) [-1324.288] * (-1317.252) [-1315.398] (-1319.266) (-1324.777) -- 0:03:14
233500 -- (-1329.729) [-1306.200] (-1327.183) (-1321.230) * [-1316.555] (-1324.827) (-1311.923) (-1327.603) -- 0:03:16
234000 -- (-1329.154) [-1311.615] (-1334.356) (-1320.164) * (-1320.856) (-1323.957) [-1310.991] (-1322.536) -- 0:03:16
234500 -- (-1327.648) [-1308.525] (-1323.468) (-1317.626) * [-1311.089] (-1316.730) (-1310.607) (-1322.931) -- 0:03:15
235000 -- (-1324.930) (-1311.832) [-1314.474] (-1309.738) * (-1319.695) (-1323.878) (-1305.380) [-1315.680] -- 0:03:15
Average standard deviation of split frequencies: 0.014709
235500 -- [-1313.957] (-1321.742) (-1314.168) (-1320.606) * (-1334.782) [-1316.089] (-1317.562) (-1326.097) -- 0:03:14
236000 -- [-1316.548] (-1323.134) (-1322.033) (-1315.423) * [-1318.114] (-1327.626) (-1318.278) (-1325.870) -- 0:03:14
236500 -- (-1309.754) (-1319.924) (-1321.859) [-1318.086] * (-1310.127) (-1325.663) [-1315.562] (-1317.099) -- 0:03:13
237000 -- (-1336.203) (-1314.713) [-1313.933] (-1324.549) * (-1308.992) (-1315.303) [-1314.159] (-1329.377) -- 0:03:16
237500 -- (-1309.895) (-1319.594) (-1334.320) [-1313.390] * (-1323.393) (-1310.832) (-1315.527) [-1316.846] -- 0:03:15
238000 -- [-1315.426] (-1312.837) (-1324.306) (-1317.169) * (-1315.310) (-1335.451) (-1311.829) [-1312.371] -- 0:03:15
238500 -- (-1326.134) (-1309.302) (-1308.501) [-1319.010] * [-1305.760] (-1322.355) (-1323.997) (-1314.269) -- 0:03:14
239000 -- (-1312.674) (-1310.589) (-1311.446) [-1324.036] * [-1313.249] (-1309.079) (-1335.922) (-1323.916) -- 0:03:14
239500 -- (-1312.427) (-1335.180) (-1310.246) [-1311.358] * [-1314.101] (-1313.552) (-1326.057) (-1327.044) -- 0:03:13
240000 -- [-1319.659] (-1324.244) (-1329.294) (-1315.028) * (-1320.067) [-1316.281] (-1329.287) (-1343.801) -- 0:03:13
Average standard deviation of split frequencies: 0.015403
240500 -- (-1309.515) (-1319.236) (-1326.638) [-1317.493] * (-1332.188) [-1305.695] (-1314.901) (-1308.599) -- 0:03:12
241000 -- [-1312.635] (-1326.345) (-1314.092) (-1312.584) * (-1324.181) (-1312.826) (-1314.031) [-1305.254] -- 0:03:15
241500 -- (-1324.939) [-1320.754] (-1332.800) (-1317.403) * (-1320.434) (-1311.932) (-1317.846) [-1304.634] -- 0:03:14
242000 -- (-1329.258) (-1310.944) [-1306.995] (-1319.251) * [-1309.300] (-1314.439) (-1320.995) (-1309.467) -- 0:03:14
242500 -- (-1319.724) [-1316.953] (-1313.033) (-1319.012) * [-1310.925] (-1307.381) (-1321.578) (-1317.306) -- 0:03:13
243000 -- (-1310.536) (-1329.100) (-1318.032) [-1311.692] * (-1317.335) [-1310.995] (-1312.573) (-1313.075) -- 0:03:13
243500 -- (-1332.798) (-1324.963) [-1305.162] (-1321.902) * (-1314.122) [-1311.677] (-1324.741) (-1326.822) -- 0:03:12
244000 -- (-1320.946) (-1316.139) (-1303.121) [-1307.092] * (-1311.458) (-1322.427) [-1315.272] (-1314.488) -- 0:03:12
244500 -- (-1326.572) (-1339.337) [-1306.171] (-1323.154) * [-1310.197] (-1316.356) (-1324.200) (-1318.504) -- 0:03:11
245000 -- (-1318.540) (-1332.145) [-1313.607] (-1322.761) * [-1321.776] (-1316.234) (-1311.018) (-1335.976) -- 0:03:14
Average standard deviation of split frequencies: 0.017080
245500 -- (-1312.264) [-1318.665] (-1310.821) (-1324.847) * (-1313.387) [-1309.190] (-1318.151) (-1328.693) -- 0:03:13
246000 -- (-1314.970) (-1318.279) (-1314.053) [-1310.563] * (-1320.628) (-1321.539) [-1323.763] (-1329.480) -- 0:03:13
246500 -- (-1326.073) (-1318.294) (-1333.452) [-1308.519] * (-1325.888) (-1332.318) [-1315.142] (-1331.235) -- 0:03:12
247000 -- [-1311.699] (-1328.220) (-1325.558) (-1318.229) * (-1319.150) (-1335.242) [-1310.335] (-1320.080) -- 0:03:12
247500 -- (-1326.741) (-1317.696) [-1319.140] (-1331.146) * (-1324.840) (-1330.483) [-1314.003] (-1318.370) -- 0:03:11
248000 -- (-1316.115) [-1316.489] (-1315.290) (-1309.877) * (-1339.412) (-1316.613) (-1317.411) [-1315.237] -- 0:03:11
248500 -- (-1316.891) (-1329.808) [-1312.861] (-1321.778) * (-1321.325) [-1310.226] (-1320.534) (-1311.626) -- 0:03:10
249000 -- (-1315.688) [-1324.751] (-1330.741) (-1309.172) * [-1311.848] (-1317.136) (-1326.865) (-1310.492) -- 0:03:13
249500 -- (-1319.443) [-1321.053] (-1319.098) (-1311.813) * (-1318.495) (-1321.000) [-1320.548] (-1318.820) -- 0:03:12
250000 -- (-1313.423) (-1323.445) (-1324.782) [-1305.276] * (-1329.692) (-1314.327) (-1340.835) [-1317.958] -- 0:03:12
Average standard deviation of split frequencies: 0.017498
250500 -- (-1327.174) (-1326.736) (-1309.663) [-1309.070] * (-1324.616) (-1320.380) [-1329.038] (-1314.249) -- 0:03:11
251000 -- (-1321.147) (-1325.325) (-1312.018) [-1310.921] * (-1329.818) [-1311.684] (-1327.976) (-1322.531) -- 0:03:10
251500 -- (-1313.475) (-1338.073) (-1318.178) [-1312.444] * [-1307.640] (-1326.395) (-1328.893) (-1319.846) -- 0:03:10
252000 -- (-1310.383) (-1334.489) [-1313.212] (-1319.584) * (-1320.195) (-1324.472) (-1318.014) [-1318.675] -- 0:03:09
252500 -- (-1316.964) (-1323.301) (-1314.716) [-1310.438] * (-1315.351) (-1320.397) [-1318.513] (-1327.510) -- 0:03:09
253000 -- [-1316.775] (-1314.656) (-1320.110) (-1315.246) * (-1315.742) (-1312.222) [-1315.723] (-1311.556) -- 0:03:11
253500 -- (-1323.941) (-1319.710) (-1328.217) [-1308.531] * (-1326.557) (-1322.613) [-1311.888] (-1312.631) -- 0:03:11
254000 -- (-1333.147) (-1321.954) (-1333.597) [-1315.661] * (-1318.430) (-1320.742) (-1334.265) [-1322.428] -- 0:03:10
254500 -- [-1309.840] (-1324.203) (-1319.384) (-1313.030) * (-1312.224) (-1320.032) (-1313.575) [-1308.865] -- 0:03:10
255000 -- (-1320.814) (-1314.946) (-1312.117) [-1312.551] * [-1310.473] (-1328.388) (-1325.633) (-1314.129) -- 0:03:09
Average standard deviation of split frequencies: 0.015987
255500 -- (-1315.241) (-1327.013) [-1325.662] (-1305.107) * (-1318.480) (-1332.331) (-1319.932) [-1313.929] -- 0:03:09
256000 -- (-1326.532) (-1313.519) (-1312.111) [-1318.146] * [-1305.139] (-1322.997) (-1327.259) (-1319.756) -- 0:03:08
256500 -- (-1320.960) [-1317.819] (-1318.669) (-1314.936) * (-1323.694) [-1314.450] (-1316.799) (-1313.934) -- 0:03:08
257000 -- (-1321.557) [-1313.680] (-1324.099) (-1323.444) * (-1329.644) (-1328.742) [-1309.609] (-1324.196) -- 0:03:10
257500 -- (-1321.169) [-1312.765] (-1321.861) (-1337.466) * (-1334.423) (-1322.926) [-1307.722] (-1315.896) -- 0:03:10
258000 -- (-1340.797) [-1309.528] (-1316.745) (-1330.322) * (-1319.013) [-1320.221] (-1319.666) (-1323.507) -- 0:03:09
258500 -- (-1334.813) (-1313.349) (-1324.335) [-1313.056] * (-1312.627) (-1327.587) [-1318.636] (-1333.333) -- 0:03:09
259000 -- (-1323.209) [-1308.497] (-1317.329) (-1324.546) * (-1310.719) [-1321.274] (-1316.916) (-1336.195) -- 0:03:08
259500 -- (-1316.025) [-1309.298] (-1315.848) (-1325.583) * [-1317.821] (-1324.996) (-1325.848) (-1313.173) -- 0:03:08
260000 -- (-1330.016) [-1311.378] (-1314.361) (-1316.410) * [-1313.008] (-1314.429) (-1319.055) (-1320.750) -- 0:03:07
Average standard deviation of split frequencies: 0.016852
260500 -- (-1322.739) [-1321.477] (-1312.149) (-1311.289) * [-1307.040] (-1334.020) (-1312.531) (-1320.781) -- 0:03:07
261000 -- (-1316.839) [-1321.573] (-1326.354) (-1322.741) * (-1327.346) [-1312.496] (-1311.418) (-1332.656) -- 0:03:09
261500 -- (-1332.307) [-1307.894] (-1313.803) (-1323.416) * (-1324.762) (-1321.760) (-1324.289) [-1316.780] -- 0:03:09
262000 -- (-1331.741) (-1333.803) (-1324.496) [-1312.955] * [-1310.031] (-1314.985) (-1327.312) (-1308.843) -- 0:03:08
262500 -- (-1325.474) [-1314.334] (-1316.337) (-1324.350) * [-1321.593] (-1308.313) (-1324.919) (-1317.959) -- 0:03:08
263000 -- [-1313.249] (-1317.796) (-1337.744) (-1325.778) * (-1311.884) (-1311.756) (-1341.907) [-1317.701] -- 0:03:07
263500 -- (-1320.481) (-1338.657) [-1327.230] (-1319.031) * (-1316.634) [-1313.103] (-1318.926) (-1316.956) -- 0:03:07
264000 -- (-1332.207) [-1310.222] (-1321.083) (-1320.953) * (-1309.679) [-1311.321] (-1317.754) (-1310.667) -- 0:03:06
264500 -- (-1328.441) [-1310.030] (-1309.085) (-1311.560) * (-1306.875) (-1313.831) (-1320.277) [-1307.232] -- 0:03:09
265000 -- (-1325.857) (-1316.104) [-1315.752] (-1327.152) * (-1321.648) (-1312.088) [-1313.808] (-1323.466) -- 0:03:08
Average standard deviation of split frequencies: 0.014486
265500 -- (-1332.399) [-1307.057] (-1317.798) (-1323.428) * (-1310.753) [-1314.414] (-1325.784) (-1322.019) -- 0:03:08
266000 -- (-1329.644) (-1316.669) [-1315.363] (-1322.576) * (-1320.973) (-1324.648) [-1308.806] (-1325.382) -- 0:03:07
266500 -- (-1320.372) (-1310.741) [-1311.667] (-1319.735) * (-1320.238) (-1332.652) (-1322.643) [-1313.883] -- 0:03:07
267000 -- (-1324.663) (-1315.645) [-1313.989] (-1324.410) * (-1311.880) (-1330.128) (-1323.835) [-1309.060] -- 0:03:06
267500 -- (-1314.222) (-1325.640) [-1309.698] (-1318.630) * (-1313.069) [-1323.152] (-1323.089) (-1312.521) -- 0:03:06
268000 -- (-1315.690) (-1323.532) [-1311.128] (-1314.649) * [-1311.448] (-1316.005) (-1328.146) (-1309.756) -- 0:03:05
268500 -- (-1315.755) (-1324.588) (-1318.737) [-1327.059] * [-1319.881] (-1335.398) (-1322.217) (-1314.684) -- 0:03:07
269000 -- [-1308.880] (-1335.929) (-1325.696) (-1318.739) * [-1309.186] (-1337.561) (-1319.147) (-1311.747) -- 0:03:07
269500 -- [-1313.203] (-1320.860) (-1325.536) (-1324.845) * (-1312.316) [-1317.581] (-1316.101) (-1309.113) -- 0:03:07
270000 -- [-1305.091] (-1313.923) (-1321.723) (-1307.678) * (-1327.024) (-1322.322) [-1314.284] (-1315.143) -- 0:03:06
Average standard deviation of split frequencies: 0.015751
270500 -- [-1303.841] (-1315.529) (-1323.768) (-1318.290) * [-1317.891] (-1321.144) (-1316.060) (-1330.367) -- 0:03:06
271000 -- (-1314.986) [-1313.523] (-1322.848) (-1316.054) * (-1320.490) (-1327.399) (-1330.752) [-1312.537] -- 0:03:05
271500 -- (-1314.459) (-1314.908) [-1311.332] (-1314.678) * (-1313.069) (-1332.593) (-1317.123) [-1318.281] -- 0:03:05
272000 -- (-1311.449) (-1316.974) (-1313.242) [-1315.361] * (-1319.017) [-1320.740] (-1333.056) (-1315.710) -- 0:03:04
272500 -- [-1312.520] (-1319.308) (-1319.062) (-1322.059) * [-1307.266] (-1337.409) (-1315.731) (-1318.183) -- 0:03:06
273000 -- (-1324.091) [-1318.262] (-1329.836) (-1339.754) * (-1328.658) (-1331.354) [-1315.678] (-1312.807) -- 0:03:06
273500 -- (-1313.253) (-1317.130) (-1312.525) [-1321.037] * [-1317.668] (-1313.833) (-1323.700) (-1333.056) -- 0:03:05
274000 -- (-1334.188) (-1319.863) [-1322.946] (-1317.303) * [-1313.563] (-1317.515) (-1313.302) (-1315.478) -- 0:03:05
274500 -- (-1316.719) [-1308.973] (-1337.047) (-1310.829) * (-1328.647) [-1318.201] (-1316.400) (-1321.967) -- 0:03:05
275000 -- [-1319.054] (-1314.590) (-1330.682) (-1318.099) * (-1318.282) (-1318.990) (-1313.929) [-1313.015] -- 0:03:04
Average standard deviation of split frequencies: 0.015743
275500 -- (-1314.928) [-1307.723] (-1330.872) (-1319.546) * [-1307.794] (-1322.505) (-1307.173) (-1312.843) -- 0:03:04
276000 -- (-1313.412) [-1309.705] (-1330.059) (-1312.619) * (-1317.058) (-1308.987) [-1324.829] (-1312.215) -- 0:03:03
276500 -- (-1323.470) (-1315.824) [-1326.929] (-1321.479) * (-1313.857) (-1313.105) [-1310.912] (-1321.422) -- 0:03:05
277000 -- (-1324.386) [-1313.216] (-1326.128) (-1322.783) * (-1326.775) [-1314.858] (-1324.838) (-1322.621) -- 0:03:05
277500 -- (-1313.025) [-1308.826] (-1333.821) (-1321.971) * (-1309.975) (-1344.516) (-1318.197) [-1324.183] -- 0:03:04
278000 -- [-1312.882] (-1316.922) (-1321.063) (-1318.480) * [-1313.914] (-1324.216) (-1318.602) (-1325.578) -- 0:03:04
278500 -- (-1320.564) (-1326.282) [-1320.611] (-1312.813) * (-1321.215) (-1321.254) (-1314.429) [-1311.283] -- 0:03:03
279000 -- (-1333.154) (-1312.648) [-1321.088] (-1305.741) * (-1319.776) (-1317.624) (-1318.184) [-1308.174] -- 0:03:03
279500 -- [-1314.779] (-1325.127) (-1314.011) (-1347.433) * (-1329.131) [-1311.887] (-1320.710) (-1320.355) -- 0:03:05
280000 -- (-1332.965) (-1333.694) (-1314.021) [-1318.606] * (-1328.341) (-1317.678) [-1307.931] (-1321.696) -- 0:03:05
Average standard deviation of split frequencies: 0.014964
280500 -- (-1330.659) [-1319.622] (-1320.203) (-1315.371) * (-1324.786) (-1315.661) [-1308.452] (-1325.201) -- 0:03:04
281000 -- (-1328.626) (-1322.228) (-1315.526) [-1316.499] * (-1325.876) [-1311.704] (-1326.447) (-1321.108) -- 0:03:04
281500 -- (-1327.028) [-1313.068] (-1312.831) (-1344.105) * [-1309.320] (-1322.092) (-1315.045) (-1313.849) -- 0:03:03
282000 -- (-1307.387) (-1338.285) [-1309.741] (-1317.599) * [-1310.358] (-1314.910) (-1315.658) (-1308.945) -- 0:03:03
282500 -- [-1318.355] (-1328.198) (-1314.021) (-1313.295) * (-1315.038) [-1314.358] (-1318.695) (-1308.078) -- 0:03:02
283000 -- (-1312.442) (-1323.510) (-1315.450) [-1308.523] * (-1331.719) (-1322.659) (-1326.354) [-1310.844] -- 0:03:04
283500 -- (-1319.464) [-1315.099] (-1316.376) (-1321.616) * (-1322.045) [-1314.327] (-1339.603) (-1319.205) -- 0:03:04
284000 -- (-1327.514) (-1316.882) [-1310.244] (-1319.678) * (-1313.470) [-1312.706] (-1321.561) (-1317.771) -- 0:03:04
284500 -- (-1319.130) (-1331.072) [-1315.186] (-1316.684) * (-1331.644) [-1307.996] (-1343.046) (-1317.921) -- 0:03:03
285000 -- (-1325.190) (-1323.152) (-1311.102) [-1308.646] * (-1321.047) [-1314.673] (-1314.812) (-1323.510) -- 0:03:03
Average standard deviation of split frequencies: 0.013036
285500 -- (-1331.109) (-1322.085) [-1309.860] (-1321.396) * (-1331.550) (-1316.451) [-1303.334] (-1322.493) -- 0:03:02
286000 -- [-1321.996] (-1325.350) (-1316.567) (-1312.302) * (-1325.698) (-1317.329) [-1309.372] (-1318.104) -- 0:03:02
286500 -- (-1318.361) (-1334.482) (-1316.112) [-1308.516] * (-1312.853) [-1307.580] (-1322.233) (-1336.535) -- 0:03:01
287000 -- (-1330.539) (-1316.723) (-1344.071) [-1319.771] * [-1322.472] (-1312.883) (-1317.078) (-1345.263) -- 0:03:03
287500 -- (-1316.368) (-1326.502) [-1309.509] (-1315.873) * (-1316.746) (-1306.762) [-1314.082] (-1330.792) -- 0:03:03
288000 -- (-1322.111) [-1331.568] (-1312.040) (-1329.134) * (-1326.965) (-1309.409) [-1314.846] (-1320.630) -- 0:03:02
288500 -- (-1347.190) (-1311.463) [-1314.837] (-1319.279) * (-1325.790) (-1315.600) (-1319.504) [-1316.839] -- 0:03:02
289000 -- (-1330.538) (-1310.229) (-1317.646) [-1322.403] * (-1314.499) [-1306.010] (-1309.447) (-1318.837) -- 0:03:02
289500 -- (-1332.515) (-1314.201) (-1315.256) [-1312.275] * (-1329.961) [-1315.276] (-1317.701) (-1316.622) -- 0:03:01
290000 -- (-1332.866) (-1320.820) [-1317.253] (-1316.536) * (-1320.645) (-1333.289) (-1320.290) [-1314.799] -- 0:03:01
Average standard deviation of split frequencies: 0.012532
290500 -- (-1326.526) [-1309.595] (-1315.461) (-1321.452) * (-1323.686) (-1324.129) (-1339.858) [-1315.336] -- 0:03:03
291000 -- (-1318.465) [-1311.881] (-1322.288) (-1317.737) * [-1316.740] (-1318.817) (-1324.638) (-1317.925) -- 0:03:02
291500 -- (-1326.124) (-1314.040) [-1313.050] (-1327.656) * (-1317.261) (-1328.108) [-1319.062] (-1321.682) -- 0:03:02
292000 -- (-1316.749) [-1308.776] (-1319.141) (-1338.099) * [-1307.907] (-1316.818) (-1311.235) (-1310.092) -- 0:03:01
292500 -- [-1316.210] (-1314.400) (-1319.986) (-1325.048) * [-1313.799] (-1316.390) (-1326.448) (-1313.322) -- 0:03:01
293000 -- [-1321.736] (-1307.119) (-1330.374) (-1314.358) * (-1314.287) (-1319.904) [-1315.698] (-1324.844) -- 0:03:00
293500 -- (-1320.010) [-1308.728] (-1334.292) (-1318.646) * (-1316.198) (-1324.031) (-1316.165) [-1306.788] -- 0:03:00
294000 -- [-1316.280] (-1328.384) (-1310.321) (-1325.757) * (-1327.138) (-1314.861) (-1322.414) [-1310.303] -- 0:03:00
294500 -- (-1310.367) (-1323.762) [-1311.820] (-1322.920) * (-1308.805) [-1316.796] (-1324.185) (-1329.449) -- 0:03:02
295000 -- (-1315.171) (-1310.718) [-1319.003] (-1334.356) * [-1320.220] (-1319.903) (-1315.048) (-1317.866) -- 0:03:01
Average standard deviation of split frequencies: 0.013392
295500 -- (-1308.114) [-1305.870] (-1313.767) (-1327.490) * (-1321.308) (-1321.829) [-1313.907] (-1318.505) -- 0:03:01
296000 -- (-1320.154) (-1315.745) (-1319.798) [-1309.806] * (-1318.610) (-1321.903) (-1320.052) [-1311.119] -- 0:03:00
296500 -- (-1316.681) [-1317.242] (-1330.837) (-1314.210) * (-1317.319) (-1320.750) [-1312.356] (-1328.813) -- 0:03:00
297000 -- (-1326.439) (-1331.588) (-1328.757) [-1310.272] * (-1323.880) (-1306.497) [-1320.115] (-1328.057) -- 0:02:59
297500 -- (-1322.893) (-1330.531) [-1312.913] (-1315.251) * (-1324.303) [-1319.728] (-1323.866) (-1313.943) -- 0:02:59
298000 -- (-1322.206) (-1312.611) [-1323.868] (-1325.641) * [-1316.957] (-1321.137) (-1317.005) (-1325.687) -- 0:02:59
298500 -- (-1321.096) (-1327.146) [-1308.605] (-1311.401) * (-1307.682) (-1335.869) [-1309.219] (-1329.542) -- 0:03:00
299000 -- (-1319.581) (-1336.053) [-1317.727] (-1321.224) * [-1307.706] (-1333.130) (-1319.508) (-1340.983) -- 0:03:00
299500 -- (-1313.639) (-1325.307) (-1317.934) [-1315.579] * [-1309.906] (-1330.793) (-1320.951) (-1327.999) -- 0:03:00
300000 -- (-1318.764) (-1324.845) (-1316.769) [-1310.640] * [-1313.931] (-1314.670) (-1333.854) (-1320.228) -- 0:02:59
Average standard deviation of split frequencies: 0.013113
300500 -- [-1312.899] (-1331.712) (-1327.996) (-1316.192) * [-1317.090] (-1331.672) (-1312.024) (-1330.954) -- 0:02:59
301000 -- (-1308.703) (-1307.528) (-1328.096) [-1318.506] * (-1325.737) [-1313.538] (-1317.484) (-1335.401) -- 0:02:58
301500 -- (-1320.451) [-1310.811] (-1345.712) (-1310.982) * [-1317.558] (-1315.236) (-1332.645) (-1334.635) -- 0:02:58
302000 -- (-1318.872) (-1330.221) (-1338.781) [-1313.530] * [-1313.080] (-1313.671) (-1310.407) (-1315.357) -- 0:03:00
302500 -- (-1326.111) (-1325.140) (-1313.724) [-1309.736] * [-1317.096] (-1329.139) (-1328.329) (-1312.937) -- 0:02:59
303000 -- (-1321.837) (-1314.541) (-1328.466) [-1311.883] * (-1316.959) (-1343.495) (-1321.777) [-1313.666] -- 0:02:59
303500 -- (-1306.908) (-1335.420) [-1321.552] (-1326.334) * [-1313.236] (-1320.863) (-1324.957) (-1319.162) -- 0:02:59
304000 -- (-1325.574) [-1310.701] (-1321.255) (-1320.735) * (-1325.630) (-1322.146) [-1313.738] (-1320.398) -- 0:02:58
304500 -- (-1314.180) (-1328.830) (-1309.828) [-1317.667] * (-1335.274) (-1330.420) [-1308.166] (-1321.228) -- 0:02:58
305000 -- (-1319.363) (-1317.799) (-1327.595) [-1320.644] * [-1317.958] (-1332.906) (-1319.213) (-1322.213) -- 0:02:57
Average standard deviation of split frequencies: 0.012257
305500 -- (-1321.862) [-1321.235] (-1323.543) (-1334.466) * (-1324.731) (-1333.174) (-1322.829) [-1314.367] -- 0:02:59
306000 -- (-1314.953) (-1311.930) (-1345.172) [-1312.927] * (-1328.278) (-1332.381) (-1308.622) [-1320.746] -- 0:02:59
306500 -- (-1319.277) (-1318.625) (-1317.403) [-1323.996] * (-1337.706) [-1309.610] (-1322.512) (-1313.856) -- 0:02:58
307000 -- (-1318.138) (-1316.131) [-1318.437] (-1328.940) * [-1324.153] (-1317.533) (-1323.722) (-1323.538) -- 0:02:58
307500 -- (-1317.085) (-1312.864) [-1309.486] (-1329.141) * [-1314.426] (-1325.512) (-1324.223) (-1313.726) -- 0:02:57
308000 -- [-1316.591] (-1312.156) (-1314.415) (-1312.553) * (-1316.467) [-1314.171] (-1320.636) (-1314.281) -- 0:02:57
308500 -- (-1325.302) (-1319.140) [-1320.025] (-1312.226) * (-1322.610) (-1327.635) [-1308.542] (-1321.281) -- 0:02:57
309000 -- (-1315.360) (-1315.437) [-1312.295] (-1327.117) * (-1319.457) (-1332.733) [-1304.433] (-1312.067) -- 0:02:56
309500 -- [-1312.979] (-1324.884) (-1313.872) (-1330.771) * (-1305.876) (-1320.180) (-1323.858) [-1307.215] -- 0:02:58
310000 -- [-1316.147] (-1329.385) (-1318.626) (-1313.114) * (-1314.854) (-1332.321) [-1313.558] (-1315.461) -- 0:02:58
Average standard deviation of split frequencies: 0.012760
310500 -- [-1310.403] (-1328.934) (-1331.171) (-1311.066) * (-1325.779) (-1314.101) (-1310.431) [-1305.579] -- 0:02:57
311000 -- [-1308.228] (-1316.838) (-1312.727) (-1319.425) * (-1309.091) (-1316.458) (-1313.678) [-1306.857] -- 0:02:57
311500 -- (-1307.849) (-1325.732) (-1317.811) [-1315.271] * (-1320.869) (-1319.352) (-1317.089) [-1316.426] -- 0:02:56
312000 -- (-1315.613) (-1315.381) [-1309.920] (-1334.975) * [-1309.137] (-1307.685) (-1324.013) (-1316.317) -- 0:02:56
312500 -- [-1316.131] (-1313.738) (-1318.609) (-1315.507) * (-1317.704) (-1315.556) (-1321.203) [-1313.401] -- 0:02:56
313000 -- (-1321.754) (-1315.264) (-1323.252) [-1311.804] * (-1327.621) (-1335.412) [-1318.364] (-1324.235) -- 0:02:55
313500 -- (-1327.520) (-1336.993) (-1314.703) [-1311.740] * (-1328.926) (-1321.594) [-1304.042] (-1309.428) -- 0:02:57
314000 -- (-1329.071) (-1336.358) [-1314.886] (-1313.791) * [-1314.218] (-1309.884) (-1311.376) (-1320.425) -- 0:02:56
314500 -- [-1311.171] (-1345.610) (-1330.528) (-1319.157) * (-1319.299) [-1319.327] (-1308.657) (-1336.726) -- 0:02:56
315000 -- [-1312.485] (-1324.648) (-1317.958) (-1321.065) * [-1311.977] (-1330.104) (-1312.213) (-1326.856) -- 0:02:56
Average standard deviation of split frequencies: 0.014036
315500 -- (-1313.623) (-1326.052) (-1317.716) [-1315.733] * (-1327.289) [-1317.198] (-1318.135) (-1321.805) -- 0:02:55
316000 -- [-1304.374] (-1316.246) (-1311.279) (-1324.957) * [-1323.172] (-1310.384) (-1333.673) (-1310.749) -- 0:02:55
316500 -- (-1318.208) (-1315.897) (-1309.194) [-1313.981] * (-1320.851) [-1313.743] (-1319.542) (-1315.780) -- 0:02:54
317000 -- (-1316.951) [-1316.502] (-1312.684) (-1309.619) * (-1320.764) (-1311.776) (-1321.738) [-1308.901] -- 0:02:54
317500 -- (-1312.717) (-1326.519) (-1321.142) [-1312.225] * (-1309.041) [-1309.382] (-1322.326) (-1319.459) -- 0:02:56
318000 -- (-1314.450) (-1323.780) [-1305.607] (-1324.171) * (-1324.821) [-1320.671] (-1328.010) (-1343.506) -- 0:02:55
318500 -- [-1315.091] (-1311.065) (-1308.253) (-1321.883) * [-1308.262] (-1317.311) (-1314.083) (-1325.030) -- 0:02:55
319000 -- (-1324.344) (-1330.374) (-1311.085) [-1323.786] * [-1316.692] (-1329.683) (-1315.978) (-1314.766) -- 0:02:55
319500 -- (-1325.848) (-1309.930) (-1323.305) [-1315.852] * (-1314.923) (-1321.378) (-1330.185) [-1319.216] -- 0:02:54
320000 -- (-1313.614) [-1308.439] (-1320.742) (-1321.657) * (-1310.321) [-1319.354] (-1315.273) (-1326.173) -- 0:02:54
Average standard deviation of split frequencies: 0.014033
320500 -- (-1323.692) (-1322.142) (-1319.504) [-1311.008] * [-1316.476] (-1312.363) (-1307.067) (-1323.563) -- 0:02:53
321000 -- [-1305.365] (-1313.356) (-1310.477) (-1319.793) * (-1320.215) [-1314.920] (-1330.314) (-1324.227) -- 0:02:53
321500 -- [-1320.108] (-1316.760) (-1319.546) (-1322.188) * [-1312.588] (-1307.125) (-1331.587) (-1314.474) -- 0:02:55
322000 -- (-1325.775) (-1312.862) [-1319.729] (-1313.119) * (-1343.090) [-1309.588] (-1336.756) (-1322.932) -- 0:02:54
322500 -- (-1307.353) [-1322.000] (-1329.206) (-1319.779) * (-1338.121) (-1317.583) [-1314.774] (-1329.493) -- 0:02:54
323000 -- [-1306.967] (-1319.263) (-1318.149) (-1315.557) * (-1326.526) (-1315.692) [-1310.478] (-1319.420) -- 0:02:53
323500 -- (-1318.740) (-1319.788) [-1315.602] (-1306.159) * (-1323.791) (-1318.892) [-1317.069] (-1328.136) -- 0:02:53
324000 -- (-1318.388) (-1321.131) (-1308.077) [-1310.726] * (-1318.616) [-1313.500] (-1327.064) (-1318.760) -- 0:02:53
324500 -- (-1320.400) (-1313.559) (-1317.505) [-1323.012] * (-1326.726) (-1312.486) [-1307.636] (-1322.029) -- 0:02:52
325000 -- [-1310.055] (-1306.862) (-1303.315) (-1314.302) * (-1322.313) [-1313.191] (-1324.668) (-1315.340) -- 0:02:52
Average standard deviation of split frequencies: 0.014523
325500 -- (-1314.749) (-1322.792) (-1326.572) [-1304.270] * (-1319.601) (-1321.853) [-1318.498] (-1328.163) -- 0:02:54
326000 -- (-1305.865) (-1309.606) (-1322.945) [-1310.896] * (-1317.558) (-1319.785) (-1327.704) [-1313.547] -- 0:02:53
326500 -- (-1312.502) (-1320.668) (-1313.243) [-1317.865] * (-1340.014) (-1322.425) [-1306.903] (-1312.829) -- 0:02:53
327000 -- (-1312.352) (-1328.455) [-1317.414] (-1319.789) * (-1326.904) (-1317.196) [-1310.526] (-1326.218) -- 0:02:52
327500 -- (-1319.081) [-1317.074] (-1311.824) (-1321.803) * (-1327.338) (-1312.690) [-1311.717] (-1326.404) -- 0:02:52
328000 -- (-1327.726) [-1312.954] (-1333.849) (-1325.565) * (-1326.720) (-1344.102) (-1308.868) [-1320.822] -- 0:02:52
328500 -- [-1312.199] (-1329.242) (-1314.444) (-1328.588) * (-1315.219) [-1317.689] (-1314.785) (-1323.969) -- 0:02:51
329000 -- [-1315.611] (-1332.476) (-1313.203) (-1320.200) * (-1339.781) (-1338.819) [-1305.620] (-1310.732) -- 0:02:51
329500 -- (-1329.866) (-1332.637) [-1315.393] (-1326.156) * (-1334.554) [-1311.754] (-1318.663) (-1318.625) -- 0:02:52
330000 -- (-1335.479) (-1321.421) [-1308.925] (-1322.689) * (-1317.655) [-1309.204] (-1323.386) (-1323.649) -- 0:02:52
Average standard deviation of split frequencies: 0.014132
330500 -- (-1324.025) (-1334.380) [-1315.983] (-1318.237) * (-1311.970) (-1326.449) (-1317.116) [-1314.892] -- 0:02:52
331000 -- (-1322.425) (-1333.090) [-1318.791] (-1334.948) * (-1313.544) (-1316.310) [-1319.515] (-1311.218) -- 0:02:51
331500 -- (-1313.668) [-1320.075] (-1320.730) (-1326.696) * (-1316.657) (-1323.240) (-1319.970) [-1315.085] -- 0:02:51
332000 -- [-1321.822] (-1326.340) (-1316.473) (-1321.528) * [-1308.982] (-1316.748) (-1332.270) (-1315.971) -- 0:02:51
332500 -- (-1317.850) [-1324.827] (-1317.150) (-1332.098) * (-1325.388) (-1318.829) (-1336.134) [-1310.260] -- 0:02:50
333000 -- (-1325.598) [-1326.287] (-1310.176) (-1326.547) * (-1315.872) (-1319.484) (-1337.168) [-1309.802] -- 0:02:52
333500 -- (-1326.282) (-1322.207) [-1305.524] (-1315.216) * [-1310.624] (-1322.834) (-1337.334) (-1315.900) -- 0:02:51
334000 -- (-1335.361) (-1321.636) (-1308.732) [-1324.511] * (-1312.632) [-1311.115] (-1340.305) (-1328.186) -- 0:02:51
334500 -- (-1322.073) (-1339.229) (-1319.067) [-1305.327] * (-1308.336) (-1328.867) (-1347.881) [-1312.925] -- 0:02:51
335000 -- (-1322.498) (-1319.418) (-1307.274) [-1317.761] * (-1305.563) [-1323.704] (-1328.946) (-1324.209) -- 0:02:50
Average standard deviation of split frequencies: 0.014701
335500 -- (-1320.423) (-1330.281) [-1312.549] (-1312.285) * (-1312.308) [-1314.423] (-1333.530) (-1329.713) -- 0:02:50
336000 -- (-1322.742) (-1339.631) (-1314.160) [-1311.037] * (-1311.620) [-1315.799] (-1329.686) (-1310.903) -- 0:02:49
336500 -- (-1335.033) (-1311.878) [-1314.437] (-1320.922) * (-1317.096) (-1334.666) (-1334.580) [-1322.233] -- 0:02:49
337000 -- (-1312.811) (-1324.926) (-1319.184) [-1310.064] * (-1331.672) [-1327.468] (-1344.422) (-1315.441) -- 0:02:51
337500 -- (-1324.926) [-1304.579] (-1314.112) (-1304.703) * (-1309.806) (-1340.104) (-1348.952) [-1311.212] -- 0:02:50
338000 -- (-1324.995) (-1308.980) [-1312.956] (-1316.238) * (-1325.542) [-1317.456] (-1336.031) (-1314.062) -- 0:02:50
338500 -- (-1328.037) (-1327.287) (-1320.683) [-1314.399] * [-1319.480] (-1318.189) (-1323.510) (-1322.165) -- 0:02:50
339000 -- [-1319.918] (-1327.616) (-1319.974) (-1321.623) * [-1321.731] (-1323.582) (-1331.337) (-1328.397) -- 0:02:49
339500 -- (-1313.810) (-1311.451) (-1314.479) [-1314.354] * [-1310.556] (-1324.254) (-1347.741) (-1327.766) -- 0:02:49
340000 -- (-1315.292) (-1317.652) (-1337.239) [-1309.867] * [-1321.131] (-1309.736) (-1335.030) (-1317.846) -- 0:02:48
Average standard deviation of split frequencies: 0.013417
340500 -- [-1310.311] (-1310.393) (-1315.910) (-1312.378) * (-1319.371) [-1313.846] (-1339.139) (-1333.211) -- 0:02:50
341000 -- [-1311.811] (-1331.610) (-1312.109) (-1312.779) * (-1320.134) (-1325.068) [-1322.222] (-1337.814) -- 0:02:50
341500 -- (-1323.135) (-1333.742) [-1317.332] (-1305.573) * (-1314.849) [-1307.977] (-1343.017) (-1315.995) -- 0:02:49
342000 -- (-1314.675) (-1333.417) (-1310.272) [-1323.310] * (-1321.959) (-1315.314) (-1333.913) [-1320.240] -- 0:02:49
342500 -- [-1312.419] (-1332.419) (-1314.225) (-1334.982) * (-1314.773) (-1324.641) (-1324.221) [-1312.437] -- 0:02:48
343000 -- [-1313.080] (-1323.831) (-1321.721) (-1339.041) * [-1300.191] (-1322.620) (-1325.809) (-1332.678) -- 0:02:48
343500 -- (-1310.329) [-1310.850] (-1312.495) (-1335.744) * [-1308.630] (-1325.492) (-1335.729) (-1315.991) -- 0:02:48
344000 -- [-1316.514] (-1319.171) (-1319.902) (-1324.300) * [-1308.116] (-1327.491) (-1339.288) (-1314.435) -- 0:02:47
344500 -- (-1314.672) [-1314.217] (-1324.094) (-1335.126) * (-1307.472) [-1310.319] (-1323.926) (-1323.139) -- 0:02:49
345000 -- [-1308.214] (-1323.644) (-1311.446) (-1316.835) * [-1313.383] (-1309.705) (-1322.589) (-1321.538) -- 0:02:48
Average standard deviation of split frequencies: 0.012736
345500 -- (-1320.284) (-1321.914) [-1317.291] (-1316.759) * (-1323.887) (-1307.185) (-1330.607) [-1309.948] -- 0:02:48
346000 -- (-1339.374) [-1321.276] (-1321.833) (-1323.565) * (-1327.107) (-1309.943) (-1316.303) [-1317.583] -- 0:02:48
346500 -- (-1311.810) (-1313.755) [-1317.246] (-1313.511) * (-1322.160) (-1317.453) (-1325.142) [-1318.874] -- 0:02:47
347000 -- (-1313.265) (-1318.716) [-1311.719] (-1317.014) * (-1323.944) [-1318.293] (-1323.461) (-1322.312) -- 0:02:47
347500 -- (-1318.024) (-1312.565) (-1327.867) [-1326.397] * (-1316.491) [-1305.016] (-1324.647) (-1323.031) -- 0:02:47
348000 -- (-1315.120) [-1318.477] (-1322.258) (-1315.740) * (-1326.683) [-1309.191] (-1311.084) (-1326.418) -- 0:02:46
348500 -- (-1308.113) (-1313.877) [-1314.513] (-1321.884) * (-1317.895) [-1316.761] (-1323.859) (-1326.779) -- 0:02:48
349000 -- (-1323.187) [-1319.487] (-1315.283) (-1324.500) * (-1336.838) [-1321.616] (-1316.044) (-1322.463) -- 0:02:47
349500 -- [-1311.192] (-1337.190) (-1310.412) (-1316.853) * (-1316.547) (-1319.219) [-1308.989] (-1326.647) -- 0:02:47
350000 -- [-1311.320] (-1332.342) (-1317.587) (-1315.455) * (-1326.130) (-1325.432) (-1315.670) [-1319.320] -- 0:02:47
Average standard deviation of split frequencies: 0.012391
350500 -- (-1320.558) (-1331.133) [-1308.194] (-1318.193) * (-1317.220) [-1310.910] (-1312.458) (-1329.786) -- 0:02:46
351000 -- (-1314.157) (-1321.605) [-1307.734] (-1314.660) * [-1313.195] (-1321.637) (-1317.252) (-1321.199) -- 0:02:46
351500 -- (-1331.519) (-1318.534) (-1320.912) [-1305.432] * (-1310.394) [-1306.529] (-1314.578) (-1321.918) -- 0:02:46
352000 -- (-1319.758) (-1327.620) [-1322.828] (-1318.655) * [-1324.972] (-1319.815) (-1329.776) (-1321.346) -- 0:02:47
352500 -- (-1324.339) (-1313.915) [-1330.061] (-1324.130) * (-1324.038) [-1312.052] (-1325.994) (-1320.373) -- 0:02:47
353000 -- (-1323.886) (-1319.303) [-1327.365] (-1318.684) * (-1335.613) (-1326.374) (-1323.034) [-1311.239] -- 0:02:46
353500 -- (-1322.254) [-1329.006] (-1331.853) (-1310.168) * [-1324.616] (-1320.407) (-1323.576) (-1325.441) -- 0:02:46
354000 -- [-1313.639] (-1326.167) (-1315.387) (-1306.630) * [-1321.125] (-1320.273) (-1325.689) (-1317.276) -- 0:02:46
354500 -- (-1327.171) (-1306.424) (-1326.430) [-1308.000] * (-1315.302) [-1316.303] (-1322.700) (-1327.588) -- 0:02:45
355000 -- (-1325.431) (-1331.706) (-1325.904) [-1315.913] * [-1305.337] (-1324.677) (-1325.286) (-1313.525) -- 0:02:45
Average standard deviation of split frequencies: 0.012493
355500 -- (-1326.830) (-1313.974) (-1316.877) [-1325.990] * [-1312.131] (-1330.072) (-1310.919) (-1319.178) -- 0:02:46
356000 -- (-1315.627) (-1313.403) [-1313.945] (-1345.258) * (-1325.802) [-1311.523] (-1328.611) (-1316.291) -- 0:02:46
356500 -- (-1325.423) (-1306.844) [-1321.876] (-1338.997) * (-1312.734) (-1317.590) (-1335.064) [-1334.680] -- 0:02:46
357000 -- (-1335.193) [-1309.613] (-1323.940) (-1333.064) * (-1329.096) [-1321.651] (-1330.133) (-1335.944) -- 0:02:45
357500 -- (-1320.411) [-1312.248] (-1329.914) (-1314.567) * (-1312.131) (-1320.242) (-1324.954) [-1306.007] -- 0:02:45
358000 -- [-1326.232] (-1316.442) (-1328.873) (-1317.890) * (-1316.364) [-1307.057] (-1345.462) (-1314.512) -- 0:02:44
358500 -- [-1309.765] (-1339.286) (-1318.156) (-1323.276) * (-1324.860) (-1312.449) (-1335.735) [-1313.462] -- 0:02:44
359000 -- [-1321.138] (-1314.437) (-1308.301) (-1330.952) * [-1311.842] (-1306.437) (-1336.145) (-1329.645) -- 0:02:44
359500 -- (-1315.477) (-1314.780) [-1321.038] (-1320.652) * (-1310.387) [-1309.301] (-1322.678) (-1320.322) -- 0:02:45
360000 -- [-1310.726] (-1327.735) (-1318.333) (-1322.056) * (-1319.452) (-1308.257) (-1322.066) [-1317.383] -- 0:02:45
Average standard deviation of split frequencies: 0.012843
360500 -- (-1319.149) (-1325.496) [-1315.160] (-1307.127) * [-1319.047] (-1315.823) (-1327.539) (-1315.991) -- 0:02:44
361000 -- (-1313.372) (-1318.082) [-1320.925] (-1316.596) * (-1321.751) [-1324.768] (-1325.925) (-1309.733) -- 0:02:44
361500 -- (-1303.182) (-1319.327) [-1322.840] (-1316.907) * [-1311.871] (-1325.928) (-1323.950) (-1331.335) -- 0:02:44
362000 -- (-1314.046) [-1302.614] (-1333.845) (-1306.835) * [-1318.233] (-1321.256) (-1336.354) (-1312.545) -- 0:02:43
362500 -- [-1315.416] (-1324.232) (-1328.156) (-1325.496) * [-1315.718] (-1317.348) (-1332.350) (-1318.222) -- 0:02:43
363000 -- [-1307.613] (-1315.897) (-1317.481) (-1323.279) * (-1319.463) (-1315.745) (-1340.019) [-1313.168] -- 0:02:44
363500 -- (-1326.017) [-1312.274] (-1314.686) (-1316.400) * (-1324.835) (-1319.377) (-1338.082) [-1312.298] -- 0:02:44
364000 -- (-1325.916) (-1308.733) [-1316.490] (-1324.195) * (-1322.493) [-1316.048] (-1343.126) (-1314.970) -- 0:02:44
364500 -- [-1310.338] (-1304.946) (-1330.195) (-1323.397) * (-1321.530) [-1315.749] (-1331.690) (-1307.370) -- 0:02:43
365000 -- (-1314.918) (-1322.753) (-1313.739) [-1312.773] * (-1310.393) [-1319.654] (-1325.177) (-1323.426) -- 0:02:43
Average standard deviation of split frequencies: 0.012264
365500 -- (-1319.891) (-1322.708) (-1317.614) [-1312.236] * (-1310.522) (-1319.898) (-1326.186) [-1321.967] -- 0:02:43
366000 -- (-1318.487) (-1327.100) (-1323.383) [-1310.121] * (-1315.760) (-1328.252) (-1320.004) [-1310.581] -- 0:02:42
366500 -- (-1350.555) (-1313.008) (-1326.705) [-1306.982] * [-1318.583] (-1323.700) (-1324.368) (-1313.333) -- 0:02:42
367000 -- (-1322.016) [-1313.698] (-1320.130) (-1318.702) * (-1315.898) (-1319.031) (-1316.241) [-1328.234] -- 0:02:43
367500 -- (-1321.287) (-1321.625) (-1328.850) [-1306.016] * (-1325.780) (-1317.433) [-1317.713] (-1325.980) -- 0:02:43
368000 -- [-1314.296] (-1318.779) (-1315.348) (-1314.109) * (-1318.339) (-1332.203) (-1327.332) [-1313.259] -- 0:02:43
368500 -- (-1340.395) (-1312.111) (-1310.877) [-1301.590] * (-1309.997) (-1309.653) (-1316.439) [-1319.350] -- 0:02:42
369000 -- (-1321.124) (-1318.159) [-1306.637] (-1314.764) * (-1315.825) [-1311.038] (-1340.131) (-1335.512) -- 0:02:42
369500 -- (-1324.208) (-1313.632) (-1325.807) [-1326.540] * (-1324.362) [-1307.629] (-1324.114) (-1337.111) -- 0:02:42
370000 -- (-1318.204) [-1317.524] (-1330.695) (-1320.271) * (-1312.389) (-1333.781) (-1323.243) [-1309.344] -- 0:02:41
Average standard deviation of split frequencies: 0.012497
370500 -- (-1322.594) (-1322.963) (-1315.022) [-1316.410] * (-1309.841) (-1313.396) (-1326.261) [-1318.566] -- 0:02:41
371000 -- (-1316.065) (-1318.527) (-1345.556) [-1316.761] * (-1315.211) [-1311.893] (-1326.235) (-1325.645) -- 0:02:42
371500 -- (-1317.866) [-1307.957] (-1341.091) (-1327.567) * (-1317.669) [-1311.631] (-1325.052) (-1333.575) -- 0:02:42
372000 -- (-1327.995) [-1317.102] (-1323.665) (-1313.348) * [-1313.021] (-1323.866) (-1323.149) (-1328.510) -- 0:02:42
372500 -- (-1314.732) [-1310.999] (-1320.495) (-1320.440) * (-1313.727) [-1313.121] (-1318.953) (-1337.841) -- 0:02:41
373000 -- (-1320.371) [-1309.988] (-1321.389) (-1313.694) * (-1320.221) [-1317.054] (-1320.976) (-1316.418) -- 0:02:41
373500 -- (-1324.759) [-1310.061] (-1330.842) (-1319.653) * (-1312.136) [-1321.318] (-1311.359) (-1320.324) -- 0:02:41
374000 -- (-1326.671) (-1316.255) (-1326.977) [-1318.660] * (-1317.518) (-1312.691) [-1316.371] (-1324.606) -- 0:02:40
374500 -- (-1317.838) (-1327.062) (-1319.566) [-1301.890] * (-1324.259) (-1334.104) [-1312.450] (-1323.810) -- 0:02:40
375000 -- (-1320.114) (-1332.028) [-1317.620] (-1315.272) * [-1322.588] (-1326.657) (-1312.515) (-1322.179) -- 0:02:41
Average standard deviation of split frequencies: 0.012701
375500 -- [-1309.571] (-1336.365) (-1311.063) (-1316.141) * (-1325.258) (-1324.515) [-1314.032] (-1324.672) -- 0:02:41
376000 -- [-1323.801] (-1324.837) (-1328.376) (-1313.447) * (-1316.784) (-1324.860) [-1324.491] (-1325.826) -- 0:02:40
376500 -- (-1334.002) [-1322.110] (-1326.254) (-1317.661) * [-1314.892] (-1318.090) (-1319.573) (-1309.947) -- 0:02:40
377000 -- (-1331.708) [-1310.544] (-1331.566) (-1315.226) * [-1318.522] (-1309.128) (-1312.281) (-1322.089) -- 0:02:40
377500 -- (-1321.504) (-1331.412) (-1328.674) [-1307.725] * (-1334.276) (-1323.806) [-1321.206] (-1315.160) -- 0:02:39
378000 -- (-1333.633) (-1320.047) (-1321.474) [-1317.006] * (-1324.908) [-1309.518] (-1320.504) (-1322.603) -- 0:02:39
378500 -- (-1316.402) [-1327.811] (-1329.890) (-1324.129) * [-1317.274] (-1322.919) (-1320.747) (-1316.568) -- 0:02:39
379000 -- (-1336.061) (-1314.360) [-1321.761] (-1328.917) * (-1327.719) [-1320.568] (-1305.880) (-1336.870) -- 0:02:40
379500 -- (-1329.558) (-1332.476) (-1315.476) [-1318.282] * [-1322.444] (-1313.925) (-1323.016) (-1323.499) -- 0:02:40
380000 -- (-1314.852) (-1332.716) [-1310.489] (-1315.091) * (-1315.315) (-1317.772) (-1312.914) [-1315.423] -- 0:02:39
Average standard deviation of split frequencies: 0.012061
380500 -- (-1317.689) (-1319.093) [-1306.513] (-1312.250) * (-1313.557) (-1308.483) [-1321.469] (-1317.246) -- 0:02:39
381000 -- (-1321.004) (-1314.724) [-1327.090] (-1321.701) * (-1317.958) [-1316.816] (-1324.403) (-1314.222) -- 0:02:39
381500 -- (-1320.549) (-1321.166) (-1333.913) [-1316.568] * (-1303.305) (-1323.926) [-1326.364] (-1311.327) -- 0:02:38
382000 -- (-1330.286) (-1323.787) [-1320.515] (-1313.145) * (-1327.612) (-1336.188) (-1330.081) [-1321.951] -- 0:02:38
382500 -- (-1317.694) (-1332.167) (-1315.337) [-1317.538] * (-1322.017) (-1331.577) [-1313.823] (-1312.152) -- 0:02:39
383000 -- (-1320.724) (-1319.733) [-1318.177] (-1309.685) * [-1308.561] (-1323.734) (-1315.588) (-1328.008) -- 0:02:39
383500 -- (-1330.568) (-1317.692) (-1329.843) [-1310.891] * [-1308.581] (-1314.817) (-1333.304) (-1323.696) -- 0:02:39
384000 -- [-1310.347] (-1315.962) (-1330.923) (-1315.941) * (-1311.367) (-1318.896) [-1317.400] (-1316.932) -- 0:02:38
384500 -- [-1318.565] (-1312.021) (-1317.936) (-1321.387) * [-1309.689] (-1331.625) (-1313.578) (-1319.000) -- 0:02:38
385000 -- (-1306.628) [-1308.578] (-1313.943) (-1332.599) * (-1312.908) [-1319.407] (-1335.468) (-1318.082) -- 0:02:38
Average standard deviation of split frequencies: 0.012159
385500 -- [-1311.657] (-1312.904) (-1319.714) (-1323.410) * [-1311.383] (-1315.009) (-1325.549) (-1324.478) -- 0:02:37
386000 -- (-1316.241) [-1319.459] (-1321.287) (-1313.556) * [-1312.300] (-1314.226) (-1339.963) (-1309.723) -- 0:02:39
386500 -- (-1341.350) [-1315.000] (-1334.213) (-1330.373) * [-1313.949] (-1327.558) (-1348.908) (-1317.673) -- 0:02:38
387000 -- (-1304.953) (-1315.259) [-1308.414] (-1320.485) * [-1318.592] (-1328.553) (-1338.551) (-1326.030) -- 0:02:38
387500 -- (-1316.295) (-1309.236) (-1315.582) [-1309.310] * [-1312.047] (-1329.775) (-1321.697) (-1311.916) -- 0:02:38
388000 -- (-1323.606) (-1325.301) (-1316.805) [-1320.963] * (-1316.538) (-1337.356) (-1310.381) [-1318.309] -- 0:02:37
388500 -- (-1309.972) [-1319.664] (-1319.588) (-1318.380) * (-1309.459) (-1345.373) (-1318.677) [-1309.227] -- 0:02:37
389000 -- [-1314.311] (-1311.016) (-1328.445) (-1335.332) * (-1310.717) (-1330.295) [-1308.002] (-1316.869) -- 0:02:37
389500 -- (-1325.947) (-1320.583) [-1318.165] (-1348.728) * (-1318.651) (-1323.135) [-1319.274] (-1313.603) -- 0:02:38
390000 -- (-1310.983) (-1319.678) [-1320.409] (-1314.309) * (-1323.392) (-1326.786) (-1319.793) [-1312.057] -- 0:02:37
Average standard deviation of split frequencies: 0.011857
390500 -- (-1328.028) (-1317.624) (-1304.265) [-1318.995] * (-1329.400) (-1320.007) (-1321.891) [-1309.619] -- 0:02:37
391000 -- (-1321.530) (-1318.445) [-1309.958] (-1324.370) * (-1316.244) (-1322.137) (-1316.183) [-1310.734] -- 0:02:37
391500 -- (-1320.951) (-1324.068) [-1307.703] (-1312.223) * (-1316.433) (-1332.149) [-1318.175] (-1315.567) -- 0:02:36
392000 -- (-1322.938) (-1340.202) [-1310.505] (-1318.543) * (-1312.136) (-1327.225) [-1318.588] (-1313.441) -- 0:02:36
392500 -- (-1329.512) (-1326.721) (-1314.131) [-1318.079] * (-1319.386) (-1315.371) [-1313.465] (-1306.438) -- 0:02:36
393000 -- (-1313.262) (-1320.097) [-1314.382] (-1336.554) * (-1315.885) (-1328.780) [-1321.761] (-1321.462) -- 0:02:35
393500 -- (-1324.018) [-1306.363] (-1312.101) (-1344.938) * [-1311.808] (-1320.827) (-1305.899) (-1313.528) -- 0:02:37
394000 -- (-1318.932) [-1310.838] (-1313.982) (-1324.266) * (-1316.004) (-1329.427) [-1308.717] (-1316.699) -- 0:02:36
394500 -- (-1316.941) (-1315.453) [-1314.352] (-1334.119) * (-1331.724) [-1316.031] (-1327.538) (-1309.220) -- 0:02:36
395000 -- [-1322.113] (-1322.879) (-1308.774) (-1317.533) * (-1320.495) [-1312.698] (-1320.774) (-1318.111) -- 0:02:36
Average standard deviation of split frequencies: 0.011542
395500 -- (-1321.659) (-1327.302) (-1319.886) [-1317.626] * (-1318.933) (-1309.850) [-1312.081] (-1318.201) -- 0:02:35
396000 -- (-1321.918) [-1315.217] (-1318.861) (-1330.856) * (-1311.465) [-1316.339] (-1344.223) (-1312.666) -- 0:02:35
396500 -- (-1323.780) [-1316.078] (-1316.227) (-1343.696) * [-1309.604] (-1316.684) (-1312.401) (-1331.415) -- 0:02:35
397000 -- [-1307.404] (-1322.506) (-1314.816) (-1345.305) * (-1321.735) (-1316.896) [-1302.353] (-1323.220) -- 0:02:34
397500 -- [-1311.268] (-1318.669) (-1322.165) (-1331.840) * [-1318.955] (-1321.340) (-1328.416) (-1320.353) -- 0:02:36
398000 -- (-1327.477) [-1318.272] (-1324.982) (-1319.457) * [-1315.059] (-1316.525) (-1315.864) (-1316.682) -- 0:02:35
398500 -- (-1329.762) [-1322.664] (-1323.749) (-1314.728) * (-1314.733) (-1327.596) [-1311.425] (-1322.133) -- 0:02:35
399000 -- (-1335.047) (-1331.409) (-1319.289) [-1322.455] * (-1319.224) (-1321.142) (-1333.789) [-1311.141] -- 0:02:35
399500 -- [-1319.883] (-1340.924) (-1324.397) (-1315.570) * [-1311.843] (-1301.336) (-1331.699) (-1324.642) -- 0:02:34
400000 -- (-1322.379) (-1314.183) (-1331.423) [-1318.486] * (-1327.369) [-1305.828] (-1323.579) (-1329.269) -- 0:02:34
Average standard deviation of split frequencies: 0.010896
400500 -- (-1331.282) (-1338.769) (-1311.625) [-1309.676] * (-1327.459) (-1323.918) (-1331.340) [-1314.343] -- 0:02:35
401000 -- (-1318.801) (-1326.814) [-1310.952] (-1313.798) * (-1320.037) (-1309.535) (-1328.745) [-1311.123] -- 0:02:35
401500 -- (-1315.542) [-1308.560] (-1334.398) (-1326.339) * (-1311.934) [-1307.976] (-1335.752) (-1308.975) -- 0:02:35
402000 -- (-1313.929) [-1314.356] (-1317.974) (-1317.846) * [-1307.518] (-1317.807) (-1313.071) (-1331.991) -- 0:02:34
402500 -- (-1314.909) (-1320.852) [-1312.624] (-1328.717) * (-1310.034) [-1316.051] (-1325.202) (-1313.388) -- 0:02:34
403000 -- (-1330.680) (-1314.093) (-1329.128) [-1327.034] * (-1321.303) (-1313.310) (-1314.853) [-1305.817] -- 0:02:34
403500 -- (-1310.837) (-1316.821) (-1318.438) [-1312.175] * (-1327.364) [-1310.092] (-1334.848) (-1332.197) -- 0:02:33
404000 -- (-1322.298) (-1321.438) [-1316.618] (-1329.497) * [-1323.890] (-1324.618) (-1324.556) (-1320.820) -- 0:02:33
404500 -- (-1323.172) (-1341.520) (-1310.106) [-1317.667] * (-1324.538) [-1320.403] (-1332.510) (-1320.789) -- 0:02:34
405000 -- (-1311.406) (-1306.934) [-1315.224] (-1329.936) * (-1321.007) [-1310.779] (-1321.540) (-1320.935) -- 0:02:34
Average standard deviation of split frequencies: 0.011056
405500 -- (-1328.992) (-1329.151) [-1307.984] (-1329.910) * (-1331.934) (-1316.652) (-1319.227) [-1318.508] -- 0:02:33
406000 -- (-1318.159) (-1314.691) [-1315.050] (-1327.267) * (-1326.477) [-1314.519] (-1334.185) (-1321.191) -- 0:02:33
406500 -- (-1329.409) (-1317.173) (-1319.949) [-1319.958] * (-1314.097) (-1347.777) (-1319.638) [-1310.392] -- 0:02:33
407000 -- (-1320.402) (-1327.950) [-1317.810] (-1325.025) * [-1319.343] (-1329.500) (-1310.097) (-1327.959) -- 0:02:32
407500 -- (-1325.673) (-1314.278) (-1308.046) [-1316.606] * (-1317.942) (-1327.030) [-1315.835] (-1317.560) -- 0:02:32
408000 -- (-1318.866) (-1317.362) [-1321.306] (-1317.451) * (-1315.001) [-1318.713] (-1321.438) (-1309.845) -- 0:02:32
408500 -- (-1319.714) (-1323.863) (-1315.506) [-1309.004] * [-1308.991] (-1310.999) (-1326.009) (-1317.538) -- 0:02:33
409000 -- (-1317.783) (-1333.168) [-1312.529] (-1310.537) * [-1308.726] (-1316.091) (-1317.713) (-1336.300) -- 0:02:33
409500 -- (-1319.236) (-1320.950) [-1310.167] (-1323.658) * [-1317.382] (-1313.491) (-1318.615) (-1329.921) -- 0:02:32
410000 -- (-1312.777) (-1315.128) (-1311.558) [-1313.583] * [-1316.704] (-1334.128) (-1311.306) (-1314.028) -- 0:02:32
Average standard deviation of split frequencies: 0.010644
410500 -- [-1311.607] (-1323.215) (-1314.612) (-1311.299) * (-1311.768) [-1330.855] (-1322.939) (-1315.515) -- 0:02:32
411000 -- (-1313.003) (-1325.908) (-1324.648) [-1316.160] * [-1309.340] (-1330.060) (-1329.147) (-1323.697) -- 0:02:31
411500 -- (-1316.420) (-1326.997) (-1327.968) [-1315.829] * [-1318.663] (-1320.758) (-1327.891) (-1321.927) -- 0:02:31
412000 -- (-1320.863) [-1311.620] (-1308.769) (-1331.032) * [-1310.742] (-1318.998) (-1336.255) (-1326.746) -- 0:02:31
412500 -- [-1317.336] (-1320.218) (-1309.414) (-1321.521) * [-1312.348] (-1327.485) (-1326.687) (-1309.662) -- 0:02:32
413000 -- (-1332.630) [-1303.409] (-1316.049) (-1311.565) * [-1306.671] (-1320.542) (-1323.030) (-1321.343) -- 0:02:32
413500 -- (-1324.691) [-1305.245] (-1308.879) (-1310.769) * (-1318.008) [-1325.221] (-1321.214) (-1326.297) -- 0:02:31
414000 -- (-1323.055) (-1332.576) [-1317.958] (-1303.324) * (-1321.130) [-1312.279] (-1318.398) (-1321.600) -- 0:02:31
414500 -- (-1332.680) [-1314.740] (-1339.793) (-1315.595) * [-1310.459] (-1325.257) (-1310.956) (-1319.088) -- 0:02:31
415000 -- (-1328.814) [-1318.887] (-1320.001) (-1309.324) * (-1323.271) (-1332.943) [-1308.034] (-1317.230) -- 0:02:30
Average standard deviation of split frequencies: 0.010147
415500 -- (-1311.130) (-1338.301) [-1312.814] (-1321.518) * (-1318.405) (-1320.033) (-1325.806) [-1321.013] -- 0:02:30
416000 -- (-1313.745) [-1312.580] (-1325.341) (-1321.715) * [-1313.568] (-1306.747) (-1326.401) (-1351.450) -- 0:02:30
416500 -- (-1312.610) (-1319.143) (-1328.408) [-1316.545] * (-1315.976) (-1309.517) [-1314.857] (-1323.794) -- 0:02:31
417000 -- (-1344.998) (-1318.644) [-1316.423] (-1309.747) * (-1315.806) (-1326.395) [-1319.998] (-1311.609) -- 0:02:30
417500 -- (-1307.021) [-1309.692] (-1320.032) (-1319.265) * (-1328.593) (-1318.275) (-1320.652) [-1312.689] -- 0:02:30
418000 -- [-1303.508] (-1316.028) (-1312.953) (-1328.647) * (-1315.397) [-1307.804] (-1310.668) (-1308.713) -- 0:02:30
418500 -- (-1324.641) (-1322.547) (-1321.193) [-1309.419] * (-1319.092) (-1308.062) [-1316.171] (-1321.299) -- 0:02:30
419000 -- (-1320.814) (-1309.408) [-1319.137] (-1320.383) * (-1321.153) (-1315.435) (-1323.388) [-1322.844] -- 0:02:29
419500 -- (-1321.532) (-1312.018) [-1313.655] (-1322.441) * (-1316.311) (-1313.065) (-1310.576) [-1309.763] -- 0:02:29
420000 -- [-1308.384] (-1335.927) (-1325.938) (-1328.673) * (-1315.169) (-1343.586) [-1320.841] (-1308.926) -- 0:02:29
Average standard deviation of split frequencies: 0.010035
420500 -- (-1325.607) (-1312.657) [-1318.801] (-1328.399) * [-1314.974] (-1335.729) (-1309.691) (-1318.536) -- 0:02:30
421000 -- (-1329.459) [-1309.983] (-1313.991) (-1319.594) * (-1325.200) (-1338.895) (-1313.097) [-1315.438] -- 0:02:29
421500 -- (-1340.884) (-1320.837) (-1309.189) [-1317.498] * (-1317.700) (-1332.073) (-1308.594) [-1316.440] -- 0:02:29
422000 -- (-1328.737) (-1320.202) (-1314.644) [-1319.121] * (-1328.423) (-1317.838) [-1306.326] (-1311.290) -- 0:02:29
422500 -- (-1319.528) (-1320.516) [-1315.954] (-1329.817) * (-1316.628) (-1309.094) (-1318.068) [-1304.644] -- 0:02:28
423000 -- (-1319.166) (-1327.534) (-1316.048) [-1317.622] * (-1325.958) [-1321.831] (-1330.103) (-1312.406) -- 0:02:28
423500 -- (-1312.312) (-1315.986) [-1314.285] (-1317.101) * (-1312.878) (-1348.417) [-1314.559] (-1315.141) -- 0:02:28
424000 -- (-1339.362) [-1320.519] (-1318.217) (-1323.789) * (-1313.323) (-1316.233) (-1317.991) [-1311.686] -- 0:02:28
424500 -- (-1324.859) (-1332.607) (-1319.872) [-1317.020] * (-1305.583) (-1320.899) (-1319.922) [-1309.961] -- 0:02:29
425000 -- (-1313.145) (-1319.345) (-1326.570) [-1314.428] * [-1307.154] (-1313.006) (-1317.182) (-1311.175) -- 0:02:28
Average standard deviation of split frequencies: 0.010362
425500 -- (-1306.860) (-1327.462) [-1315.330] (-1318.762) * (-1310.518) [-1311.318] (-1320.831) (-1307.541) -- 0:02:28
426000 -- [-1310.653] (-1323.910) (-1317.570) (-1332.128) * (-1315.506) [-1311.285] (-1310.922) (-1320.683) -- 0:02:28
426500 -- (-1310.255) [-1318.043] (-1312.669) (-1337.382) * (-1341.499) (-1336.287) [-1308.608] (-1328.501) -- 0:02:27
427000 -- (-1324.768) (-1324.104) [-1313.277] (-1320.343) * (-1331.748) [-1312.575] (-1323.085) (-1320.449) -- 0:02:27
427500 -- (-1318.090) [-1304.275] (-1318.629) (-1329.073) * (-1311.194) [-1316.910] (-1333.038) (-1322.989) -- 0:02:27
428000 -- (-1337.254) (-1320.597) [-1311.686] (-1323.205) * [-1316.856] (-1319.618) (-1316.910) (-1319.917) -- 0:02:28
428500 -- (-1329.961) (-1315.472) (-1322.420) [-1327.290] * (-1320.740) [-1310.361] (-1317.383) (-1330.067) -- 0:02:28
429000 -- (-1318.951) [-1309.656] (-1320.142) (-1323.848) * (-1310.875) [-1307.542] (-1321.373) (-1322.480) -- 0:02:27
429500 -- (-1337.918) (-1312.099) [-1307.407] (-1318.706) * (-1319.276) (-1320.171) (-1333.498) [-1313.820] -- 0:02:27
430000 -- [-1317.556] (-1313.465) (-1330.820) (-1319.902) * [-1312.647] (-1315.498) (-1334.477) (-1315.077) -- 0:02:27
Average standard deviation of split frequencies: 0.010249
430500 -- (-1336.383) (-1308.139) [-1309.968] (-1324.666) * (-1337.989) (-1324.894) (-1321.461) [-1305.733] -- 0:02:26
431000 -- (-1325.012) (-1318.468) [-1310.236] (-1314.056) * [-1312.847] (-1308.831) (-1330.799) (-1313.234) -- 0:02:26
431500 -- (-1315.857) (-1314.350) (-1318.367) [-1309.984] * (-1316.490) (-1314.913) (-1331.334) [-1310.204] -- 0:02:26
432000 -- (-1322.268) (-1322.974) [-1307.941] (-1306.531) * (-1325.245) (-1321.100) (-1315.714) [-1316.993] -- 0:02:27
432500 -- (-1319.645) [-1316.261] (-1319.174) (-1324.792) * (-1330.740) [-1318.446] (-1319.731) (-1319.573) -- 0:02:26
433000 -- (-1316.320) (-1330.944) [-1309.237] (-1319.653) * [-1312.251] (-1318.051) (-1335.437) (-1323.923) -- 0:02:26
433500 -- (-1316.817) (-1319.350) (-1318.490) [-1316.606] * [-1315.138] (-1317.866) (-1333.065) (-1321.649) -- 0:02:26
434000 -- [-1307.086] (-1336.142) (-1312.527) (-1314.445) * (-1320.599) (-1326.574) (-1316.492) [-1319.597] -- 0:02:26
434500 -- (-1316.197) (-1329.397) [-1311.309] (-1319.327) * [-1307.569] (-1332.248) (-1325.924) (-1321.137) -- 0:02:25
435000 -- (-1305.423) (-1313.755) [-1311.932] (-1327.587) * [-1307.560] (-1320.234) (-1312.474) (-1315.139) -- 0:02:25
Average standard deviation of split frequencies: 0.010468
435500 -- [-1314.310] (-1321.441) (-1322.854) (-1323.028) * (-1322.906) (-1330.148) (-1323.375) [-1312.638] -- 0:02:25
436000 -- (-1328.335) [-1317.660] (-1312.540) (-1329.979) * (-1320.454) (-1308.528) (-1319.253) [-1309.370] -- 0:02:26
436500 -- (-1313.148) (-1320.706) (-1324.684) [-1314.386] * (-1312.097) (-1322.353) (-1312.715) [-1308.961] -- 0:02:25
437000 -- (-1324.105) (-1333.289) [-1321.795] (-1315.857) * (-1316.260) (-1311.160) [-1308.477] (-1339.050) -- 0:02:25
437500 -- (-1316.436) [-1315.284] (-1323.850) (-1320.523) * [-1323.570] (-1313.734) (-1325.278) (-1319.008) -- 0:02:25
438000 -- [-1312.004] (-1327.570) (-1325.811) (-1308.292) * [-1311.487] (-1323.040) (-1322.716) (-1329.621) -- 0:02:24
438500 -- (-1329.952) (-1316.377) (-1319.362) [-1311.346] * (-1318.867) [-1307.858] (-1308.737) (-1331.069) -- 0:02:24
439000 -- [-1303.983] (-1307.931) (-1338.194) (-1329.368) * (-1331.873) (-1330.706) [-1315.351] (-1314.751) -- 0:02:24
439500 -- (-1308.702) (-1321.099) [-1313.638] (-1328.977) * (-1318.475) (-1333.089) [-1309.892] (-1319.749) -- 0:02:24
440000 -- [-1311.598] (-1312.155) (-1324.436) (-1317.180) * (-1313.110) (-1317.468) [-1311.845] (-1313.777) -- 0:02:25
Average standard deviation of split frequencies: 0.011232
440500 -- [-1319.325] (-1315.905) (-1316.719) (-1317.326) * (-1315.449) (-1323.879) [-1312.075] (-1316.688) -- 0:02:24
441000 -- [-1323.995] (-1332.765) (-1315.010) (-1313.062) * (-1319.756) [-1304.650] (-1316.206) (-1320.072) -- 0:02:24
441500 -- (-1319.967) [-1314.958] (-1325.639) (-1318.104) * (-1330.651) [-1324.065] (-1316.644) (-1309.795) -- 0:02:24
442000 -- (-1320.269) (-1309.393) [-1311.960] (-1329.487) * (-1320.032) [-1313.554] (-1337.734) (-1309.948) -- 0:02:23
442500 -- (-1318.307) [-1316.546] (-1314.656) (-1325.850) * [-1320.120] (-1310.526) (-1329.552) (-1308.119) -- 0:02:23
443000 -- (-1319.324) (-1315.898) [-1319.210] (-1331.733) * (-1327.479) [-1312.631] (-1319.155) (-1320.125) -- 0:02:23
443500 -- [-1319.008] (-1310.787) (-1323.470) (-1337.832) * [-1307.932] (-1314.357) (-1326.132) (-1330.213) -- 0:02:23
444000 -- (-1330.001) (-1320.570) [-1304.659] (-1314.836) * (-1313.000) (-1307.439) [-1313.192] (-1331.269) -- 0:02:24
444500 -- [-1310.379] (-1306.816) (-1313.647) (-1317.321) * (-1313.624) (-1308.066) [-1311.316] (-1334.663) -- 0:02:23
445000 -- [-1308.547] (-1312.558) (-1315.717) (-1334.826) * (-1314.021) [-1313.463] (-1308.554) (-1319.163) -- 0:02:23
Average standard deviation of split frequencies: 0.010810
445500 -- (-1305.850) (-1314.765) [-1319.364] (-1319.697) * (-1317.948) [-1320.402] (-1311.223) (-1313.186) -- 0:02:23
446000 -- [-1321.956] (-1321.705) (-1314.838) (-1322.663) * (-1315.817) (-1319.260) [-1314.262] (-1310.487) -- 0:02:22
446500 -- (-1308.636) [-1307.493] (-1332.999) (-1341.293) * (-1316.475) (-1325.066) (-1316.654) [-1308.952] -- 0:02:22
447000 -- (-1311.114) (-1321.138) [-1320.104] (-1320.349) * (-1326.463) [-1317.004] (-1318.980) (-1326.885) -- 0:02:22
447500 -- (-1315.830) [-1314.435] (-1326.083) (-1335.629) * [-1314.699] (-1319.198) (-1321.691) (-1314.604) -- 0:02:21
448000 -- (-1322.207) [-1308.221] (-1321.636) (-1332.101) * (-1311.907) (-1322.734) (-1317.294) [-1310.370] -- 0:02:22
448500 -- (-1313.488) (-1318.574) [-1314.953] (-1336.521) * [-1310.612] (-1325.514) (-1317.231) (-1314.305) -- 0:02:22
449000 -- (-1323.907) (-1324.801) [-1312.916] (-1326.514) * (-1311.679) [-1316.538] (-1333.910) (-1322.423) -- 0:02:22
449500 -- [-1311.795] (-1321.442) (-1312.896) (-1323.132) * (-1309.475) (-1321.687) (-1341.987) [-1317.328] -- 0:02:22
450000 -- (-1320.285) [-1307.881] (-1335.008) (-1327.392) * (-1322.358) (-1323.511) (-1315.859) [-1314.763] -- 0:02:21
Average standard deviation of split frequencies: 0.010793
450500 -- (-1320.064) (-1327.513) [-1310.799] (-1322.357) * [-1308.620] (-1321.371) (-1321.575) (-1315.336) -- 0:02:21
451000 -- (-1327.039) (-1328.339) [-1320.645] (-1322.074) * [-1315.070] (-1319.969) (-1315.839) (-1321.622) -- 0:02:21
451500 -- (-1323.767) (-1326.298) [-1324.648] (-1320.339) * [-1317.673] (-1313.862) (-1312.176) (-1317.944) -- 0:02:22
452000 -- (-1327.321) (-1323.380) (-1323.115) [-1309.583] * (-1317.902) (-1321.375) [-1306.564] (-1329.044) -- 0:02:21
452500 -- (-1327.551) [-1313.684] (-1327.517) (-1312.720) * [-1311.145] (-1315.030) (-1321.449) (-1327.912) -- 0:02:21
453000 -- (-1334.413) (-1332.598) (-1326.289) [-1314.429] * (-1337.259) (-1326.108) (-1309.440) [-1320.796] -- 0:02:21
453500 -- (-1313.865) (-1332.070) (-1324.449) [-1312.882] * (-1330.805) [-1322.524] (-1340.523) (-1321.042) -- 0:02:20
454000 -- (-1318.274) [-1322.304] (-1328.350) (-1309.459) * (-1321.139) (-1317.998) (-1321.487) [-1314.586] -- 0:02:20
454500 -- (-1320.182) [-1310.919] (-1332.053) (-1312.599) * (-1325.495) (-1313.154) (-1327.580) [-1309.341] -- 0:02:20
455000 -- (-1313.989) (-1305.411) [-1309.892] (-1326.417) * [-1319.990] (-1326.781) (-1309.521) (-1316.602) -- 0:02:20
Average standard deviation of split frequencies: 0.010526
455500 -- (-1309.199) (-1321.024) (-1329.166) [-1311.547] * [-1308.650] (-1323.457) (-1302.598) (-1313.454) -- 0:02:21
456000 -- (-1322.187) [-1320.656] (-1326.573) (-1335.365) * [-1310.935] (-1330.366) (-1308.223) (-1315.862) -- 0:02:20
456500 -- [-1313.359] (-1331.404) (-1336.470) (-1322.390) * (-1310.100) [-1316.694] (-1318.959) (-1318.936) -- 0:02:20
457000 -- [-1311.793] (-1313.297) (-1325.078) (-1312.332) * [-1310.279] (-1318.235) (-1326.500) (-1328.053) -- 0:02:20
457500 -- [-1314.476] (-1333.938) (-1317.420) (-1318.755) * (-1315.636) [-1309.765] (-1309.967) (-1310.294) -- 0:02:19
458000 -- (-1314.530) (-1318.333) [-1308.953] (-1326.083) * [-1317.177] (-1327.119) (-1309.282) (-1313.464) -- 0:02:19
458500 -- (-1321.216) [-1313.973] (-1337.223) (-1325.244) * (-1308.533) [-1310.859] (-1319.315) (-1315.434) -- 0:02:19
459000 -- (-1329.559) (-1314.622) (-1329.973) [-1314.098] * (-1307.237) (-1315.950) [-1308.718] (-1314.733) -- 0:02:19
459500 -- (-1347.718) [-1311.525] (-1328.073) (-1317.466) * (-1320.077) (-1311.541) [-1311.671] (-1315.605) -- 0:02:19
460000 -- (-1315.242) (-1320.604) [-1317.859] (-1319.547) * (-1321.814) [-1319.104] (-1328.475) (-1313.738) -- 0:02:19
Average standard deviation of split frequencies: 0.010698
460500 -- (-1328.601) (-1324.994) [-1321.525] (-1325.709) * (-1329.294) (-1312.109) (-1318.426) [-1306.835] -- 0:02:19
461000 -- (-1327.681) (-1317.021) [-1327.758] (-1323.622) * (-1317.448) (-1314.043) (-1328.711) [-1308.746] -- 0:02:19
461500 -- (-1327.461) [-1315.392] (-1314.498) (-1327.252) * (-1323.062) [-1308.419] (-1309.893) (-1324.661) -- 0:02:18
462000 -- (-1326.152) (-1306.617) [-1319.600] (-1318.618) * (-1307.087) [-1317.065] (-1335.829) (-1331.236) -- 0:02:18
462500 -- (-1317.008) (-1311.518) (-1314.813) [-1312.618] * (-1314.305) (-1312.643) (-1327.038) [-1315.393] -- 0:02:18
463000 -- (-1315.656) (-1317.388) [-1320.018] (-1309.802) * (-1306.613) (-1328.435) [-1320.628] (-1307.665) -- 0:02:18
463500 -- [-1323.638] (-1313.920) (-1319.060) (-1322.188) * (-1324.132) (-1324.271) (-1327.709) [-1318.370] -- 0:02:18
464000 -- (-1312.524) [-1307.130] (-1305.454) (-1325.386) * [-1312.540] (-1316.170) (-1317.173) (-1331.627) -- 0:02:18
464500 -- (-1314.186) [-1302.727] (-1306.903) (-1317.827) * (-1310.529) [-1313.228] (-1313.103) (-1326.715) -- 0:02:18
465000 -- (-1315.704) (-1325.422) [-1311.589] (-1308.734) * [-1308.291] (-1309.518) (-1322.570) (-1338.950) -- 0:02:18
Average standard deviation of split frequencies: 0.010714
465500 -- (-1311.867) (-1317.786) (-1317.777) [-1320.479] * (-1328.449) [-1308.085] (-1318.944) (-1323.282) -- 0:02:17
466000 -- (-1317.719) (-1324.022) (-1323.798) [-1313.481] * (-1312.705) (-1316.147) (-1314.784) [-1315.523] -- 0:02:17
466500 -- (-1325.528) (-1307.984) [-1304.315] (-1319.718) * (-1315.816) (-1324.011) (-1331.155) [-1315.620] -- 0:02:17
467000 -- (-1317.236) [-1309.357] (-1317.755) (-1331.468) * (-1338.850) [-1312.209] (-1321.365) (-1309.086) -- 0:02:16
467500 -- (-1309.341) [-1304.462] (-1312.910) (-1316.028) * (-1319.390) (-1344.193) (-1310.934) [-1315.742] -- 0:02:17
468000 -- [-1304.994] (-1330.293) (-1338.642) (-1317.782) * (-1335.984) (-1322.074) (-1314.461) [-1312.211] -- 0:02:17
468500 -- (-1319.731) (-1344.349) [-1316.366] (-1311.773) * (-1346.260) (-1317.265) (-1321.721) [-1309.068] -- 0:02:17
469000 -- (-1320.305) (-1325.877) (-1311.421) [-1302.613] * (-1324.333) (-1308.663) (-1332.127) [-1315.617] -- 0:02:16
469500 -- [-1310.867] (-1318.354) (-1317.195) (-1340.044) * (-1318.791) [-1300.929] (-1329.072) (-1309.169) -- 0:02:16
470000 -- (-1311.873) (-1316.705) [-1317.538] (-1317.044) * (-1321.892) (-1323.248) (-1313.020) [-1312.760] -- 0:02:16
Average standard deviation of split frequencies: 0.010699
470500 -- (-1308.702) [-1310.394] (-1317.108) (-1328.547) * (-1312.885) [-1310.178] (-1324.909) (-1311.843) -- 0:02:16
471000 -- (-1315.555) (-1320.185) (-1315.263) [-1321.584] * (-1319.114) (-1308.732) (-1310.099) [-1306.174] -- 0:02:15
471500 -- [-1316.697] (-1310.501) (-1339.330) (-1337.788) * (-1329.177) [-1312.541] (-1337.901) (-1322.753) -- 0:02:16
472000 -- [-1320.561] (-1310.376) (-1339.031) (-1319.049) * (-1323.034) [-1322.372] (-1331.914) (-1329.366) -- 0:02:16
472500 -- (-1318.701) (-1308.991) (-1314.410) [-1324.004] * (-1325.160) [-1314.758] (-1331.139) (-1337.917) -- 0:02:16
473000 -- (-1305.784) [-1312.285] (-1314.806) (-1318.375) * [-1315.185] (-1317.293) (-1315.999) (-1330.892) -- 0:02:15
473500 -- (-1317.869) (-1312.020) [-1313.598] (-1318.285) * (-1315.319) (-1306.349) [-1312.454] (-1327.800) -- 0:02:15
474000 -- (-1326.337) (-1317.559) [-1312.258] (-1315.928) * (-1317.921) [-1317.153] (-1333.869) (-1321.705) -- 0:02:15
474500 -- [-1319.471] (-1317.481) (-1329.173) (-1315.371) * (-1323.301) [-1325.057] (-1322.084) (-1319.917) -- 0:02:15
475000 -- (-1329.292) [-1311.940] (-1315.939) (-1328.814) * (-1318.492) [-1317.895] (-1327.931) (-1322.036) -- 0:02:15
Average standard deviation of split frequencies: 0.010669
475500 -- (-1331.672) [-1316.590] (-1316.581) (-1320.120) * (-1312.676) [-1325.044] (-1304.307) (-1315.840) -- 0:02:15
476000 -- [-1319.054] (-1316.457) (-1324.513) (-1307.245) * (-1327.111) (-1313.181) [-1312.435] (-1321.517) -- 0:02:15
476500 -- [-1317.802] (-1317.222) (-1329.313) (-1325.244) * [-1315.543] (-1311.044) (-1327.869) (-1317.140) -- 0:02:15
477000 -- (-1313.163) (-1325.508) (-1340.171) [-1311.903] * [-1328.364] (-1319.834) (-1318.489) (-1308.361) -- 0:02:14
477500 -- (-1323.498) (-1315.033) [-1318.958] (-1316.928) * (-1314.987) (-1324.256) (-1322.199) [-1306.191] -- 0:02:14
478000 -- (-1314.039) (-1327.829) (-1321.398) [-1321.905] * (-1310.577) [-1314.856] (-1331.578) (-1332.140) -- 0:02:14
478500 -- (-1320.922) [-1324.760] (-1313.304) (-1317.521) * (-1320.292) [-1311.938] (-1309.385) (-1322.868) -- 0:02:14
479000 -- [-1310.143] (-1322.740) (-1317.727) (-1316.208) * (-1328.012) [-1323.906] (-1310.540) (-1330.388) -- 0:02:14
479500 -- (-1310.631) (-1324.594) (-1330.119) [-1315.001] * (-1310.394) (-1325.434) [-1312.419] (-1313.193) -- 0:02:14
480000 -- (-1341.306) [-1313.993] (-1319.667) (-1307.237) * (-1321.858) [-1317.952] (-1317.330) (-1308.547) -- 0:02:14
Average standard deviation of split frequencies: 0.011680
480500 -- (-1336.826) (-1321.847) [-1311.692] (-1309.870) * (-1321.118) (-1327.327) (-1325.349) [-1315.879] -- 0:02:14
481000 -- (-1327.100) (-1340.757) [-1310.396] (-1324.394) * (-1306.371) [-1315.283] (-1334.295) (-1326.230) -- 0:02:13
481500 -- (-1313.585) (-1322.425) [-1315.322] (-1322.196) * (-1318.259) [-1310.845] (-1322.711) (-1328.541) -- 0:02:13
482000 -- (-1321.626) (-1326.196) [-1321.241] (-1321.541) * (-1330.199) (-1310.149) (-1317.898) [-1310.415] -- 0:02:13
482500 -- (-1327.462) (-1327.567) [-1311.276] (-1327.629) * (-1326.478) (-1311.521) (-1329.004) [-1315.929] -- 0:02:12
483000 -- (-1316.870) (-1329.648) (-1324.696) [-1317.865] * [-1320.462] (-1313.887) (-1315.211) (-1337.546) -- 0:02:13
483500 -- (-1321.770) [-1327.437] (-1307.914) (-1317.752) * [-1309.199] (-1315.906) (-1318.808) (-1308.855) -- 0:02:13
484000 -- (-1310.384) (-1317.208) [-1314.561] (-1338.205) * [-1322.121] (-1327.254) (-1320.438) (-1312.045) -- 0:02:13
484500 -- [-1319.531] (-1328.837) (-1312.802) (-1326.405) * (-1340.494) (-1315.252) [-1319.240] (-1321.339) -- 0:02:12
485000 -- (-1335.761) (-1319.694) (-1323.511) [-1316.037] * (-1334.118) [-1316.341] (-1329.524) (-1329.320) -- 0:02:12
Average standard deviation of split frequencies: 0.011199
485500 -- (-1328.141) [-1318.941] (-1311.058) (-1332.690) * (-1317.400) (-1315.404) [-1317.381] (-1333.304) -- 0:02:12
486000 -- (-1323.429) (-1325.940) (-1313.737) [-1312.406] * (-1317.207) (-1311.666) [-1311.851] (-1332.897) -- 0:02:12
486500 -- (-1328.938) (-1311.130) (-1313.976) [-1314.506] * [-1312.407] (-1312.290) (-1325.389) (-1333.651) -- 0:02:11
487000 -- (-1333.415) (-1321.747) [-1315.063] (-1318.806) * [-1310.622] (-1318.527) (-1324.025) (-1320.332) -- 0:02:12
487500 -- (-1306.595) [-1309.057] (-1318.698) (-1322.574) * (-1321.203) [-1310.075] (-1318.704) (-1321.508) -- 0:02:12
488000 -- (-1323.246) [-1315.540] (-1319.464) (-1328.451) * (-1322.277) [-1321.832] (-1316.645) (-1338.845) -- 0:02:12
488500 -- (-1325.056) (-1319.222) [-1312.317] (-1306.126) * (-1324.442) [-1319.716] (-1319.338) (-1334.711) -- 0:02:11
489000 -- (-1313.796) (-1320.094) (-1325.078) [-1311.610] * (-1322.719) (-1311.602) (-1313.379) [-1312.438] -- 0:02:11
489500 -- (-1307.119) (-1331.244) (-1318.849) [-1312.072] * (-1322.091) [-1310.345] (-1318.730) (-1319.103) -- 0:02:11
490000 -- [-1319.434] (-1309.116) (-1325.753) (-1322.836) * (-1333.273) [-1317.114] (-1307.653) (-1321.909) -- 0:02:11
Average standard deviation of split frequencies: 0.010980
490500 -- [-1314.708] (-1325.038) (-1319.402) (-1330.332) * (-1308.430) (-1314.696) [-1311.642] (-1320.812) -- 0:02:10
491000 -- (-1322.372) (-1339.957) [-1316.128] (-1317.873) * (-1309.976) [-1311.237] (-1315.399) (-1321.096) -- 0:02:11
491500 -- (-1318.378) [-1316.190] (-1332.120) (-1325.797) * (-1313.030) [-1321.384] (-1316.936) (-1335.029) -- 0:02:11
492000 -- (-1319.128) [-1311.859] (-1331.508) (-1324.263) * (-1326.175) [-1307.521] (-1338.891) (-1327.417) -- 0:02:11
492500 -- (-1330.856) (-1314.196) (-1322.531) [-1311.606] * (-1325.210) (-1328.419) [-1316.848] (-1338.556) -- 0:02:10
493000 -- (-1321.288) (-1315.281) (-1335.475) [-1315.338] * (-1319.288) (-1337.462) [-1317.366] (-1315.200) -- 0:02:10
493500 -- (-1322.575) (-1322.709) [-1323.030] (-1329.892) * (-1313.315) (-1321.595) (-1324.221) [-1314.995] -- 0:02:10
494000 -- [-1311.698] (-1327.220) (-1311.698) (-1324.525) * (-1323.906) (-1316.911) (-1309.695) [-1315.765] -- 0:02:10
494500 -- [-1315.981] (-1322.876) (-1309.311) (-1307.909) * (-1325.741) (-1325.819) [-1308.825] (-1316.435) -- 0:02:09
495000 -- (-1332.118) [-1311.683] (-1322.716) (-1313.304) * [-1314.299] (-1323.221) (-1307.505) (-1305.253) -- 0:02:10
Average standard deviation of split frequencies: 0.010325
495500 -- (-1318.930) [-1318.143] (-1316.948) (-1335.438) * [-1306.999] (-1320.860) (-1317.663) (-1320.104) -- 0:02:10
496000 -- (-1325.976) (-1311.691) (-1323.224) [-1310.420] * [-1308.219] (-1327.260) (-1322.288) (-1313.498) -- 0:02:10
496500 -- [-1308.089] (-1318.584) (-1319.074) (-1319.592) * (-1315.052) (-1336.727) [-1319.939] (-1321.902) -- 0:02:09
497000 -- (-1324.930) (-1310.263) [-1315.605] (-1324.126) * (-1309.137) (-1316.878) (-1321.014) [-1311.537] -- 0:02:09
497500 -- (-1322.765) [-1314.985] (-1324.886) (-1325.134) * [-1320.911] (-1315.962) (-1328.674) (-1316.634) -- 0:02:09
498000 -- (-1324.578) [-1326.542] (-1322.850) (-1310.722) * (-1323.170) [-1311.999] (-1316.348) (-1330.549) -- 0:02:09
498500 -- [-1319.883] (-1318.403) (-1323.988) (-1326.962) * [-1323.879] (-1319.891) (-1325.854) (-1312.931) -- 0:02:08
499000 -- (-1317.293) [-1307.457] (-1330.111) (-1318.297) * [-1313.922] (-1325.424) (-1324.585) (-1315.633) -- 0:02:09
499500 -- (-1320.516) [-1305.120] (-1312.601) (-1315.781) * (-1324.199) (-1313.974) [-1323.606] (-1334.551) -- 0:02:09
500000 -- (-1317.266) (-1322.414) [-1307.929] (-1315.496) * [-1311.435] (-1314.850) (-1320.924) (-1330.502) -- 0:02:09
Average standard deviation of split frequencies: 0.010267
500500 -- (-1317.040) (-1320.936) (-1323.579) [-1313.863] * [-1319.588] (-1318.226) (-1316.395) (-1316.421) -- 0:02:08
501000 -- (-1311.486) (-1318.421) [-1316.746] (-1326.582) * (-1321.966) (-1333.400) [-1312.910] (-1329.697) -- 0:02:08
501500 -- [-1306.791] (-1316.756) (-1334.389) (-1325.945) * [-1305.314] (-1334.982) (-1330.343) (-1310.937) -- 0:02:08
502000 -- (-1315.566) (-1331.023) (-1318.142) [-1315.703] * (-1315.159) (-1326.898) [-1311.656] (-1313.185) -- 0:02:07
502500 -- (-1315.835) (-1314.460) (-1317.084) [-1315.026] * (-1316.706) [-1313.695] (-1319.505) (-1309.954) -- 0:02:08
503000 -- [-1326.242] (-1314.319) (-1318.242) (-1330.235) * (-1308.378) [-1320.669] (-1316.151) (-1309.051) -- 0:02:08
503500 -- [-1314.551] (-1319.082) (-1317.027) (-1320.968) * [-1321.275] (-1317.342) (-1335.484) (-1321.585) -- 0:02:08
504000 -- (-1327.257) (-1314.464) [-1313.863] (-1335.820) * [-1305.136] (-1320.308) (-1330.027) (-1311.925) -- 0:02:07
504500 -- [-1315.709] (-1320.739) (-1326.910) (-1325.078) * (-1313.793) (-1319.671) [-1312.646] (-1312.377) -- 0:02:07
505000 -- (-1310.147) [-1307.346] (-1315.798) (-1333.539) * (-1305.351) [-1325.642] (-1323.330) (-1350.246) -- 0:02:07
Average standard deviation of split frequencies: 0.010204
505500 -- (-1319.260) (-1323.995) (-1310.171) [-1310.923] * (-1309.240) [-1310.110] (-1319.330) (-1323.496) -- 0:02:07
506000 -- [-1311.118] (-1330.506) (-1313.966) (-1322.671) * [-1324.723] (-1305.925) (-1327.727) (-1322.985) -- 0:02:06
506500 -- (-1307.320) (-1316.832) (-1324.064) [-1314.109] * [-1311.413] (-1311.293) (-1328.414) (-1322.917) -- 0:02:07
507000 -- (-1328.699) [-1310.072] (-1328.765) (-1329.661) * (-1316.934) (-1328.379) [-1310.452] (-1323.035) -- 0:02:07
507500 -- (-1313.338) [-1304.438] (-1330.162) (-1318.922) * [-1319.401] (-1322.955) (-1328.487) (-1327.645) -- 0:02:07
508000 -- [-1304.869] (-1314.415) (-1313.004) (-1342.755) * (-1323.329) (-1327.164) (-1325.860) [-1304.325] -- 0:02:06
508500 -- (-1310.635) [-1312.960] (-1314.217) (-1316.306) * (-1330.032) (-1316.391) [-1312.146] (-1315.369) -- 0:02:06
509000 -- (-1307.979) [-1313.278] (-1316.861) (-1329.073) * (-1325.540) [-1326.136] (-1328.848) (-1325.483) -- 0:02:06
509500 -- (-1311.987) (-1314.181) (-1315.612) [-1314.004] * (-1319.018) (-1320.816) [-1322.099] (-1321.021) -- 0:02:06
510000 -- (-1340.371) [-1312.572] (-1309.552) (-1324.498) * (-1331.032) (-1315.663) (-1324.317) [-1309.262] -- 0:02:06
Average standard deviation of split frequencies: 0.010110
510500 -- (-1317.178) [-1312.737] (-1317.851) (-1339.835) * (-1318.740) (-1312.156) [-1308.521] (-1305.710) -- 0:02:06
511000 -- (-1319.127) (-1318.699) (-1318.432) [-1316.390] * (-1317.794) (-1311.405) [-1313.324] (-1314.747) -- 0:02:06
511500 -- (-1318.328) (-1316.216) [-1312.130] (-1327.406) * (-1315.968) (-1315.375) [-1323.338] (-1317.989) -- 0:02:06
512000 -- (-1313.102) (-1328.350) [-1309.339] (-1322.152) * (-1324.946) (-1320.763) (-1328.927) [-1312.575] -- 0:02:05
512500 -- (-1321.965) (-1316.905) (-1317.721) [-1310.809] * (-1328.885) (-1320.621) (-1327.940) [-1313.141] -- 0:02:05
513000 -- (-1329.443) (-1324.142) (-1340.116) [-1314.527] * (-1327.863) [-1310.788] (-1312.454) (-1316.859) -- 0:02:05
513500 -- (-1321.267) (-1315.325) [-1311.599] (-1332.372) * (-1320.125) (-1304.839) (-1321.638) [-1310.701] -- 0:02:05
514000 -- (-1327.711) [-1306.649] (-1326.225) (-1308.356) * (-1334.750) (-1311.297) [-1316.463] (-1321.562) -- 0:02:05
514500 -- (-1326.570) [-1317.105] (-1314.938) (-1319.118) * [-1320.681] (-1317.642) (-1325.018) (-1315.864) -- 0:02:05
515000 -- (-1335.272) (-1311.692) [-1308.008] (-1322.154) * (-1324.501) [-1309.187] (-1319.898) (-1320.437) -- 0:02:05
Average standard deviation of split frequencies: 0.009614
515500 -- (-1332.977) (-1322.158) [-1316.912] (-1313.704) * (-1333.968) [-1317.304] (-1314.093) (-1321.137) -- 0:02:05
516000 -- (-1330.110) (-1324.120) [-1314.770] (-1316.802) * (-1332.970) (-1316.216) (-1311.032) [-1313.097] -- 0:02:04
516500 -- [-1316.193] (-1326.354) (-1313.430) (-1324.425) * (-1317.319) (-1325.304) (-1316.304) [-1327.880] -- 0:02:04
517000 -- (-1322.303) (-1315.521) [-1307.976] (-1325.414) * [-1311.421] (-1321.772) (-1311.927) (-1318.154) -- 0:02:04
517500 -- (-1322.328) (-1341.068) (-1308.542) [-1312.303] * [-1317.112] (-1324.371) (-1314.335) (-1317.150) -- 0:02:04
518000 -- (-1323.199) (-1328.432) [-1313.392] (-1324.096) * (-1327.744) (-1327.291) [-1311.058] (-1311.311) -- 0:02:04
518500 -- [-1322.197] (-1320.698) (-1312.941) (-1329.044) * (-1327.341) [-1318.987] (-1310.834) (-1321.574) -- 0:02:04
519000 -- (-1317.317) [-1318.007] (-1317.563) (-1318.227) * (-1320.398) (-1310.170) [-1315.369] (-1314.815) -- 0:02:04
519500 -- (-1325.547) (-1319.140) [-1306.409] (-1324.971) * (-1317.963) (-1320.689) [-1313.037] (-1321.225) -- 0:02:03
520000 -- (-1319.078) [-1313.448] (-1311.190) (-1313.742) * [-1319.981] (-1318.556) (-1316.883) (-1325.787) -- 0:02:03
Average standard deviation of split frequencies: 0.009830
520500 -- [-1314.837] (-1317.894) (-1318.736) (-1315.851) * (-1323.060) [-1332.374] (-1304.734) (-1323.844) -- 0:02:03
521000 -- (-1320.919) [-1311.613] (-1320.915) (-1320.694) * (-1322.083) (-1334.862) (-1327.893) [-1314.435] -- 0:02:03
521500 -- [-1310.357] (-1320.866) (-1308.360) (-1313.930) * [-1315.658] (-1334.766) (-1317.883) (-1320.410) -- 0:02:02
522000 -- (-1316.889) (-1317.859) [-1309.484] (-1322.467) * (-1320.584) (-1315.037) [-1314.168] (-1318.444) -- 0:02:03
522500 -- (-1325.774) [-1313.283] (-1310.081) (-1319.571) * (-1311.041) (-1324.292) [-1323.216] (-1315.916) -- 0:02:03
523000 -- (-1310.219) (-1335.298) (-1309.787) [-1313.369] * [-1312.383] (-1310.672) (-1338.325) (-1315.702) -- 0:02:03
523500 -- (-1313.663) (-1329.826) (-1319.629) [-1314.290] * (-1317.346) [-1316.166] (-1335.896) (-1324.012) -- 0:02:02
524000 -- (-1321.999) (-1340.444) [-1325.776] (-1315.805) * [-1306.582] (-1311.121) (-1332.183) (-1309.171) -- 0:02:02
524500 -- [-1314.265] (-1322.117) (-1315.915) (-1318.758) * (-1324.675) [-1307.142] (-1316.740) (-1321.155) -- 0:02:02
525000 -- (-1306.363) (-1328.034) (-1319.205) [-1323.801] * [-1314.418] (-1315.473) (-1315.753) (-1331.801) -- 0:02:03
Average standard deviation of split frequencies: 0.010200
525500 -- (-1312.233) [-1315.012] (-1321.098) (-1316.429) * (-1315.330) [-1311.153] (-1336.584) (-1314.892) -- 0:02:02
526000 -- (-1314.901) (-1315.095) [-1323.460] (-1321.426) * (-1318.865) (-1314.902) (-1330.932) [-1321.084] -- 0:02:02
526500 -- [-1309.403] (-1327.406) (-1315.465) (-1322.193) * (-1321.717) (-1311.770) [-1315.719] (-1320.852) -- 0:02:02
527000 -- [-1311.802] (-1324.747) (-1334.112) (-1334.878) * (-1316.187) (-1335.594) [-1309.613] (-1333.191) -- 0:02:02
527500 -- (-1321.644) [-1320.803] (-1338.173) (-1309.126) * (-1326.115) (-1336.276) [-1317.759] (-1319.500) -- 0:02:01
528000 -- (-1329.919) (-1321.571) (-1319.433) [-1316.535] * [-1306.103] (-1328.539) (-1311.002) (-1312.997) -- 0:02:01
528500 -- (-1326.247) (-1330.365) [-1325.025] (-1315.570) * (-1327.099) (-1335.491) [-1310.045] (-1321.431) -- 0:02:01
529000 -- (-1339.001) [-1310.373] (-1319.093) (-1317.663) * (-1323.951) (-1333.580) [-1315.777] (-1333.838) -- 0:02:01
529500 -- (-1332.218) (-1316.031) (-1325.822) [-1301.140] * (-1308.167) [-1318.493] (-1331.406) (-1333.358) -- 0:02:01
530000 -- (-1315.972) [-1313.230] (-1315.160) (-1318.939) * (-1308.883) (-1323.528) (-1325.267) [-1314.697] -- 0:02:01
Average standard deviation of split frequencies: 0.010237
530500 -- (-1334.959) (-1323.044) (-1314.540) [-1308.997] * (-1318.564) (-1322.212) [-1318.691] (-1317.556) -- 0:02:01
531000 -- (-1322.761) (-1325.159) (-1311.431) [-1322.935] * (-1321.917) (-1334.687) [-1315.682] (-1319.057) -- 0:02:01
531500 -- (-1322.525) (-1311.558) (-1335.318) [-1313.862] * (-1323.708) (-1320.655) (-1318.796) [-1313.417] -- 0:02:00
532000 -- (-1329.144) [-1313.764] (-1312.724) (-1309.015) * [-1316.676] (-1312.990) (-1318.812) (-1327.107) -- 0:02:00
532500 -- (-1325.247) [-1314.473] (-1316.730) (-1319.026) * (-1323.062) (-1318.139) [-1319.507] (-1325.057) -- 0:02:00
533000 -- (-1330.217) [-1314.526] (-1321.286) (-1323.913) * (-1322.306) [-1305.872] (-1311.740) (-1313.014) -- 0:02:00
533500 -- [-1316.880] (-1317.692) (-1317.828) (-1309.879) * (-1327.681) [-1311.501] (-1317.749) (-1327.257) -- 0:02:00
534000 -- [-1312.248] (-1318.006) (-1320.572) (-1320.619) * (-1335.346) (-1316.687) (-1309.609) [-1307.099] -- 0:02:00
534500 -- (-1315.502) [-1312.501] (-1313.217) (-1326.574) * (-1342.746) (-1313.797) (-1314.003) [-1319.686] -- 0:02:00
535000 -- [-1309.707] (-1315.568) (-1324.902) (-1319.983) * (-1342.411) (-1313.322) (-1313.458) [-1311.896] -- 0:01:59
Average standard deviation of split frequencies: 0.009926
535500 -- (-1310.907) [-1316.094] (-1327.019) (-1310.798) * (-1332.455) (-1331.523) (-1337.467) [-1310.223] -- 0:01:59
536000 -- (-1322.994) [-1303.920] (-1313.389) (-1326.130) * (-1331.509) (-1321.280) (-1310.482) [-1314.085] -- 0:01:59
536500 -- [-1319.993] (-1324.853) (-1319.534) (-1325.936) * (-1315.525) (-1346.452) (-1308.071) [-1312.094] -- 0:01:59
537000 -- [-1307.875] (-1324.058) (-1331.373) (-1322.101) * (-1310.634) [-1306.472] (-1331.133) (-1320.407) -- 0:01:59
537500 -- (-1329.343) (-1317.563) (-1319.173) [-1317.009] * (-1316.871) (-1322.160) (-1323.031) [-1311.627] -- 0:01:59
538000 -- (-1337.899) [-1309.495] (-1322.487) (-1306.345) * (-1326.042) (-1335.500) [-1310.999] (-1315.751) -- 0:01:59
538500 -- (-1312.906) (-1314.194) (-1326.421) [-1313.628] * (-1315.434) (-1314.298) [-1313.623] (-1345.006) -- 0:01:59
539000 -- (-1326.677) (-1313.082) (-1313.519) [-1317.406] * (-1319.465) (-1327.782) [-1324.210] (-1317.538) -- 0:01:58
539500 -- [-1305.687] (-1332.943) (-1319.307) (-1320.304) * (-1324.676) [-1316.515] (-1324.190) (-1315.994) -- 0:01:58
540000 -- [-1310.947] (-1330.180) (-1316.419) (-1330.144) * (-1321.519) [-1307.286] (-1310.324) (-1322.613) -- 0:01:58
Average standard deviation of split frequencies: 0.010172
540500 -- (-1311.495) [-1319.557] (-1312.551) (-1325.358) * (-1322.326) (-1339.994) [-1318.073] (-1309.193) -- 0:01:58
541000 -- (-1325.440) (-1324.943) (-1328.176) [-1311.068] * (-1314.885) [-1310.803] (-1319.092) (-1324.443) -- 0:01:58
541500 -- (-1328.240) [-1320.183] (-1315.108) (-1320.111) * (-1313.602) (-1329.097) [-1307.071] (-1327.630) -- 0:01:58
542000 -- (-1315.433) (-1321.687) [-1312.909] (-1312.390) * (-1333.096) (-1330.120) (-1322.828) [-1315.591] -- 0:01:58
542500 -- (-1316.814) (-1339.328) [-1309.777] (-1316.599) * [-1310.545] (-1326.654) (-1320.549) (-1311.811) -- 0:01:58
543000 -- (-1310.982) (-1319.539) [-1312.907] (-1313.756) * (-1316.320) (-1321.565) (-1324.574) [-1306.320] -- 0:01:57
543500 -- (-1315.943) [-1310.334] (-1326.981) (-1316.613) * (-1329.218) (-1318.835) (-1335.014) [-1310.792] -- 0:01:57
544000 -- (-1318.035) (-1328.485) (-1334.174) [-1314.867] * (-1309.476) (-1317.984) (-1310.857) [-1322.248] -- 0:01:57
544500 -- [-1305.130] (-1316.069) (-1310.132) (-1312.414) * (-1336.689) (-1315.037) [-1316.280] (-1314.201) -- 0:01:57
545000 -- (-1313.874) (-1329.789) [-1308.665] (-1314.906) * (-1336.730) (-1316.587) (-1317.277) [-1326.199] -- 0:01:57
Average standard deviation of split frequencies: 0.009890
545500 -- (-1312.616) (-1318.135) [-1324.137] (-1315.440) * (-1324.667) [-1322.554] (-1315.057) (-1319.347) -- 0:01:57
546000 -- (-1321.744) [-1321.794] (-1328.161) (-1313.519) * (-1320.766) (-1310.589) (-1318.350) [-1309.982] -- 0:01:57
546500 -- (-1331.311) (-1320.749) (-1322.747) [-1307.292] * (-1326.026) (-1323.506) (-1311.990) [-1317.717] -- 0:01:57
547000 -- (-1320.813) (-1326.271) (-1325.387) [-1313.317] * (-1318.923) (-1316.630) (-1314.724) [-1310.457] -- 0:01:56
547500 -- [-1316.225] (-1328.407) (-1332.559) (-1310.028) * (-1313.922) [-1318.646] (-1313.149) (-1319.971) -- 0:01:56
548000 -- (-1320.477) [-1316.483] (-1320.820) (-1319.095) * (-1322.308) (-1315.731) [-1317.861] (-1316.016) -- 0:01:56
548500 -- (-1320.063) [-1323.146] (-1325.663) (-1315.448) * (-1313.695) [-1316.844] (-1325.898) (-1318.520) -- 0:01:56
549000 -- (-1322.646) [-1313.666] (-1316.575) (-1322.774) * (-1313.483) [-1311.143] (-1318.575) (-1330.123) -- 0:01:56
549500 -- (-1321.971) (-1327.696) (-1323.401) [-1315.127] * (-1315.230) (-1326.442) (-1319.125) [-1312.761] -- 0:01:56
550000 -- (-1316.541) [-1320.328] (-1336.060) (-1320.965) * (-1320.645) (-1324.245) (-1330.391) [-1308.144] -- 0:01:56
Average standard deviation of split frequencies: 0.009378
550500 -- (-1315.323) (-1320.789) [-1321.988] (-1316.579) * (-1313.169) (-1311.705) (-1318.184) [-1315.641] -- 0:01:55
551000 -- (-1317.936) (-1310.049) [-1314.977] (-1317.201) * (-1333.885) (-1320.142) [-1318.194] (-1321.113) -- 0:01:55
551500 -- (-1333.343) [-1313.810] (-1333.580) (-1319.647) * (-1336.387) [-1321.539] (-1316.974) (-1310.099) -- 0:01:55
552000 -- (-1315.113) [-1305.922] (-1316.826) (-1332.340) * [-1313.744] (-1318.474) (-1313.400) (-1317.674) -- 0:01:55
552500 -- (-1308.038) (-1313.167) [-1319.310] (-1321.045) * [-1318.256] (-1311.197) (-1323.214) (-1312.804) -- 0:01:55
553000 -- [-1311.907] (-1324.393) (-1324.897) (-1318.528) * (-1319.198) (-1313.451) (-1314.125) [-1320.967] -- 0:01:55
553500 -- [-1309.252] (-1311.481) (-1321.340) (-1310.036) * (-1311.156) [-1313.752] (-1323.639) (-1321.813) -- 0:01:55
554000 -- (-1325.293) (-1320.668) (-1314.947) [-1315.376] * (-1313.496) [-1305.282] (-1325.928) (-1329.959) -- 0:01:55
554500 -- (-1322.677) [-1308.748] (-1324.120) (-1324.637) * (-1317.368) [-1308.905] (-1318.666) (-1338.473) -- 0:01:54
555000 -- (-1323.780) (-1315.945) [-1313.694] (-1323.436) * (-1313.642) [-1310.582] (-1323.241) (-1325.140) -- 0:01:54
Average standard deviation of split frequencies: 0.009892
555500 -- (-1320.080) [-1307.180] (-1328.067) (-1317.174) * (-1310.057) (-1306.930) [-1324.671] (-1337.256) -- 0:01:54
556000 -- (-1326.007) (-1324.618) (-1313.136) [-1318.632] * (-1319.098) [-1305.021] (-1329.063) (-1344.346) -- 0:01:54
556500 -- [-1320.374] (-1313.911) (-1321.879) (-1324.053) * (-1315.457) (-1326.008) [-1319.650] (-1338.097) -- 0:01:54
557000 -- (-1319.295) (-1325.314) (-1313.617) [-1305.841] * (-1333.896) [-1313.187] (-1328.948) (-1330.482) -- 0:01:54
557500 -- (-1330.075) (-1310.145) [-1309.271] (-1317.274) * (-1319.488) [-1307.723] (-1326.526) (-1323.290) -- 0:01:54
558000 -- (-1333.562) (-1330.580) [-1304.123] (-1317.510) * (-1333.505) (-1321.305) (-1319.562) [-1312.385] -- 0:01:54
558500 -- (-1324.949) (-1323.509) [-1307.701] (-1310.462) * (-1315.069) [-1314.371] (-1311.418) (-1331.154) -- 0:01:53
559000 -- [-1310.201] (-1308.915) (-1324.552) (-1313.581) * (-1321.584) (-1309.104) [-1314.607] (-1325.116) -- 0:01:53
559500 -- (-1315.955) (-1321.624) [-1306.209] (-1307.802) * (-1326.388) (-1317.942) [-1315.518] (-1315.085) -- 0:01:53
560000 -- (-1319.991) (-1313.831) [-1318.174] (-1313.653) * (-1319.333) (-1320.809) (-1309.486) [-1312.519] -- 0:01:53
Average standard deviation of split frequencies: 0.009489
560500 -- (-1313.754) (-1316.935) [-1309.282] (-1321.439) * [-1317.241] (-1319.463) (-1319.814) (-1321.721) -- 0:01:53
561000 -- (-1320.497) (-1304.281) (-1333.735) [-1313.526] * (-1317.460) (-1324.454) [-1316.384] (-1322.866) -- 0:01:53
561500 -- (-1317.224) (-1331.136) [-1317.070] (-1317.712) * [-1311.482] (-1318.449) (-1306.228) (-1308.605) -- 0:01:53
562000 -- [-1311.319] (-1317.606) (-1321.754) (-1328.819) * (-1318.199) [-1311.958] (-1321.664) (-1327.441) -- 0:01:53
562500 -- (-1318.871) (-1316.872) [-1317.753] (-1309.848) * [-1313.854] (-1317.057) (-1308.269) (-1318.658) -- 0:01:52
563000 -- (-1313.341) [-1307.645] (-1329.337) (-1319.387) * [-1314.141] (-1326.395) (-1308.916) (-1325.996) -- 0:01:52
563500 -- (-1313.785) (-1318.676) [-1311.744] (-1338.928) * [-1309.569] (-1331.985) (-1320.869) (-1319.649) -- 0:01:53
564000 -- [-1327.679] (-1309.805) (-1313.546) (-1327.231) * [-1316.196] (-1314.030) (-1309.276) (-1328.784) -- 0:01:52
564500 -- (-1319.510) [-1310.768] (-1315.763) (-1309.430) * (-1330.955) [-1312.290] (-1308.960) (-1314.171) -- 0:01:52
565000 -- (-1314.566) (-1324.299) (-1318.678) [-1309.421] * (-1325.904) (-1336.019) [-1311.039] (-1324.764) -- 0:01:52
Average standard deviation of split frequencies: 0.009439
565500 -- [-1312.333] (-1314.412) (-1321.831) (-1324.575) * (-1312.403) (-1329.246) (-1312.937) [-1321.943] -- 0:01:52
566000 -- (-1329.785) (-1328.244) (-1307.229) [-1319.828] * (-1324.750) (-1336.527) (-1316.470) [-1309.867] -- 0:01:51
566500 -- (-1320.820) (-1324.233) [-1309.030] (-1321.738) * (-1327.860) (-1321.157) [-1319.300] (-1315.646) -- 0:01:51
567000 -- (-1333.294) [-1314.497] (-1306.817) (-1320.856) * (-1313.300) [-1325.901] (-1312.079) (-1324.661) -- 0:01:51
567500 -- (-1309.962) (-1319.822) [-1308.042] (-1322.412) * [-1312.144] (-1314.403) (-1312.498) (-1320.423) -- 0:01:52
568000 -- (-1326.178) (-1321.793) [-1315.841] (-1322.240) * (-1315.719) (-1312.251) (-1334.233) [-1312.078] -- 0:01:51
568500 -- (-1318.721) (-1319.351) [-1304.629] (-1339.922) * [-1314.640] (-1310.230) (-1329.277) (-1334.709) -- 0:01:51
569000 -- (-1308.093) (-1321.749) [-1307.240] (-1324.795) * [-1310.938] (-1308.467) (-1314.755) (-1339.101) -- 0:01:51
569500 -- [-1307.307] (-1317.813) (-1318.366) (-1324.936) * [-1316.828] (-1305.047) (-1329.434) (-1318.306) -- 0:01:51
570000 -- [-1313.172] (-1316.293) (-1319.914) (-1320.262) * (-1326.699) (-1311.535) (-1328.980) [-1317.878] -- 0:01:50
Average standard deviation of split frequencies: 0.009913
570500 -- (-1315.043) (-1319.374) (-1323.781) [-1310.928] * (-1321.603) [-1317.484] (-1316.928) (-1326.013) -- 0:01:50
571000 -- (-1315.029) (-1339.172) (-1322.458) [-1310.154] * [-1311.763] (-1310.494) (-1318.751) (-1321.060) -- 0:01:51
571500 -- (-1310.408) (-1327.164) [-1312.417] (-1315.978) * (-1316.006) (-1308.092) [-1316.420] (-1328.281) -- 0:01:50
572000 -- [-1309.980] (-1325.401) (-1326.208) (-1313.561) * [-1307.923] (-1308.822) (-1318.034) (-1316.030) -- 0:01:50
572500 -- (-1329.142) [-1320.057] (-1321.907) (-1310.645) * (-1309.879) (-1326.991) [-1315.390] (-1312.859) -- 0:01:50
573000 -- (-1315.169) [-1311.372] (-1321.854) (-1320.506) * [-1311.334] (-1311.335) (-1324.438) (-1316.230) -- 0:01:50
573500 -- [-1312.993] (-1329.897) (-1336.209) (-1326.567) * (-1308.872) (-1321.573) (-1315.338) [-1317.940] -- 0:01:50
574000 -- (-1312.070) (-1333.786) (-1328.136) [-1329.332] * (-1323.925) [-1311.962] (-1313.810) (-1310.408) -- 0:01:49
574500 -- (-1314.960) (-1327.426) (-1328.719) [-1306.413] * (-1339.475) (-1314.199) (-1328.801) [-1318.391] -- 0:01:49
575000 -- [-1306.227] (-1328.359) (-1332.587) (-1306.011) * (-1325.880) (-1319.816) (-1317.757) [-1314.845] -- 0:01:50
Average standard deviation of split frequencies: 0.010367
575500 -- (-1315.469) (-1314.200) [-1316.022] (-1321.698) * [-1315.803] (-1320.876) (-1335.002) (-1321.889) -- 0:01:49
576000 -- (-1323.649) (-1332.736) (-1319.742) [-1312.952] * [-1311.841] (-1321.414) (-1336.355) (-1310.441) -- 0:01:49
576500 -- (-1310.608) (-1323.295) [-1316.548] (-1321.313) * [-1314.924] (-1312.386) (-1319.011) (-1323.600) -- 0:01:49
577000 -- (-1315.348) (-1323.603) (-1305.563) [-1311.886] * (-1312.343) (-1323.823) (-1329.036) [-1309.679] -- 0:01:49
577500 -- (-1326.425) (-1324.143) (-1318.086) [-1312.321] * (-1318.334) [-1305.199] (-1319.330) (-1310.701) -- 0:01:49
578000 -- (-1317.612) (-1315.929) [-1326.814] (-1324.596) * (-1312.902) [-1302.259] (-1330.092) (-1327.070) -- 0:01:48
578500 -- (-1314.527) (-1328.225) (-1310.357) [-1323.823] * [-1311.926] (-1329.647) (-1314.474) (-1325.676) -- 0:01:48
579000 -- (-1322.619) (-1324.641) (-1328.724) [-1311.231] * (-1317.578) (-1324.002) (-1342.322) [-1321.318] -- 0:01:49
579500 -- (-1305.058) [-1318.246] (-1335.940) (-1312.450) * [-1314.006] (-1313.331) (-1334.853) (-1327.874) -- 0:01:48
580000 -- (-1328.646) [-1321.266] (-1312.445) (-1320.986) * (-1320.533) [-1310.473] (-1324.600) (-1324.374) -- 0:01:48
Average standard deviation of split frequencies: 0.010438
580500 -- (-1324.551) (-1318.489) (-1313.577) [-1311.516] * (-1318.534) [-1308.801] (-1314.925) (-1330.068) -- 0:01:48
581000 -- (-1323.587) [-1313.968] (-1319.981) (-1316.662) * (-1308.354) (-1317.358) [-1311.773] (-1321.166) -- 0:01:48
581500 -- (-1324.352) (-1320.673) (-1318.000) [-1307.935] * (-1314.599) [-1321.196] (-1322.692) (-1319.335) -- 0:01:47
582000 -- [-1310.181] (-1309.772) (-1321.996) (-1322.312) * (-1315.389) [-1311.668] (-1324.368) (-1317.337) -- 0:01:47
582500 -- (-1321.171) (-1316.144) (-1305.112) [-1307.838] * [-1308.545] (-1324.560) (-1326.746) (-1317.828) -- 0:01:47
583000 -- (-1322.556) (-1310.333) (-1316.595) [-1316.154] * [-1310.910] (-1314.077) (-1338.750) (-1327.661) -- 0:01:48
583500 -- (-1317.267) (-1317.339) (-1323.516) [-1313.499] * (-1316.651) [-1310.120] (-1341.638) (-1316.882) -- 0:01:47
584000 -- (-1332.725) [-1309.967] (-1311.161) (-1335.669) * (-1318.505) [-1312.836] (-1323.847) (-1323.448) -- 0:01:47
584500 -- (-1320.665) [-1312.196] (-1324.010) (-1326.934) * (-1310.447) (-1318.395) (-1335.309) [-1311.432] -- 0:01:47
585000 -- (-1323.487) (-1308.560) (-1332.174) [-1315.457] * (-1330.659) (-1318.487) [-1323.799] (-1333.649) -- 0:01:47
Average standard deviation of split frequencies: 0.010573
585500 -- [-1309.244] (-1316.866) (-1335.834) (-1318.797) * [-1312.449] (-1319.455) (-1337.746) (-1330.853) -- 0:01:46
586000 -- [-1314.945] (-1321.514) (-1326.704) (-1318.763) * [-1315.163] (-1338.012) (-1311.985) (-1323.489) -- 0:01:46
586500 -- [-1320.889] (-1337.640) (-1312.682) (-1317.843) * [-1324.664] (-1324.802) (-1328.284) (-1319.163) -- 0:01:47
587000 -- [-1314.905] (-1320.294) (-1315.345) (-1326.679) * [-1310.335] (-1316.120) (-1329.582) (-1328.541) -- 0:01:46
587500 -- (-1319.953) [-1317.151] (-1317.295) (-1314.377) * (-1312.915) (-1323.988) (-1334.276) [-1315.856] -- 0:01:46
588000 -- (-1327.096) [-1325.045] (-1324.408) (-1320.033) * (-1320.670) (-1321.198) [-1313.588] (-1316.308) -- 0:01:46
588500 -- (-1311.797) (-1323.612) [-1315.417] (-1324.390) * (-1317.734) (-1327.588) [-1311.971] (-1317.659) -- 0:01:46
589000 -- (-1320.056) [-1314.829] (-1338.431) (-1315.233) * (-1329.148) (-1325.154) [-1308.340] (-1323.187) -- 0:01:46
589500 -- [-1311.369] (-1318.959) (-1318.882) (-1324.790) * (-1326.923) (-1312.823) (-1324.826) [-1315.775] -- 0:01:45
590000 -- (-1314.361) [-1321.088] (-1330.475) (-1323.627) * (-1328.966) (-1320.162) (-1325.963) [-1316.935] -- 0:01:45
Average standard deviation of split frequencies: 0.009758
590500 -- [-1312.929] (-1325.809) (-1320.989) (-1309.186) * [-1312.764] (-1323.442) (-1322.819) (-1335.101) -- 0:01:46
591000 -- (-1330.073) (-1311.469) [-1324.843] (-1327.549) * (-1310.645) (-1328.938) (-1315.392) [-1318.289] -- 0:01:45
591500 -- (-1319.637) (-1317.718) [-1313.040] (-1325.788) * (-1316.986) (-1323.960) (-1323.857) [-1311.707] -- 0:01:45
592000 -- (-1314.498) (-1315.399) (-1319.893) [-1319.304] * (-1323.214) [-1318.933] (-1310.965) (-1307.774) -- 0:01:45
592500 -- (-1330.618) [-1316.986] (-1312.593) (-1317.626) * (-1318.560) (-1320.677) [-1323.023] (-1320.724) -- 0:01:45
593000 -- (-1325.890) (-1320.265) (-1317.903) [-1316.755] * [-1315.745] (-1319.213) (-1311.589) (-1318.177) -- 0:01:45
593500 -- (-1330.482) (-1310.938) [-1309.653] (-1312.001) * (-1315.226) [-1310.841] (-1328.681) (-1312.439) -- 0:01:44
594000 -- (-1332.623) [-1309.574] (-1314.670) (-1314.366) * [-1314.526] (-1316.234) (-1336.187) (-1321.949) -- 0:01:45
594500 -- [-1318.077] (-1325.145) (-1314.120) (-1314.433) * (-1319.755) (-1309.949) (-1318.687) [-1316.323] -- 0:01:45
595000 -- [-1314.077] (-1323.770) (-1317.892) (-1317.604) * (-1327.752) (-1311.450) (-1328.904) [-1312.986] -- 0:01:44
Average standard deviation of split frequencies: 0.010210
595500 -- (-1336.083) (-1314.891) [-1308.077] (-1323.602) * (-1344.224) [-1314.710] (-1318.631) (-1323.184) -- 0:01:44
596000 -- (-1331.408) (-1334.205) [-1315.427] (-1316.178) * (-1346.529) (-1330.582) [-1315.529] (-1319.885) -- 0:01:44
596500 -- (-1311.714) (-1308.767) [-1316.039] (-1334.959) * (-1323.522) (-1323.809) [-1315.783] (-1315.530) -- 0:01:44
597000 -- [-1321.641] (-1323.755) (-1310.544) (-1324.936) * (-1319.707) (-1317.943) [-1313.404] (-1310.163) -- 0:01:43
597500 -- (-1308.374) [-1307.257] (-1313.172) (-1319.277) * (-1325.626) [-1317.363] (-1318.794) (-1310.208) -- 0:01:43
598000 -- (-1325.275) [-1308.761] (-1326.690) (-1322.799) * (-1323.108) (-1317.232) [-1319.323] (-1321.286) -- 0:01:44
598500 -- [-1318.825] (-1318.048) (-1339.565) (-1316.037) * (-1332.293) (-1313.467) (-1319.179) [-1319.597] -- 0:01:43
599000 -- (-1321.117) [-1310.749] (-1317.657) (-1323.756) * (-1320.789) (-1312.838) (-1338.266) [-1310.767] -- 0:01:43
599500 -- (-1317.237) (-1317.339) (-1340.343) [-1330.819] * (-1319.132) [-1317.364] (-1325.153) (-1309.823) -- 0:01:43
600000 -- (-1318.240) [-1311.713] (-1324.381) (-1325.374) * (-1323.992) (-1311.167) [-1312.249] (-1325.444) -- 0:01:43
Average standard deviation of split frequencies: 0.010373
600500 -- (-1330.763) (-1309.961) [-1312.089] (-1327.164) * (-1330.467) [-1323.909] (-1313.542) (-1310.177) -- 0:01:43
601000 -- (-1317.157) [-1319.571] (-1326.630) (-1318.926) * (-1320.129) (-1327.384) (-1318.245) [-1306.253] -- 0:01:42
601500 -- (-1318.094) (-1311.471) [-1323.640] (-1312.529) * (-1316.188) (-1322.916) (-1313.470) [-1321.254] -- 0:01:42
602000 -- (-1331.169) (-1314.737) (-1312.592) [-1310.193] * (-1319.227) (-1316.669) [-1312.064] (-1324.430) -- 0:01:43
602500 -- (-1314.915) (-1321.293) [-1306.303] (-1316.212) * (-1328.559) [-1316.429] (-1326.093) (-1312.128) -- 0:01:42
603000 -- (-1333.638) (-1309.802) (-1317.240) [-1315.903] * (-1322.716) [-1313.311] (-1317.854) (-1311.420) -- 0:01:42
603500 -- (-1334.672) (-1324.858) (-1309.462) [-1312.602] * (-1319.388) (-1334.207) (-1312.095) [-1309.198] -- 0:01:42
604000 -- (-1308.925) [-1306.514] (-1315.136) (-1308.653) * [-1313.929] (-1332.372) (-1310.939) (-1324.200) -- 0:01:42
604500 -- (-1325.916) (-1315.413) (-1321.844) [-1317.195] * (-1319.611) (-1310.517) (-1321.911) [-1302.326] -- 0:01:42
605000 -- (-1325.181) (-1311.418) (-1307.497) [-1307.967] * (-1320.256) [-1307.355] (-1324.369) (-1326.026) -- 0:01:41
Average standard deviation of split frequencies: 0.010485
605500 -- (-1329.407) (-1315.440) (-1320.072) [-1316.698] * (-1312.488) [-1309.751] (-1306.323) (-1326.693) -- 0:01:41
606000 -- (-1315.917) (-1323.129) [-1317.068] (-1314.748) * (-1308.541) (-1319.614) [-1311.781] (-1340.772) -- 0:01:42
606500 -- (-1323.177) (-1318.991) (-1309.159) [-1319.653] * (-1312.456) [-1314.829] (-1319.133) (-1329.078) -- 0:01:41
607000 -- (-1319.145) [-1319.548] (-1315.710) (-1330.119) * (-1314.954) (-1316.414) [-1304.865] (-1333.033) -- 0:01:41
607500 -- (-1315.701) [-1319.697] (-1308.052) (-1328.632) * (-1319.770) [-1312.281] (-1322.158) (-1328.233) -- 0:01:41
608000 -- [-1311.387] (-1321.039) (-1322.640) (-1309.169) * (-1318.695) [-1325.795] (-1318.006) (-1334.937) -- 0:01:41
608500 -- (-1323.338) [-1313.547] (-1308.418) (-1326.149) * (-1319.642) (-1321.910) [-1320.964] (-1327.668) -- 0:01:41
609000 -- [-1305.425] (-1341.279) (-1314.136) (-1321.322) * [-1319.032] (-1318.181) (-1311.580) (-1319.034) -- 0:01:40
609500 -- (-1318.758) (-1344.214) (-1324.868) [-1314.628] * (-1311.897) [-1320.272] (-1306.408) (-1332.565) -- 0:01:40
610000 -- [-1310.257] (-1320.073) (-1325.172) (-1320.728) * (-1326.733) [-1327.368] (-1322.748) (-1323.867) -- 0:01:41
Average standard deviation of split frequencies: 0.010841
610500 -- [-1307.752] (-1314.743) (-1334.277) (-1321.433) * [-1320.380] (-1328.904) (-1320.692) (-1317.146) -- 0:01:40
611000 -- (-1324.399) [-1315.378] (-1327.104) (-1317.812) * (-1331.721) (-1320.365) (-1314.095) [-1315.789] -- 0:01:40
611500 -- (-1329.593) (-1321.139) (-1321.403) [-1306.028] * [-1311.835] (-1322.605) (-1326.077) (-1334.558) -- 0:01:40
612000 -- (-1348.971) (-1309.444) (-1309.250) [-1316.253] * [-1310.649] (-1320.558) (-1326.348) (-1327.612) -- 0:01:40
612500 -- (-1322.116) (-1320.827) (-1316.743) [-1319.691] * (-1312.732) (-1330.087) [-1318.314] (-1327.049) -- 0:01:39
613000 -- [-1309.062] (-1308.563) (-1319.473) (-1328.893) * (-1317.748) (-1311.543) [-1313.796] (-1324.009) -- 0:01:39
613500 -- [-1314.215] (-1307.353) (-1314.444) (-1344.422) * (-1318.733) (-1311.573) [-1314.322] (-1321.310) -- 0:01:39
614000 -- (-1325.312) [-1315.179] (-1319.788) (-1313.981) * [-1312.675] (-1313.392) (-1312.827) (-1333.181) -- 0:01:39
614500 -- (-1318.223) [-1319.558] (-1326.979) (-1315.953) * (-1314.175) [-1309.559] (-1314.949) (-1321.539) -- 0:01:39
615000 -- (-1315.790) [-1319.823] (-1328.967) (-1324.011) * (-1323.093) (-1305.501) [-1309.191] (-1337.426) -- 0:01:39
Average standard deviation of split frequencies: 0.010947
615500 -- (-1316.899) [-1311.535] (-1322.104) (-1341.759) * (-1324.230) (-1327.868) (-1325.965) [-1317.628] -- 0:01:39
616000 -- (-1317.072) (-1319.058) (-1317.539) [-1329.547] * [-1318.622] (-1318.078) (-1330.012) (-1331.040) -- 0:01:39
616500 -- [-1317.531] (-1317.667) (-1318.172) (-1318.397) * (-1314.134) [-1306.321] (-1344.822) (-1326.895) -- 0:01:38
617000 -- [-1309.017] (-1315.957) (-1303.759) (-1335.733) * (-1311.651) (-1313.310) (-1320.550) [-1314.447] -- 0:01:38
617500 -- (-1303.501) [-1308.402] (-1314.603) (-1332.331) * (-1312.577) [-1313.160] (-1340.390) (-1309.840) -- 0:01:38
618000 -- (-1311.976) (-1323.250) (-1323.303) [-1321.661] * (-1318.743) (-1320.350) (-1326.488) [-1316.762] -- 0:01:38
618500 -- (-1313.569) (-1320.748) [-1312.367] (-1325.391) * (-1307.982) (-1337.007) (-1318.782) [-1312.754] -- 0:01:38
619000 -- (-1322.532) [-1316.274] (-1336.653) (-1328.248) * (-1312.404) (-1326.685) [-1323.355] (-1326.013) -- 0:01:38
619500 -- (-1317.094) [-1308.957] (-1321.884) (-1346.736) * [-1311.651] (-1331.058) (-1330.396) (-1323.160) -- 0:01:38
620000 -- (-1313.016) [-1308.984] (-1320.142) (-1331.385) * [-1308.853] (-1316.344) (-1329.253) (-1322.908) -- 0:01:38
Average standard deviation of split frequencies: 0.010336
620500 -- (-1312.810) (-1310.588) [-1314.103] (-1328.064) * [-1313.238] (-1322.538) (-1333.205) (-1315.406) -- 0:01:37
621000 -- (-1313.460) (-1316.339) [-1313.027] (-1332.799) * (-1318.437) [-1319.189] (-1325.313) (-1310.363) -- 0:01:37
621500 -- [-1314.884] (-1314.816) (-1319.973) (-1322.808) * (-1302.928) (-1334.278) (-1322.039) [-1314.601] -- 0:01:37
622000 -- (-1315.269) (-1326.265) [-1304.259] (-1323.095) * (-1317.955) (-1336.925) (-1323.181) [-1309.885] -- 0:01:37
622500 -- [-1323.691] (-1319.520) (-1312.212) (-1333.208) * (-1313.641) [-1303.081] (-1317.531) (-1334.082) -- 0:01:37
623000 -- (-1321.041) [-1313.517] (-1312.760) (-1338.527) * [-1316.020] (-1322.384) (-1316.381) (-1327.102) -- 0:01:37
623500 -- (-1318.944) (-1321.283) [-1312.466] (-1333.864) * (-1331.159) (-1320.246) [-1317.024] (-1325.595) -- 0:01:37
624000 -- (-1314.062) (-1320.198) [-1313.571] (-1323.825) * (-1314.002) (-1318.900) (-1330.384) [-1318.688] -- 0:01:37
624500 -- (-1323.734) (-1316.792) (-1320.052) [-1317.184] * (-1301.980) (-1322.040) (-1335.482) [-1319.704] -- 0:01:36
625000 -- (-1309.168) [-1311.212] (-1320.511) (-1315.420) * (-1326.458) [-1317.758] (-1321.603) (-1315.374) -- 0:01:36
Average standard deviation of split frequencies: 0.010150
625500 -- [-1313.375] (-1314.087) (-1323.830) (-1310.972) * (-1327.721) [-1315.396] (-1316.117) (-1317.178) -- 0:01:36
626000 -- (-1341.563) (-1314.274) (-1310.981) [-1314.720] * (-1321.954) [-1312.236] (-1315.441) (-1327.553) -- 0:01:36
626500 -- (-1335.663) (-1326.047) [-1321.136] (-1321.993) * [-1325.430] (-1322.408) (-1313.454) (-1317.829) -- 0:01:36
627000 -- (-1316.274) (-1328.699) [-1309.856] (-1315.829) * (-1313.573) (-1321.871) (-1331.271) [-1323.948] -- 0:01:36
627500 -- (-1328.324) [-1311.320] (-1311.589) (-1320.540) * (-1313.040) [-1310.265] (-1333.976) (-1312.587) -- 0:01:36
628000 -- [-1318.392] (-1314.605) (-1324.240) (-1315.110) * (-1318.656) (-1322.370) [-1328.528] (-1314.993) -- 0:01:35
628500 -- (-1321.947) (-1313.804) [-1317.310] (-1316.931) * (-1332.987) (-1329.827) (-1320.453) [-1312.072] -- 0:01:35
629000 -- (-1314.163) (-1316.759) [-1310.852] (-1332.959) * (-1316.070) (-1316.919) [-1317.187] (-1328.193) -- 0:01:35
629500 -- (-1324.094) [-1318.394] (-1312.594) (-1317.335) * [-1325.905] (-1315.487) (-1318.305) (-1309.871) -- 0:01:35
630000 -- (-1335.083) (-1325.955) [-1315.703] (-1324.042) * (-1316.546) (-1307.973) (-1323.160) [-1313.526] -- 0:01:35
Average standard deviation of split frequencies: 0.010205
630500 -- (-1316.405) (-1318.662) (-1336.514) [-1312.729] * (-1321.129) (-1313.595) [-1314.895] (-1315.225) -- 0:01:35
631000 -- [-1311.340] (-1314.466) (-1329.305) (-1320.277) * (-1311.823) [-1315.935] (-1321.677) (-1311.530) -- 0:01:35
631500 -- (-1353.453) [-1312.260] (-1318.227) (-1331.055) * [-1315.592] (-1316.217) (-1320.571) (-1308.554) -- 0:01:35
632000 -- (-1320.715) (-1315.959) [-1318.544] (-1317.454) * (-1321.933) (-1323.945) [-1312.026] (-1309.467) -- 0:01:34
632500 -- (-1321.682) [-1313.554] (-1312.562) (-1309.746) * (-1338.607) (-1327.520) (-1316.101) [-1312.778] -- 0:01:34
633000 -- [-1316.728] (-1321.760) (-1326.327) (-1342.394) * (-1313.782) (-1313.123) [-1314.832] (-1326.015) -- 0:01:34
633500 -- (-1312.285) (-1329.532) [-1326.471] (-1341.697) * (-1322.285) [-1317.371] (-1317.810) (-1318.731) -- 0:01:34
634000 -- [-1310.849] (-1318.254) (-1318.742) (-1326.983) * (-1322.936) (-1318.817) [-1314.170] (-1317.024) -- 0:01:34
634500 -- [-1307.296] (-1332.975) (-1317.427) (-1317.394) * (-1319.145) [-1319.343] (-1316.288) (-1321.471) -- 0:01:34
635000 -- [-1317.211] (-1348.436) (-1311.607) (-1311.068) * (-1311.373) (-1308.805) [-1306.151] (-1327.356) -- 0:01:34
Average standard deviation of split frequencies: 0.010055
635500 -- [-1314.210] (-1323.564) (-1315.449) (-1313.955) * (-1307.403) (-1316.037) (-1326.371) [-1307.839] -- 0:01:34
636000 -- (-1319.947) (-1329.721) [-1309.065] (-1317.164) * (-1315.272) [-1311.709] (-1317.979) (-1326.316) -- 0:01:33
636500 -- [-1310.164] (-1311.456) (-1316.537) (-1308.395) * (-1327.405) (-1321.666) (-1302.527) [-1319.386] -- 0:01:33
637000 -- (-1320.797) (-1314.929) [-1319.040] (-1313.598) * (-1318.772) [-1315.621] (-1329.168) (-1326.372) -- 0:01:33
637500 -- (-1329.762) (-1327.799) (-1323.715) [-1309.942] * (-1326.845) (-1332.610) [-1310.227] (-1320.559) -- 0:01:33
638000 -- (-1334.326) [-1322.339] (-1329.007) (-1311.263) * (-1326.330) [-1317.994] (-1324.150) (-1304.066) -- 0:01:33
638500 -- (-1317.685) [-1318.606] (-1327.638) (-1321.361) * (-1330.738) (-1326.762) [-1309.278] (-1321.315) -- 0:01:33
639000 -- (-1322.190) [-1311.932] (-1316.233) (-1321.740) * (-1326.905) (-1323.681) [-1318.292] (-1326.476) -- 0:01:33
639500 -- (-1312.871) (-1324.856) (-1311.731) [-1310.884] * (-1322.511) (-1325.228) (-1339.204) [-1306.958] -- 0:01:33
640000 -- (-1319.658) (-1324.618) (-1311.990) [-1309.279] * (-1319.746) [-1317.594] (-1313.314) (-1319.117) -- 0:01:32
Average standard deviation of split frequencies: 0.010237
640500 -- (-1334.955) [-1315.549] (-1309.540) (-1318.459) * (-1323.745) [-1317.545] (-1323.316) (-1313.412) -- 0:01:32
641000 -- (-1336.985) (-1318.448) [-1310.560] (-1317.833) * (-1311.000) (-1333.618) [-1310.311] (-1318.867) -- 0:01:32
641500 -- (-1317.360) (-1314.794) (-1327.412) [-1316.404] * [-1314.460] (-1324.698) (-1315.620) (-1314.751) -- 0:01:32
642000 -- (-1332.999) (-1320.680) [-1319.978] (-1317.491) * (-1309.959) (-1323.622) (-1331.406) [-1313.997] -- 0:01:32
642500 -- (-1324.222) [-1320.010] (-1317.553) (-1319.299) * (-1314.334) (-1323.996) (-1326.400) [-1310.240] -- 0:01:32
643000 -- (-1323.028) (-1321.131) (-1315.184) [-1307.509] * [-1308.597] (-1323.505) (-1334.806) (-1309.115) -- 0:01:32
643500 -- (-1319.814) (-1324.002) (-1318.523) [-1318.656] * (-1314.060) (-1324.911) (-1320.736) [-1309.006] -- 0:01:31
644000 -- (-1321.977) (-1313.585) (-1312.417) [-1316.114] * (-1323.167) [-1310.478] (-1318.342) (-1316.351) -- 0:01:31
644500 -- (-1316.253) (-1328.666) [-1310.840] (-1318.330) * (-1321.054) (-1327.738) (-1308.464) [-1313.304] -- 0:01:31
645000 -- (-1320.109) (-1316.481) (-1309.927) [-1324.991] * (-1327.879) (-1328.759) (-1313.882) [-1319.623] -- 0:01:31
Average standard deviation of split frequencies: 0.010343
645500 -- (-1313.917) (-1317.963) (-1316.787) [-1318.044] * (-1315.873) [-1311.859] (-1315.791) (-1312.671) -- 0:01:31
646000 -- (-1321.178) (-1322.251) [-1309.680] (-1331.679) * (-1313.184) (-1315.855) [-1315.704] (-1322.363) -- 0:01:31
646500 -- (-1316.333) [-1313.488] (-1310.674) (-1324.625) * (-1310.056) [-1316.909] (-1314.002) (-1314.172) -- 0:01:31
647000 -- (-1312.334) (-1307.249) [-1322.850] (-1331.930) * [-1312.687] (-1326.033) (-1331.468) (-1306.084) -- 0:01:31
647500 -- (-1308.269) (-1318.323) (-1313.189) [-1313.518] * [-1315.086] (-1313.363) (-1320.371) (-1312.773) -- 0:01:30
648000 -- (-1319.319) (-1318.478) (-1323.744) [-1321.906] * (-1308.464) (-1309.987) [-1310.969] (-1307.715) -- 0:01:30
648500 -- [-1312.093] (-1312.129) (-1333.682) (-1310.011) * [-1309.610] (-1341.364) (-1313.159) (-1316.270) -- 0:01:30
649000 -- (-1321.723) (-1322.292) (-1315.465) [-1316.011] * (-1323.584) [-1318.354] (-1313.858) (-1329.398) -- 0:01:30
649500 -- (-1320.382) [-1315.643] (-1316.817) (-1312.067) * (-1312.042) (-1314.398) (-1317.309) [-1308.532] -- 0:01:30
650000 -- (-1318.579) (-1335.298) [-1312.171] (-1311.088) * (-1308.939) [-1322.870] (-1320.647) (-1317.716) -- 0:01:30
Average standard deviation of split frequencies: 0.010080
650500 -- (-1316.703) (-1344.111) [-1323.346] (-1327.626) * [-1313.707] (-1319.937) (-1323.655) (-1316.309) -- 0:01:30
651000 -- (-1312.378) (-1341.080) (-1331.571) [-1317.822] * [-1312.467] (-1311.622) (-1322.810) (-1321.710) -- 0:01:30
651500 -- (-1323.714) (-1321.236) (-1329.268) [-1309.527] * [-1312.027] (-1314.142) (-1330.904) (-1315.102) -- 0:01:29
652000 -- [-1312.693] (-1314.949) (-1324.181) (-1306.992) * (-1340.317) [-1316.600] (-1322.593) (-1328.088) -- 0:01:29
652500 -- (-1306.470) (-1334.243) (-1326.757) [-1321.433] * [-1314.943] (-1327.791) (-1309.701) (-1333.118) -- 0:01:29
653000 -- (-1325.516) (-1321.748) (-1333.178) [-1328.715] * [-1316.653] (-1318.400) (-1326.996) (-1323.094) -- 0:01:29
653500 -- (-1325.012) (-1323.022) [-1313.027] (-1332.401) * (-1312.056) [-1314.185] (-1339.098) (-1330.731) -- 0:01:29
654000 -- (-1324.396) (-1313.753) [-1308.991] (-1324.929) * [-1309.209] (-1334.944) (-1334.740) (-1318.414) -- 0:01:29
654500 -- [-1318.072] (-1322.864) (-1334.609) (-1329.923) * [-1308.509] (-1307.029) (-1334.394) (-1316.895) -- 0:01:29
655000 -- (-1318.793) (-1309.853) (-1321.885) [-1316.754] * (-1313.276) (-1327.969) [-1318.524] (-1332.464) -- 0:01:29
Average standard deviation of split frequencies: 0.010154
655500 -- (-1316.095) (-1324.204) (-1317.720) [-1310.702] * [-1321.435] (-1316.498) (-1313.318) (-1337.302) -- 0:01:28
656000 -- (-1311.184) (-1323.537) [-1310.121] (-1314.105) * (-1320.042) (-1330.971) [-1314.047] (-1335.733) -- 0:01:28
656500 -- (-1323.248) [-1316.563] (-1320.379) (-1316.227) * [-1306.298] (-1311.350) (-1316.675) (-1330.625) -- 0:01:28
657000 -- (-1308.689) (-1319.186) (-1310.587) [-1328.156] * [-1308.308] (-1329.262) (-1309.037) (-1316.674) -- 0:01:28
657500 -- (-1321.408) [-1306.493] (-1323.375) (-1327.287) * (-1323.732) (-1327.910) [-1321.885] (-1313.514) -- 0:01:28
658000 -- [-1313.333] (-1318.962) (-1312.776) (-1326.255) * [-1320.368] (-1322.287) (-1322.415) (-1332.507) -- 0:01:28
658500 -- (-1317.620) [-1305.069] (-1317.105) (-1324.668) * (-1314.288) (-1324.682) (-1335.810) [-1315.573] -- 0:01:28
659000 -- (-1309.933) (-1312.910) [-1310.209] (-1335.695) * (-1308.395) (-1326.100) (-1321.497) [-1308.585] -- 0:01:27
659500 -- (-1313.956) (-1324.759) (-1304.705) [-1317.762] * [-1323.821] (-1310.387) (-1324.366) (-1308.711) -- 0:01:27
660000 -- [-1313.624] (-1324.067) (-1307.621) (-1324.167) * (-1326.200) (-1321.032) (-1330.834) [-1310.321] -- 0:01:27
Average standard deviation of split frequencies: 0.009989
660500 -- (-1310.032) (-1320.724) [-1313.791] (-1321.055) * [-1315.269] (-1316.655) (-1338.390) (-1314.900) -- 0:01:27
661000 -- (-1320.425) [-1312.144] (-1307.946) (-1314.699) * [-1313.181] (-1329.054) (-1322.849) (-1323.529) -- 0:01:27
661500 -- (-1314.530) [-1317.498] (-1326.542) (-1330.484) * [-1316.228] (-1325.859) (-1329.128) (-1329.649) -- 0:01:27
662000 -- (-1319.911) (-1315.309) (-1321.044) [-1310.780] * (-1306.812) [-1326.942] (-1340.053) (-1318.922) -- 0:01:27
662500 -- (-1310.820) (-1317.890) (-1317.916) [-1312.861] * [-1308.220] (-1325.968) (-1320.361) (-1314.786) -- 0:01:27
663000 -- (-1316.945) [-1308.974] (-1322.620) (-1316.965) * (-1320.928) [-1319.125] (-1316.725) (-1319.205) -- 0:01:26
663500 -- [-1311.994] (-1310.148) (-1326.800) (-1326.668) * (-1320.316) (-1325.236) (-1309.835) [-1313.407] -- 0:01:26
664000 -- (-1318.949) (-1314.524) [-1311.024] (-1318.291) * [-1317.811] (-1323.252) (-1321.363) (-1328.495) -- 0:01:26
664500 -- (-1310.758) (-1325.882) [-1313.619] (-1308.942) * (-1321.915) (-1321.226) (-1339.447) [-1316.566] -- 0:01:26
665000 -- (-1336.176) (-1311.450) (-1320.001) [-1309.744] * (-1332.922) [-1320.692] (-1319.921) (-1310.446) -- 0:01:26
Average standard deviation of split frequencies: 0.009817
665500 -- (-1320.155) [-1312.509] (-1323.702) (-1313.421) * (-1312.484) (-1314.748) (-1326.739) [-1315.642] -- 0:01:26
666000 -- (-1334.782) (-1319.214) (-1320.171) [-1304.137] * [-1307.354] (-1323.112) (-1324.792) (-1332.605) -- 0:01:26
666500 -- (-1315.700) (-1323.547) (-1315.534) [-1321.866] * (-1316.854) (-1327.586) (-1327.622) [-1314.257] -- 0:01:26
667000 -- (-1315.653) [-1317.176] (-1314.262) (-1313.734) * (-1318.842) (-1318.202) [-1305.385] (-1336.592) -- 0:01:25
667500 -- (-1318.196) [-1315.651] (-1316.238) (-1316.975) * (-1311.681) (-1313.129) (-1324.904) [-1315.369] -- 0:01:25
668000 -- (-1304.489) (-1320.878) (-1328.876) [-1318.299] * (-1340.626) (-1315.588) (-1322.152) [-1311.386] -- 0:01:25
668500 -- [-1302.264] (-1312.690) (-1315.270) (-1322.780) * (-1314.698) [-1318.145] (-1326.445) (-1311.180) -- 0:01:25
669000 -- (-1304.968) (-1306.181) [-1313.151] (-1328.138) * (-1317.169) [-1309.849] (-1321.368) (-1309.977) -- 0:01:25
669500 -- (-1325.362) (-1318.625) (-1318.203) [-1309.780] * (-1310.601) [-1310.254] (-1315.078) (-1342.335) -- 0:01:25
670000 -- (-1314.561) [-1319.850] (-1326.536) (-1319.351) * (-1310.071) (-1315.675) [-1321.317] (-1325.994) -- 0:01:25
Average standard deviation of split frequencies: 0.009840
670500 -- (-1315.950) (-1312.500) (-1325.376) [-1311.515] * [-1312.150] (-1328.995) (-1320.700) (-1331.690) -- 0:01:25
671000 -- (-1316.110) (-1327.116) (-1332.327) [-1323.856] * (-1327.316) (-1315.563) [-1309.260] (-1316.095) -- 0:01:24
671500 -- [-1311.120] (-1320.357) (-1327.687) (-1309.795) * (-1331.710) (-1311.220) [-1313.609] (-1325.556) -- 0:01:24
672000 -- (-1312.388) [-1315.469] (-1325.866) (-1313.084) * (-1314.658) (-1330.303) (-1314.255) [-1318.868] -- 0:01:24
672500 -- (-1328.161) [-1323.183] (-1321.733) (-1333.397) * [-1315.221] (-1311.613) (-1307.384) (-1322.125) -- 0:01:24
673000 -- (-1321.530) [-1321.665] (-1319.015) (-1324.618) * (-1320.939) (-1324.182) [-1315.362] (-1309.460) -- 0:01:24
673500 -- (-1314.784) (-1327.668) [-1309.847] (-1319.297) * (-1327.156) [-1308.997] (-1318.477) (-1315.800) -- 0:01:24
674000 -- (-1309.507) (-1332.135) [-1315.580] (-1313.705) * (-1308.366) (-1312.296) [-1318.871] (-1324.512) -- 0:01:24
674500 -- (-1323.309) (-1319.308) (-1305.911) [-1309.809] * (-1307.084) (-1326.421) [-1314.549] (-1306.664) -- 0:01:23
675000 -- [-1314.673] (-1332.277) (-1310.045) (-1332.277) * (-1322.936) (-1317.295) [-1312.658] (-1320.609) -- 0:01:23
Average standard deviation of split frequencies: 0.010127
675500 -- (-1310.900) (-1317.158) (-1304.928) [-1311.805] * (-1314.123) [-1311.635] (-1343.068) (-1322.022) -- 0:01:23
676000 -- (-1318.318) (-1336.035) (-1322.299) [-1306.656] * (-1320.384) (-1316.758) (-1329.870) [-1314.505] -- 0:01:23
676500 -- (-1303.538) (-1337.530) [-1306.446] (-1318.642) * (-1316.059) [-1312.814] (-1344.420) (-1324.354) -- 0:01:23
677000 -- [-1307.761] (-1326.614) (-1311.258) (-1320.573) * [-1309.672] (-1312.671) (-1342.264) (-1318.400) -- 0:01:23
677500 -- [-1309.333] (-1335.743) (-1310.834) (-1351.884) * [-1314.711] (-1322.442) (-1318.384) (-1318.007) -- 0:01:23
678000 -- (-1320.462) [-1311.744] (-1321.921) (-1324.407) * (-1323.649) [-1317.595] (-1324.497) (-1324.215) -- 0:01:23
678500 -- (-1312.706) [-1326.179] (-1326.377) (-1328.160) * [-1315.499] (-1315.328) (-1334.679) (-1316.560) -- 0:01:22
679000 -- [-1314.160] (-1311.421) (-1317.531) (-1325.820) * (-1323.593) (-1307.679) (-1322.680) [-1316.993] -- 0:01:22
679500 -- (-1311.945) (-1318.624) [-1319.775] (-1321.599) * (-1324.410) (-1320.539) (-1315.697) [-1314.496] -- 0:01:22
680000 -- (-1323.838) (-1322.253) (-1314.302) [-1315.990] * (-1332.140) (-1315.444) [-1313.391] (-1319.481) -- 0:01:22
Average standard deviation of split frequencies: 0.010358
680500 -- (-1325.939) (-1335.631) [-1311.409] (-1320.030) * (-1317.375) (-1315.629) [-1315.120] (-1320.144) -- 0:01:22
681000 -- (-1334.500) (-1313.092) (-1313.077) [-1317.129] * (-1316.777) [-1311.375] (-1315.423) (-1321.115) -- 0:01:22
681500 -- (-1327.956) (-1312.419) (-1315.641) [-1314.395] * [-1308.005] (-1319.520) (-1310.137) (-1321.162) -- 0:01:22
682000 -- (-1329.451) (-1321.075) [-1312.987] (-1319.213) * (-1315.990) (-1332.954) (-1328.743) [-1310.100] -- 0:01:22
682500 -- (-1322.320) [-1314.743] (-1322.671) (-1328.126) * (-1320.154) (-1320.379) (-1330.919) [-1309.911] -- 0:01:21
683000 -- (-1323.883) (-1310.050) [-1322.575] (-1322.818) * (-1331.448) (-1312.650) (-1320.238) [-1313.101] -- 0:01:21
683500 -- (-1312.971) (-1326.627) [-1309.951] (-1326.010) * (-1318.174) (-1331.587) [-1315.889] (-1325.028) -- 0:01:21
684000 -- [-1302.955] (-1325.877) (-1321.472) (-1319.712) * (-1315.479) [-1310.177] (-1305.063) (-1312.273) -- 0:01:21
684500 -- (-1316.751) (-1330.962) (-1333.837) [-1315.754] * [-1311.696] (-1321.036) (-1333.597) (-1310.885) -- 0:01:21
685000 -- (-1309.960) (-1320.209) (-1328.392) [-1309.662] * (-1324.092) (-1325.532) [-1315.457] (-1320.174) -- 0:01:21
Average standard deviation of split frequencies: 0.010457
685500 -- (-1310.940) (-1317.724) (-1319.250) [-1313.250] * [-1316.692] (-1318.902) (-1314.439) (-1324.344) -- 0:01:21
686000 -- (-1332.030) (-1317.234) (-1313.123) [-1311.437] * (-1310.188) [-1323.965] (-1326.039) (-1312.885) -- 0:01:21
686500 -- [-1319.321] (-1319.566) (-1319.013) (-1312.355) * (-1316.851) (-1315.279) (-1320.785) [-1317.085] -- 0:01:20
687000 -- (-1331.971) [-1309.051] (-1318.782) (-1315.492) * (-1310.087) (-1319.396) (-1329.281) [-1320.172] -- 0:01:20
687500 -- (-1331.093) [-1315.798] (-1313.670) (-1320.123) * [-1312.063] (-1320.446) (-1309.846) (-1315.546) -- 0:01:20
688000 -- (-1320.046) [-1312.275] (-1328.458) (-1317.776) * (-1314.523) [-1314.143] (-1325.911) (-1312.388) -- 0:01:20
688500 -- (-1325.354) (-1322.731) [-1311.473] (-1314.309) * (-1322.227) (-1320.701) (-1308.369) [-1316.376] -- 0:01:20
689000 -- (-1321.988) (-1306.481) [-1304.570] (-1320.880) * (-1319.588) (-1323.660) (-1309.607) [-1318.735] -- 0:01:20
689500 -- (-1333.693) [-1310.369] (-1317.804) (-1335.846) * [-1315.990] (-1327.397) (-1307.360) (-1326.026) -- 0:01:20
690000 -- [-1314.210] (-1308.967) (-1323.380) (-1321.644) * (-1308.919) [-1307.876] (-1317.155) (-1316.849) -- 0:01:19
Average standard deviation of split frequencies: 0.010090
690500 -- [-1315.578] (-1311.926) (-1319.292) (-1334.287) * [-1311.842] (-1311.322) (-1321.603) (-1308.917) -- 0:01:19
691000 -- (-1325.185) (-1321.248) (-1317.365) [-1317.735] * [-1320.601] (-1325.696) (-1309.052) (-1315.164) -- 0:01:19
691500 -- (-1346.482) (-1311.498) (-1332.932) [-1321.262] * (-1319.664) (-1319.767) (-1313.551) [-1316.495] -- 0:01:19
692000 -- (-1339.966) [-1314.156] (-1335.105) (-1313.214) * (-1315.345) (-1314.198) [-1310.262] (-1310.636) -- 0:01:19
692500 -- (-1315.339) (-1326.792) (-1323.295) [-1314.628] * [-1309.550] (-1311.409) (-1319.581) (-1322.832) -- 0:01:19
693000 -- (-1322.228) (-1315.310) (-1348.471) [-1309.149] * (-1321.487) (-1320.318) [-1309.243] (-1319.624) -- 0:01:19
693500 -- (-1320.187) [-1313.565] (-1343.008) (-1313.799) * (-1328.190) (-1312.383) [-1310.823] (-1322.090) -- 0:01:19
694000 -- (-1338.467) (-1313.155) (-1333.260) [-1309.819] * (-1323.136) (-1313.462) (-1310.275) [-1308.895] -- 0:01:18
694500 -- (-1328.898) (-1322.350) (-1316.614) [-1310.293] * (-1341.457) (-1309.892) (-1315.757) [-1317.839] -- 0:01:18
695000 -- (-1322.059) (-1312.410) (-1330.900) [-1327.493] * (-1318.605) [-1318.136] (-1321.230) (-1307.291) -- 0:01:18
Average standard deviation of split frequencies: 0.010071
695500 -- [-1323.698] (-1326.073) (-1321.118) (-1332.517) * (-1320.950) [-1307.719] (-1337.779) (-1325.750) -- 0:01:18
696000 -- [-1312.910] (-1303.747) (-1336.570) (-1315.912) * [-1311.180] (-1326.127) (-1318.142) (-1327.204) -- 0:01:18
696500 -- [-1319.408] (-1315.788) (-1318.038) (-1320.909) * [-1308.693] (-1319.826) (-1327.058) (-1312.201) -- 0:01:17
697000 -- (-1325.639) (-1308.229) [-1318.167] (-1317.821) * (-1311.322) (-1342.447) [-1318.243] (-1320.977) -- 0:01:18
697500 -- (-1323.054) (-1310.992) (-1318.515) [-1315.363] * (-1305.686) [-1309.929] (-1328.750) (-1311.341) -- 0:01:18
698000 -- (-1314.208) [-1317.843] (-1326.972) (-1318.261) * (-1317.466) [-1311.699] (-1329.134) (-1321.689) -- 0:01:17
698500 -- [-1316.523] (-1318.679) (-1321.542) (-1319.124) * (-1323.124) (-1324.633) (-1323.439) [-1323.773] -- 0:01:17
699000 -- [-1316.972] (-1319.129) (-1318.204) (-1312.477) * [-1314.427] (-1319.740) (-1320.483) (-1333.069) -- 0:01:17
699500 -- (-1320.160) (-1310.198) [-1306.610] (-1326.933) * (-1309.192) (-1324.055) (-1325.982) [-1318.861] -- 0:01:17
700000 -- (-1325.035) (-1315.843) [-1309.899] (-1318.461) * (-1320.995) (-1323.449) [-1316.509] (-1323.165) -- 0:01:17
Average standard deviation of split frequencies: 0.010297
700500 -- (-1319.399) (-1325.030) (-1330.680) [-1306.795] * (-1318.434) (-1322.394) (-1336.752) [-1300.648] -- 0:01:17
701000 -- [-1314.520] (-1319.936) (-1321.574) (-1315.541) * (-1319.687) (-1327.837) (-1324.106) [-1311.943] -- 0:01:17
701500 -- (-1319.154) (-1316.209) (-1324.025) [-1312.759] * (-1318.069) (-1330.721) (-1319.023) [-1308.526] -- 0:01:17
702000 -- (-1330.364) (-1313.165) [-1316.010] (-1314.855) * (-1321.551) (-1327.811) (-1321.990) [-1310.787] -- 0:01:16
702500 -- (-1329.443) (-1316.590) (-1319.355) [-1302.249] * [-1305.958] (-1333.403) (-1327.897) (-1317.502) -- 0:01:16
703000 -- [-1318.023] (-1320.620) (-1324.486) (-1308.393) * [-1305.235] (-1322.603) (-1333.642) (-1310.366) -- 0:01:16
703500 -- [-1320.546] (-1337.216) (-1328.428) (-1309.545) * (-1309.046) [-1321.584] (-1340.706) (-1319.760) -- 0:01:16
704000 -- (-1325.699) [-1315.909] (-1319.890) (-1307.137) * [-1316.699] (-1331.360) (-1320.466) (-1308.910) -- 0:01:16
704500 -- (-1316.487) (-1315.971) (-1324.966) [-1308.463] * (-1308.831) (-1323.445) (-1324.786) [-1313.919] -- 0:01:16
705000 -- (-1311.048) (-1318.616) (-1324.123) [-1314.218] * (-1317.891) (-1316.249) (-1316.367) [-1314.166] -- 0:01:16
Average standard deviation of split frequencies: 0.010045
705500 -- (-1327.034) (-1320.717) [-1324.943] (-1317.161) * (-1320.931) (-1324.213) (-1336.256) [-1306.801] -- 0:01:15
706000 -- (-1326.167) [-1319.075] (-1317.444) (-1306.072) * (-1332.785) (-1326.166) [-1319.636] (-1317.322) -- 0:01:15
706500 -- [-1310.315] (-1312.953) (-1339.553) (-1319.650) * [-1308.313] (-1318.234) (-1335.198) (-1303.674) -- 0:01:15
707000 -- (-1316.482) [-1313.057] (-1318.467) (-1324.038) * (-1323.408) (-1314.579) (-1340.621) [-1314.223] -- 0:01:15
707500 -- (-1310.731) (-1311.188) (-1326.589) [-1326.531] * (-1315.786) (-1312.153) (-1321.665) [-1308.388] -- 0:01:15
708000 -- (-1315.968) (-1314.081) (-1322.457) [-1310.636] * (-1314.883) (-1321.635) (-1331.386) [-1314.738] -- 0:01:15
708500 -- [-1307.141] (-1317.377) (-1327.564) (-1312.747) * (-1316.804) [-1307.101] (-1339.194) (-1313.980) -- 0:01:15
709000 -- (-1308.401) [-1313.049] (-1313.720) (-1318.993) * (-1318.847) [-1314.446] (-1342.474) (-1311.135) -- 0:01:15
709500 -- (-1322.750) (-1316.489) [-1313.245] (-1324.892) * (-1312.295) [-1310.578] (-1337.320) (-1323.051) -- 0:01:14
710000 -- (-1317.996) (-1318.698) (-1323.695) [-1312.644] * (-1325.849) (-1317.000) (-1318.232) [-1309.981] -- 0:01:14
Average standard deviation of split frequencies: 0.009980
710500 -- (-1314.657) (-1331.615) (-1322.211) [-1314.332] * [-1315.473] (-1319.578) (-1322.392) (-1314.335) -- 0:01:14
711000 -- (-1323.261) [-1312.794] (-1321.434) (-1316.088) * (-1321.750) (-1316.150) (-1309.749) [-1338.028] -- 0:01:14
711500 -- [-1321.837] (-1320.928) (-1331.298) (-1320.920) * [-1307.749] (-1308.887) (-1319.179) (-1328.971) -- 0:01:14
712000 -- (-1320.827) (-1324.777) (-1335.673) [-1315.831] * (-1323.136) [-1314.880] (-1316.581) (-1328.491) -- 0:01:14
712500 -- [-1308.605] (-1316.916) (-1321.500) (-1316.648) * (-1322.175) [-1328.377] (-1315.174) (-1323.262) -- 0:01:14
713000 -- (-1318.434) [-1308.134] (-1316.533) (-1324.729) * [-1315.760] (-1318.803) (-1315.051) (-1326.803) -- 0:01:14
713500 -- (-1318.178) [-1318.783] (-1319.642) (-1320.434) * (-1317.686) [-1323.858] (-1318.205) (-1330.807) -- 0:01:13
714000 -- [-1313.422] (-1327.769) (-1322.657) (-1316.327) * [-1308.091] (-1336.534) (-1310.876) (-1319.018) -- 0:01:13
714500 -- (-1315.600) (-1313.529) (-1332.156) [-1313.412] * [-1311.701] (-1342.154) (-1311.577) (-1326.842) -- 0:01:13
715000 -- (-1325.731) [-1312.453] (-1307.117) (-1327.951) * [-1314.703] (-1334.670) (-1320.618) (-1321.564) -- 0:01:13
Average standard deviation of split frequencies: 0.010127
715500 -- (-1321.428) (-1312.030) (-1326.329) [-1318.767] * (-1322.833) (-1322.648) (-1308.607) [-1313.046] -- 0:01:13
716000 -- [-1308.399] (-1319.478) (-1329.029) (-1320.219) * (-1336.737) [-1315.389] (-1308.731) (-1333.948) -- 0:01:13
716500 -- (-1322.206) (-1324.732) [-1312.153] (-1319.717) * (-1322.112) (-1318.858) [-1320.482] (-1311.676) -- 0:01:13
717000 -- (-1312.527) [-1313.186] (-1324.795) (-1330.078) * [-1313.176] (-1331.893) (-1321.026) (-1312.333) -- 0:01:13
717500 -- (-1306.885) [-1320.844] (-1318.945) (-1322.899) * (-1312.418) (-1324.930) [-1317.740] (-1324.123) -- 0:01:12
718000 -- (-1314.303) (-1314.490) (-1344.788) [-1313.782] * [-1314.503] (-1328.103) (-1327.111) (-1318.457) -- 0:01:12
718500 -- (-1316.245) (-1314.454) [-1334.227] (-1317.965) * [-1307.981] (-1327.969) (-1332.583) (-1313.575) -- 0:01:12
719000 -- (-1317.232) (-1315.799) (-1331.106) [-1311.054] * (-1314.507) (-1338.537) [-1318.189] (-1316.033) -- 0:01:12
719500 -- [-1314.492] (-1321.747) (-1321.018) (-1324.963) * (-1315.551) (-1322.621) (-1325.123) [-1306.142] -- 0:01:12
720000 -- (-1315.872) (-1320.482) (-1321.851) [-1316.659] * (-1316.078) (-1317.850) (-1325.819) [-1307.535] -- 0:01:12
Average standard deviation of split frequencies: 0.010186
720500 -- (-1309.893) (-1317.788) [-1310.062] (-1317.960) * (-1317.431) [-1328.790] (-1317.297) (-1338.175) -- 0:01:12
721000 -- (-1320.543) (-1325.563) (-1312.193) [-1318.764] * (-1320.256) [-1314.995] (-1321.082) (-1310.523) -- 0:01:11
721500 -- (-1310.218) [-1319.680] (-1341.845) (-1321.880) * (-1315.302) [-1306.785] (-1318.468) (-1327.700) -- 0:01:11
722000 -- (-1316.430) (-1319.335) [-1316.881] (-1324.849) * (-1316.809) [-1320.876] (-1319.404) (-1322.881) -- 0:01:11
722500 -- [-1332.900] (-1332.216) (-1318.578) (-1322.294) * [-1323.092] (-1316.079) (-1325.503) (-1315.180) -- 0:01:11
723000 -- (-1329.805) (-1327.043) (-1315.527) [-1313.026] * (-1332.382) [-1318.020] (-1305.724) (-1321.286) -- 0:01:11
723500 -- [-1319.885] (-1317.912) (-1335.755) (-1318.339) * (-1319.973) [-1321.921] (-1313.417) (-1322.242) -- 0:01:11
724000 -- (-1321.143) (-1322.312) (-1326.974) [-1304.521] * (-1328.255) [-1311.997] (-1330.522) (-1325.191) -- 0:01:11
724500 -- (-1320.931) [-1316.432] (-1319.502) (-1331.179) * (-1332.454) (-1329.742) [-1309.781] (-1324.898) -- 0:01:11
725000 -- (-1325.250) (-1331.213) [-1324.540] (-1325.696) * (-1326.454) (-1316.356) (-1323.306) [-1305.805] -- 0:01:10
Average standard deviation of split frequencies: 0.009445
725500 -- (-1323.013) (-1328.968) (-1325.110) [-1313.984] * (-1336.750) (-1318.240) (-1311.968) [-1310.141] -- 0:01:10
726000 -- (-1320.425) (-1319.856) [-1318.938] (-1341.633) * (-1327.847) (-1309.335) [-1316.118] (-1313.907) -- 0:01:10
726500 -- (-1325.034) (-1315.768) (-1320.182) [-1317.734] * (-1328.826) [-1315.189] (-1318.650) (-1309.958) -- 0:01:10
727000 -- (-1330.630) (-1324.462) (-1320.324) [-1307.888] * (-1339.733) (-1324.243) (-1325.420) [-1305.275] -- 0:01:10
727500 -- (-1315.804) (-1327.206) (-1310.977) [-1310.902] * (-1327.620) (-1323.981) [-1311.168] (-1311.753) -- 0:01:10
728000 -- (-1330.421) (-1319.184) (-1321.134) [-1323.128] * (-1313.760) [-1311.765] (-1331.499) (-1322.973) -- 0:01:10
728500 -- [-1313.899] (-1332.784) (-1317.427) (-1342.166) * (-1336.194) (-1328.539) [-1308.799] (-1330.011) -- 0:01:10
729000 -- (-1317.942) [-1316.693] (-1338.667) (-1325.863) * (-1315.076) (-1333.361) [-1323.528] (-1322.274) -- 0:01:09
729500 -- (-1336.605) (-1330.601) [-1314.193] (-1319.920) * (-1327.968) [-1312.648] (-1327.480) (-1321.893) -- 0:01:09
730000 -- (-1311.960) (-1332.319) [-1309.600] (-1331.380) * (-1324.747) [-1312.283] (-1321.864) (-1327.121) -- 0:01:09
Average standard deviation of split frequencies: 0.009531
730500 -- (-1313.340) (-1317.991) [-1310.305] (-1333.814) * [-1312.274] (-1321.551) (-1312.440) (-1337.075) -- 0:01:09
731000 -- (-1315.547) [-1319.976] (-1320.336) (-1318.866) * (-1323.480) (-1314.835) [-1322.317] (-1315.097) -- 0:01:09
731500 -- (-1324.461) (-1315.515) (-1321.618) [-1315.891] * (-1322.206) [-1309.684] (-1331.178) (-1322.295) -- 0:01:09
732000 -- (-1318.131) (-1318.339) (-1324.788) [-1309.931] * (-1326.960) (-1303.683) [-1306.588] (-1316.701) -- 0:01:09
732500 -- (-1323.138) (-1331.900) (-1314.890) [-1313.414] * (-1319.380) [-1313.181] (-1309.546) (-1314.588) -- 0:01:09
733000 -- (-1317.466) (-1319.900) (-1317.506) [-1313.056] * (-1335.538) (-1319.379) (-1332.354) [-1306.812] -- 0:01:08
733500 -- (-1328.522) (-1321.717) (-1323.025) [-1324.279] * (-1324.127) (-1318.450) (-1324.933) [-1301.307] -- 0:01:08
734000 -- (-1337.235) [-1311.619] (-1311.214) (-1317.109) * (-1328.679) [-1312.446] (-1341.802) (-1316.012) -- 0:01:08
734500 -- (-1322.271) [-1316.243] (-1319.048) (-1321.464) * (-1322.123) (-1321.018) [-1317.749] (-1308.353) -- 0:01:08
735000 -- (-1329.343) [-1310.259] (-1310.460) (-1317.687) * (-1321.107) (-1336.458) (-1314.878) [-1314.247] -- 0:01:08
Average standard deviation of split frequencies: 0.009869
735500 -- (-1325.256) [-1319.482] (-1323.626) (-1320.215) * (-1325.692) (-1321.173) (-1315.048) [-1318.352] -- 0:01:08
736000 -- (-1323.537) [-1319.158] (-1324.122) (-1319.949) * (-1317.093) (-1323.113) (-1322.814) [-1320.813] -- 0:01:08
736500 -- (-1320.604) [-1314.943] (-1311.074) (-1319.620) * [-1319.349] (-1317.653) (-1337.995) (-1321.612) -- 0:01:07
737000 -- (-1324.014) [-1316.073] (-1308.462) (-1327.610) * (-1317.309) [-1314.943] (-1318.457) (-1322.437) -- 0:01:07
737500 -- (-1320.551) [-1316.681] (-1316.054) (-1327.452) * [-1313.487] (-1317.515) (-1325.887) (-1329.950) -- 0:01:07
738000 -- (-1332.479) (-1318.372) [-1313.905] (-1320.493) * (-1313.193) [-1310.249] (-1331.625) (-1326.128) -- 0:01:07
738500 -- (-1324.111) (-1327.550) (-1309.322) [-1314.514] * (-1317.585) (-1311.397) [-1318.194] (-1333.197) -- 0:01:07
739000 -- [-1314.598] (-1320.990) (-1319.472) (-1327.421) * (-1315.806) [-1311.426] (-1316.789) (-1334.420) -- 0:01:07
739500 -- (-1312.617) (-1324.698) [-1319.724] (-1322.482) * (-1305.722) (-1326.067) (-1329.743) [-1319.462] -- 0:01:07
740000 -- (-1307.097) (-1320.457) [-1307.833] (-1319.066) * [-1319.419] (-1313.973) (-1311.574) (-1324.985) -- 0:01:07
Average standard deviation of split frequencies: 0.010010
740500 -- [-1305.666] (-1309.634) (-1320.250) (-1322.502) * (-1324.503) [-1317.277] (-1337.114) (-1341.263) -- 0:01:06
741000 -- (-1333.871) [-1312.761] (-1325.582) (-1319.864) * [-1320.513] (-1320.887) (-1328.018) (-1327.685) -- 0:01:06
741500 -- (-1329.917) (-1321.770) (-1321.081) [-1307.449] * (-1328.029) [-1311.189] (-1336.103) (-1329.373) -- 0:01:06
742000 -- (-1323.322) (-1312.689) (-1321.811) [-1312.081] * (-1321.589) (-1312.067) [-1328.633] (-1316.949) -- 0:01:06
742500 -- [-1314.070] (-1323.812) (-1324.340) (-1326.234) * (-1317.439) [-1310.908] (-1327.375) (-1319.647) -- 0:01:06
743000 -- (-1318.263) (-1337.840) (-1312.030) [-1316.452] * [-1321.653] (-1332.447) (-1316.748) (-1328.123) -- 0:01:06
743500 -- (-1329.586) (-1321.578) [-1318.662] (-1323.122) * [-1311.006] (-1321.792) (-1311.417) (-1337.582) -- 0:01:06
744000 -- [-1318.571] (-1329.966) (-1338.485) (-1346.851) * (-1316.301) [-1323.123] (-1319.160) (-1312.756) -- 0:01:06
744500 -- (-1311.168) (-1311.773) [-1307.489] (-1308.482) * (-1317.220) [-1319.383] (-1309.681) (-1318.142) -- 0:01:05
745000 -- (-1324.085) (-1314.164) [-1314.626] (-1317.639) * (-1325.170) (-1316.349) [-1310.665] (-1308.270) -- 0:01:05
Average standard deviation of split frequencies: 0.009708
745500 -- (-1327.154) (-1318.833) [-1312.091] (-1317.469) * (-1323.916) (-1307.751) (-1334.323) [-1313.759] -- 0:01:05
746000 -- (-1316.087) (-1315.524) [-1314.027] (-1327.489) * (-1312.131) (-1320.719) [-1304.726] (-1312.740) -- 0:01:05
746500 -- (-1312.970) [-1307.995] (-1310.851) (-1311.487) * (-1321.697) (-1314.493) [-1314.942] (-1320.507) -- 0:01:05
747000 -- [-1325.348] (-1319.332) (-1323.789) (-1312.427) * [-1308.535] (-1314.018) (-1315.722) (-1315.072) -- 0:01:05
747500 -- (-1327.005) (-1316.291) (-1313.224) [-1312.198] * (-1317.326) [-1313.175] (-1337.437) (-1321.569) -- 0:01:05
748000 -- (-1322.574) (-1311.273) [-1328.617] (-1328.461) * (-1320.165) [-1327.019] (-1321.433) (-1312.967) -- 0:01:05
748500 -- (-1317.004) [-1307.484] (-1332.748) (-1317.187) * [-1313.851] (-1316.577) (-1324.624) (-1318.605) -- 0:01:04
749000 -- (-1307.952) (-1309.745) [-1316.408] (-1313.425) * (-1321.175) (-1313.527) [-1322.879] (-1332.933) -- 0:01:04
749500 -- (-1324.528) [-1312.022] (-1304.985) (-1323.529) * (-1327.037) (-1326.375) (-1317.312) [-1323.185] -- 0:01:04
750000 -- [-1311.722] (-1326.384) (-1329.222) (-1309.662) * [-1313.071] (-1318.543) (-1316.279) (-1319.322) -- 0:01:04
Average standard deviation of split frequencies: 0.010436
750500 -- [-1310.442] (-1314.980) (-1323.407) (-1312.659) * (-1318.719) (-1313.016) [-1308.641] (-1324.588) -- 0:01:04
751000 -- (-1312.528) (-1316.188) [-1306.009] (-1330.281) * (-1328.379) (-1321.530) (-1327.486) [-1327.208] -- 0:01:04
751500 -- (-1323.121) (-1316.535) [-1322.658] (-1316.064) * (-1321.803) [-1316.521] (-1305.317) (-1327.667) -- 0:01:04
752000 -- (-1336.464) (-1310.898) [-1313.343] (-1312.868) * (-1326.896) [-1306.681] (-1326.536) (-1316.575) -- 0:01:03
752500 -- (-1326.881) [-1314.798] (-1320.735) (-1320.962) * (-1329.483) [-1312.256] (-1317.651) (-1311.722) -- 0:01:03
753000 -- (-1331.402) (-1319.534) [-1312.122] (-1316.230) * [-1308.218] (-1323.842) (-1320.928) (-1319.805) -- 0:01:03
753500 -- (-1322.454) [-1312.091] (-1322.032) (-1318.590) * (-1324.532) (-1324.840) [-1311.955] (-1324.022) -- 0:01:03
754000 -- (-1328.280) [-1310.883] (-1313.269) (-1336.574) * (-1311.508) (-1330.956) [-1317.758] (-1315.217) -- 0:01:03
754500 -- (-1322.666) (-1318.839) [-1325.118] (-1342.461) * (-1330.191) (-1310.021) (-1323.985) [-1312.002] -- 0:01:03
755000 -- [-1311.306] (-1320.220) (-1327.118) (-1327.563) * (-1323.761) (-1314.544) [-1312.961] (-1310.212) -- 0:01:03
Average standard deviation of split frequencies: 0.010155
755500 -- [-1303.050] (-1317.308) (-1318.021) (-1326.710) * (-1335.492) [-1311.262] (-1332.078) (-1310.178) -- 0:01:03
756000 -- (-1322.590) (-1314.614) [-1308.544] (-1317.722) * (-1338.098) (-1320.526) (-1319.580) [-1304.302] -- 0:01:02
756500 -- (-1313.237) (-1318.900) (-1320.538) [-1328.044] * (-1310.940) (-1325.059) (-1326.166) [-1315.935] -- 0:01:02
757000 -- [-1308.250] (-1325.464) (-1314.927) (-1323.896) * (-1330.088) (-1320.324) [-1313.781] (-1315.809) -- 0:01:02
757500 -- [-1315.888] (-1319.967) (-1311.208) (-1329.801) * [-1316.198] (-1319.638) (-1316.840) (-1338.267) -- 0:01:02
758000 -- (-1314.022) (-1327.553) (-1318.535) [-1311.780] * [-1308.953] (-1325.352) (-1331.530) (-1319.331) -- 0:01:02
758500 -- (-1322.825) (-1315.865) [-1313.241] (-1314.933) * (-1317.556) [-1313.570] (-1327.178) (-1312.920) -- 0:01:02
759000 -- (-1326.862) (-1321.943) (-1313.309) [-1318.014] * (-1321.975) (-1322.382) [-1313.521] (-1321.770) -- 0:01:02
759500 -- (-1318.516) [-1312.905] (-1321.978) (-1310.937) * (-1313.295) (-1319.865) (-1317.279) [-1310.864] -- 0:01:02
760000 -- (-1310.520) (-1314.277) [-1313.227] (-1310.158) * [-1313.405] (-1333.983) (-1319.523) (-1309.068) -- 0:01:01
Average standard deviation of split frequencies: 0.009975
760500 -- (-1320.273) (-1315.005) [-1316.190] (-1319.270) * (-1343.112) (-1323.725) [-1314.887] (-1329.958) -- 0:01:01
761000 -- (-1317.058) (-1311.488) (-1323.887) [-1316.524] * (-1319.643) [-1318.197] (-1315.339) (-1321.514) -- 0:01:01
761500 -- (-1316.629) (-1324.204) (-1322.615) [-1308.485] * (-1321.179) (-1329.029) (-1310.128) [-1314.550] -- 0:01:01
762000 -- [-1315.762] (-1319.152) (-1319.350) (-1333.913) * (-1319.950) (-1324.134) [-1313.698] (-1322.273) -- 0:01:01
762500 -- (-1318.069) [-1314.519] (-1322.872) (-1324.452) * (-1322.869) (-1336.455) (-1307.852) [-1312.088] -- 0:01:01
763000 -- (-1321.290) (-1323.584) [-1310.075] (-1313.770) * [-1316.895] (-1314.732) (-1325.504) (-1319.887) -- 0:01:01
763500 -- (-1324.397) [-1307.227] (-1308.630) (-1309.024) * (-1343.019) (-1325.212) [-1310.197] (-1317.977) -- 0:01:01
764000 -- (-1317.184) (-1320.144) (-1316.328) [-1307.956] * [-1313.191] (-1328.372) (-1330.859) (-1314.222) -- 0:01:00
764500 -- (-1318.609) (-1320.164) (-1317.864) [-1311.904] * (-1311.690) (-1324.137) (-1326.242) [-1310.551] -- 0:01:00
765000 -- [-1315.465] (-1331.701) (-1322.942) (-1319.532) * [-1319.402] (-1313.370) (-1325.474) (-1322.429) -- 0:01:00
Average standard deviation of split frequencies: 0.009876
765500 -- (-1317.467) [-1308.526] (-1317.584) (-1320.438) * (-1333.163) (-1317.285) (-1317.731) [-1312.099] -- 0:01:00
766000 -- (-1325.819) (-1311.857) (-1326.422) [-1313.899] * (-1333.955) (-1307.094) (-1321.957) [-1312.936] -- 0:01:00
766500 -- (-1321.543) (-1319.201) (-1312.141) [-1317.569] * (-1317.599) [-1305.197] (-1315.625) (-1320.768) -- 0:01:00
767000 -- [-1311.719] (-1328.244) (-1320.415) (-1319.161) * (-1322.350) (-1313.895) [-1320.820] (-1306.652) -- 0:01:00
767500 -- (-1312.136) (-1317.037) [-1316.173] (-1321.119) * (-1319.163) (-1311.944) (-1313.393) [-1314.634] -- 0:00:59
768000 -- (-1339.275) (-1315.077) [-1314.468] (-1308.144) * (-1311.141) (-1322.643) (-1317.342) [-1314.692] -- 0:00:59
768500 -- (-1322.585) (-1321.410) (-1309.883) [-1315.940] * (-1321.928) (-1316.588) (-1320.499) [-1315.591] -- 0:00:59
769000 -- [-1313.149] (-1324.852) (-1326.621) (-1310.644) * (-1330.584) [-1313.192] (-1330.894) (-1331.350) -- 0:00:59
769500 -- [-1315.760] (-1322.804) (-1311.231) (-1330.823) * [-1321.104] (-1318.044) (-1319.004) (-1325.049) -- 0:00:59
770000 -- [-1314.105] (-1322.067) (-1318.460) (-1316.061) * (-1325.212) (-1323.209) [-1315.493] (-1338.054) -- 0:00:59
Average standard deviation of split frequencies: 0.009292
770500 -- (-1313.871) (-1330.040) [-1314.514] (-1322.181) * [-1317.039] (-1328.156) (-1319.165) (-1312.203) -- 0:00:59
771000 -- (-1327.790) (-1315.093) [-1316.119] (-1331.469) * (-1327.809) [-1305.940] (-1336.791) (-1317.580) -- 0:00:59
771500 -- (-1321.185) [-1314.959] (-1314.533) (-1324.320) * (-1321.648) (-1307.534) [-1309.793] (-1337.459) -- 0:00:58
772000 -- (-1324.143) (-1324.717) (-1326.256) [-1317.255] * (-1328.075) (-1335.986) (-1324.839) [-1318.419] -- 0:00:58
772500 -- (-1332.356) (-1321.598) (-1319.354) [-1315.216] * (-1326.293) (-1316.427) (-1323.943) [-1324.720] -- 0:00:58
773000 -- (-1325.900) [-1309.773] (-1327.410) (-1316.311) * (-1315.223) [-1314.366] (-1316.247) (-1325.171) -- 0:00:58
773500 -- (-1315.236) [-1312.748] (-1329.606) (-1325.191) * [-1311.217] (-1314.975) (-1322.613) (-1322.680) -- 0:00:58
774000 -- (-1333.302) [-1306.138] (-1329.406) (-1326.777) * (-1325.893) (-1318.832) (-1328.769) [-1315.563] -- 0:00:58
774500 -- (-1335.828) (-1310.826) [-1323.023] (-1312.651) * (-1325.495) [-1309.709] (-1314.497) (-1320.050) -- 0:00:58
775000 -- [-1302.087] (-1328.143) (-1325.551) (-1318.930) * [-1314.655] (-1343.635) (-1320.569) (-1329.779) -- 0:00:58
Average standard deviation of split frequencies: 0.009546
775500 -- [-1309.086] (-1322.057) (-1329.067) (-1343.110) * (-1321.687) (-1311.034) [-1306.343] (-1319.571) -- 0:00:57
776000 -- [-1315.869] (-1321.162) (-1326.767) (-1321.399) * (-1309.695) (-1311.075) (-1319.285) [-1314.625] -- 0:00:57
776500 -- [-1321.300] (-1319.212) (-1317.610) (-1329.691) * [-1309.733] (-1319.335) (-1322.244) (-1309.556) -- 0:00:57
777000 -- (-1328.447) [-1316.749] (-1319.901) (-1329.472) * (-1327.949) [-1310.729] (-1323.740) (-1314.881) -- 0:00:57
777500 -- (-1327.055) [-1311.099] (-1318.912) (-1332.037) * (-1314.549) (-1320.533) [-1316.798] (-1302.772) -- 0:00:57
778000 -- (-1324.733) (-1328.207) [-1311.510] (-1310.554) * (-1322.559) (-1316.828) [-1309.459] (-1314.780) -- 0:00:57
778500 -- (-1330.911) (-1317.469) (-1323.681) [-1308.187] * (-1318.326) (-1316.138) (-1332.017) [-1318.510] -- 0:00:57
779000 -- (-1326.965) (-1320.805) (-1322.797) [-1312.284] * (-1305.764) (-1318.940) [-1319.630] (-1309.767) -- 0:00:57
779500 -- (-1313.971) (-1314.967) [-1315.587] (-1315.720) * (-1325.642) (-1321.690) [-1327.133] (-1328.969) -- 0:00:56
780000 -- (-1311.917) [-1316.431] (-1309.592) (-1324.569) * (-1317.572) [-1313.052] (-1328.677) (-1321.493) -- 0:00:56
Average standard deviation of split frequencies: 0.009777
780500 -- (-1320.376) (-1324.276) [-1314.363] (-1332.465) * [-1314.944] (-1312.110) (-1322.382) (-1306.895) -- 0:00:56
781000 -- (-1314.748) (-1326.640) [-1311.868] (-1339.469) * (-1311.590) (-1312.245) (-1318.273) [-1310.341] -- 0:00:56
781500 -- (-1322.944) (-1332.739) (-1319.134) [-1321.890] * (-1319.345) [-1312.506] (-1360.455) (-1317.122) -- 0:00:56
782000 -- [-1317.661] (-1330.915) (-1329.043) (-1314.498) * (-1316.704) (-1306.532) (-1319.297) [-1309.650] -- 0:00:56
782500 -- (-1320.871) [-1333.184] (-1308.575) (-1330.145) * (-1315.261) (-1315.937) [-1312.954] (-1322.001) -- 0:00:56
783000 -- [-1309.385] (-1334.462) (-1319.573) (-1328.690) * (-1315.858) (-1312.483) [-1307.265] (-1330.912) -- 0:00:55
783500 -- (-1306.588) (-1326.820) (-1324.382) [-1321.888] * (-1307.843) (-1314.263) [-1308.401] (-1317.015) -- 0:00:55
784000 -- (-1317.579) (-1329.981) [-1313.022] (-1320.237) * (-1340.707) (-1317.148) (-1316.718) [-1311.109] -- 0:00:55
784500 -- (-1346.434) (-1321.745) (-1327.825) [-1315.210] * (-1328.791) (-1329.859) [-1329.284] (-1302.740) -- 0:00:55
785000 -- (-1341.354) [-1317.337] (-1305.950) (-1315.602) * [-1315.188] (-1329.026) (-1315.955) (-1307.593) -- 0:00:55
Average standard deviation of split frequencies: 0.009487
785500 -- [-1316.327] (-1320.102) (-1325.983) (-1325.498) * (-1324.697) (-1320.790) [-1319.932] (-1317.567) -- 0:00:55
786000 -- (-1332.953) (-1313.254) [-1310.310] (-1316.801) * (-1322.007) (-1329.154) [-1311.838] (-1312.276) -- 0:00:54
786500 -- (-1333.456) [-1311.018] (-1329.428) (-1334.305) * (-1328.112) (-1320.632) (-1299.128) [-1314.751] -- 0:00:55
787000 -- (-1323.160) (-1308.011) (-1317.783) [-1314.667] * (-1315.990) (-1320.816) (-1314.971) [-1323.567] -- 0:00:54
787500 -- (-1318.968) [-1305.936] (-1320.666) (-1319.350) * (-1316.342) (-1317.116) [-1313.904] (-1314.945) -- 0:00:54
788000 -- (-1317.333) [-1309.799] (-1321.669) (-1322.534) * (-1315.771) (-1322.345) (-1319.095) [-1321.420] -- 0:00:54
788500 -- (-1327.652) (-1322.731) (-1315.901) [-1310.796] * (-1326.619) [-1305.451] (-1327.214) (-1307.563) -- 0:00:54
789000 -- (-1328.195) (-1328.918) [-1314.456] (-1322.281) * (-1316.737) (-1311.290) (-1316.533) [-1308.943] -- 0:00:54
789500 -- (-1325.835) [-1315.499] (-1329.889) (-1320.049) * (-1316.724) (-1316.901) (-1336.601) [-1313.785] -- 0:00:54
790000 -- (-1334.549) [-1317.209] (-1323.741) (-1335.882) * (-1336.830) (-1309.200) (-1320.435) [-1314.775] -- 0:00:53
Average standard deviation of split frequencies: 0.009729
790500 -- (-1338.897) (-1314.106) [-1308.340] (-1321.307) * (-1315.347) [-1312.357] (-1318.769) (-1313.051) -- 0:00:54
791000 -- (-1319.576) (-1314.537) (-1340.287) [-1320.029] * (-1319.320) (-1324.685) (-1330.598) [-1321.427] -- 0:00:53
791500 -- (-1308.736) (-1325.093) (-1321.119) [-1316.092] * (-1324.006) [-1306.408] (-1322.167) (-1330.044) -- 0:00:53
792000 -- (-1322.267) (-1310.894) [-1312.060] (-1316.326) * [-1326.776] (-1313.037) (-1328.905) (-1327.038) -- 0:00:53
792500 -- (-1323.976) [-1309.051] (-1317.412) (-1319.350) * (-1322.320) [-1319.823] (-1328.912) (-1315.530) -- 0:00:53
793000 -- (-1324.877) (-1317.829) (-1306.695) [-1316.281] * (-1327.291) [-1311.626] (-1313.294) (-1317.732) -- 0:00:53
793500 -- (-1334.435) (-1318.501) (-1314.374) [-1316.674] * (-1317.047) (-1321.581) [-1317.042] (-1324.039) -- 0:00:53
794000 -- [-1321.738] (-1316.475) (-1310.232) (-1337.569) * [-1314.627] (-1337.279) (-1319.308) (-1319.750) -- 0:00:52
794500 -- (-1318.987) (-1310.328) [-1309.118] (-1318.066) * [-1309.755] (-1312.882) (-1333.471) (-1320.886) -- 0:00:53
795000 -- (-1338.801) (-1326.601) [-1313.516] (-1306.368) * (-1314.496) [-1309.350] (-1318.013) (-1312.603) -- 0:00:52
Average standard deviation of split frequencies: 0.009368
795500 -- (-1328.229) (-1322.570) (-1311.930) [-1312.873] * [-1310.391] (-1319.915) (-1314.791) (-1322.933) -- 0:00:52
796000 -- [-1309.390] (-1326.289) (-1326.592) (-1310.654) * (-1314.664) [-1315.164] (-1325.754) (-1327.596) -- 0:00:52
796500 -- (-1323.976) (-1315.509) (-1317.763) [-1309.440] * (-1318.329) (-1319.000) (-1315.643) [-1310.194] -- 0:00:52
797000 -- (-1315.159) (-1313.728) (-1329.173) [-1313.270] * (-1316.961) (-1336.592) [-1311.532] (-1325.778) -- 0:00:52
797500 -- [-1311.064] (-1328.325) (-1324.481) (-1316.098) * (-1315.105) (-1322.924) [-1308.276] (-1319.298) -- 0:00:52
798000 -- [-1324.360] (-1315.673) (-1322.033) (-1315.225) * (-1319.703) (-1319.890) (-1315.837) [-1314.510] -- 0:00:52
798500 -- (-1317.636) (-1317.225) (-1337.472) [-1311.514] * (-1325.433) (-1327.860) [-1308.541] (-1334.571) -- 0:00:51
799000 -- (-1329.753) [-1316.352] (-1312.403) (-1318.409) * (-1321.122) (-1319.507) [-1310.688] (-1320.131) -- 0:00:51
799500 -- (-1325.296) (-1319.931) [-1318.314] (-1316.366) * (-1329.864) [-1309.610] (-1334.740) (-1318.120) -- 0:00:51
800000 -- [-1312.653] (-1327.300) (-1325.443) (-1328.599) * (-1326.980) (-1315.313) (-1320.260) [-1308.325] -- 0:00:51
Average standard deviation of split frequencies: 0.009019
800500 -- (-1340.652) [-1322.436] (-1319.025) (-1319.267) * (-1317.826) (-1323.825) [-1322.323] (-1335.772) -- 0:00:51
801000 -- (-1323.171) (-1326.490) [-1310.760] (-1317.423) * (-1329.582) (-1326.044) (-1328.692) [-1301.026] -- 0:00:51
801500 -- (-1322.498) [-1316.231] (-1312.611) (-1330.536) * (-1309.456) [-1312.806] (-1319.478) (-1306.424) -- 0:00:51
802000 -- [-1308.132] (-1317.725) (-1309.471) (-1311.038) * (-1315.553) [-1310.005] (-1324.165) (-1319.601) -- 0:00:51
802500 -- [-1310.221] (-1321.243) (-1326.571) (-1334.944) * [-1309.962] (-1314.422) (-1319.384) (-1305.427) -- 0:00:50
803000 -- (-1322.232) (-1317.040) [-1312.834] (-1333.406) * [-1308.325] (-1317.356) (-1319.420) (-1318.997) -- 0:00:50
803500 -- (-1320.018) [-1317.373] (-1311.686) (-1330.054) * (-1331.751) (-1323.113) (-1330.165) [-1309.042] -- 0:00:50
804000 -- (-1317.615) (-1320.524) [-1309.780] (-1324.864) * (-1323.086) (-1326.963) [-1311.453] (-1317.912) -- 0:00:50
804500 -- [-1309.064] (-1320.313) (-1332.838) (-1315.135) * (-1321.934) (-1332.043) (-1309.801) [-1311.327] -- 0:00:50
805000 -- (-1331.304) [-1319.361] (-1323.905) (-1322.634) * [-1310.658] (-1318.162) (-1323.919) (-1316.447) -- 0:00:50
Average standard deviation of split frequencies: 0.008640
805500 -- (-1319.303) [-1314.510] (-1318.861) (-1322.168) * [-1314.217] (-1318.407) (-1332.443) (-1335.180) -- 0:00:49
806000 -- (-1330.443) (-1325.626) (-1320.548) [-1311.045] * (-1308.097) [-1315.126] (-1316.140) (-1307.319) -- 0:00:50
806500 -- [-1319.497] (-1314.527) (-1325.049) (-1320.814) * (-1323.915) [-1309.458] (-1320.048) (-1317.296) -- 0:00:49
807000 -- (-1332.253) (-1327.558) (-1307.686) [-1336.198] * (-1319.948) (-1335.468) (-1317.613) [-1308.504] -- 0:00:49
807500 -- [-1314.153] (-1323.559) (-1329.644) (-1316.094) * (-1314.951) (-1338.090) (-1318.538) [-1318.374] -- 0:00:49
808000 -- (-1321.194) (-1337.800) [-1311.904] (-1320.541) * (-1322.055) (-1340.197) (-1316.408) [-1309.977] -- 0:00:49
808500 -- (-1311.301) (-1340.340) (-1314.165) [-1306.681] * [-1320.200] (-1310.570) (-1316.473) (-1313.568) -- 0:00:49
809000 -- [-1318.954] (-1343.235) (-1321.657) (-1319.837) * (-1315.908) (-1315.319) (-1339.257) [-1306.767] -- 0:00:49
809500 -- [-1319.105] (-1318.194) (-1320.909) (-1332.415) * (-1334.879) [-1311.333] (-1316.411) (-1318.862) -- 0:00:48
810000 -- (-1318.462) (-1336.591) (-1318.393) [-1311.473] * [-1311.253] (-1322.304) (-1312.171) (-1318.208) -- 0:00:49
Average standard deviation of split frequencies: 0.009636
810500 -- (-1331.587) (-1313.452) [-1315.501] (-1325.029) * (-1316.006) (-1314.316) (-1322.854) [-1313.205] -- 0:00:48
811000 -- [-1320.811] (-1313.602) (-1335.407) (-1316.615) * [-1308.363] (-1316.490) (-1314.347) (-1312.252) -- 0:00:48
811500 -- (-1320.488) [-1304.095] (-1314.107) (-1334.662) * (-1325.634) (-1311.139) (-1314.401) [-1310.855] -- 0:00:48
812000 -- [-1323.643] (-1322.782) (-1323.503) (-1322.955) * (-1321.774) [-1312.262] (-1312.323) (-1323.546) -- 0:00:48
812500 -- (-1320.253) (-1311.201) [-1310.325] (-1332.687) * [-1311.752] (-1338.108) (-1320.222) (-1314.093) -- 0:00:48
813000 -- (-1330.075) [-1313.431] (-1312.360) (-1311.905) * (-1325.520) (-1326.068) (-1310.142) [-1300.638] -- 0:00:48
813500 -- (-1320.054) [-1318.679] (-1311.614) (-1310.225) * (-1317.252) (-1325.226) (-1313.520) [-1312.029] -- 0:00:47
814000 -- (-1333.430) [-1319.072] (-1317.266) (-1311.031) * (-1343.425) [-1315.265] (-1319.040) (-1315.609) -- 0:00:47
814500 -- (-1326.165) [-1311.644] (-1324.670) (-1312.999) * (-1325.324) (-1312.665) (-1316.104) [-1314.685] -- 0:00:47
815000 -- (-1313.183) [-1318.981] (-1319.447) (-1319.140) * (-1313.848) [-1308.735] (-1319.192) (-1320.184) -- 0:00:47
Average standard deviation of split frequencies: 0.009138
815500 -- [-1316.365] (-1320.986) (-1311.235) (-1320.019) * (-1329.231) (-1311.841) [-1318.002] (-1308.213) -- 0:00:47
816000 -- (-1323.250) (-1313.498) [-1316.792] (-1318.393) * (-1335.596) [-1314.331] (-1316.224) (-1318.075) -- 0:00:47
816500 -- (-1323.678) [-1314.436] (-1316.233) (-1330.609) * (-1321.366) [-1313.736] (-1315.182) (-1323.030) -- 0:00:47
817000 -- (-1334.411) [-1314.920] (-1320.558) (-1320.372) * (-1321.611) (-1321.120) [-1319.114] (-1316.290) -- 0:00:47
817500 -- (-1312.118) (-1324.298) (-1317.790) [-1311.899] * (-1319.469) (-1315.476) [-1317.994] (-1322.461) -- 0:00:46
818000 -- (-1313.491) [-1313.604] (-1323.391) (-1320.469) * (-1309.296) [-1318.829] (-1325.262) (-1322.533) -- 0:00:46
818500 -- [-1308.223] (-1326.633) (-1315.848) (-1320.117) * [-1316.693] (-1317.274) (-1318.460) (-1315.294) -- 0:00:46
819000 -- (-1335.411) [-1309.370] (-1320.106) (-1336.747) * [-1319.126] (-1318.763) (-1316.804) (-1334.945) -- 0:00:46
819500 -- (-1321.101) (-1311.093) [-1313.040] (-1336.027) * (-1318.545) (-1317.757) (-1319.853) [-1312.863] -- 0:00:46
820000 -- [-1318.806] (-1307.980) (-1321.355) (-1334.243) * [-1317.837] (-1325.619) (-1318.498) (-1320.962) -- 0:00:46
Average standard deviation of split frequencies: 0.009191
820500 -- (-1311.513) (-1319.024) [-1316.214] (-1329.297) * (-1312.503) [-1309.781] (-1310.641) (-1324.022) -- 0:00:46
821000 -- (-1318.890) (-1309.260) (-1319.552) [-1320.495] * (-1323.185) (-1314.860) [-1311.382] (-1335.450) -- 0:00:46
821500 -- (-1319.162) (-1318.168) [-1324.987] (-1307.455) * (-1330.353) (-1319.051) (-1314.294) [-1321.605] -- 0:00:45
822000 -- (-1313.287) [-1317.543] (-1317.641) (-1318.225) * (-1315.347) (-1329.491) [-1319.258] (-1348.080) -- 0:00:45
822500 -- (-1322.609) (-1324.863) (-1323.817) [-1311.647] * (-1314.780) [-1318.656] (-1313.311) (-1324.763) -- 0:00:45
823000 -- (-1333.342) [-1315.607] (-1324.234) (-1312.298) * (-1316.012) (-1334.357) (-1329.805) [-1310.995] -- 0:00:45
823500 -- (-1333.263) [-1310.114] (-1321.434) (-1320.072) * (-1323.566) [-1324.969] (-1315.534) (-1320.205) -- 0:00:45
824000 -- (-1326.899) (-1321.506) (-1312.929) [-1312.722] * (-1322.137) (-1322.811) (-1311.614) [-1314.405] -- 0:00:45
824500 -- (-1311.185) (-1320.568) [-1304.244] (-1328.028) * (-1320.304) (-1335.115) [-1316.291] (-1330.655) -- 0:00:45
825000 -- (-1315.618) [-1304.863] (-1309.656) (-1322.100) * (-1323.736) [-1311.770] (-1318.735) (-1316.405) -- 0:00:45
Average standard deviation of split frequencies: 0.008958
825500 -- (-1320.646) (-1306.120) (-1331.597) [-1305.568] * (-1326.875) (-1311.582) (-1323.590) [-1306.975] -- 0:00:45
826000 -- (-1316.577) (-1311.073) [-1311.679] (-1330.193) * (-1321.836) (-1321.191) (-1320.490) [-1309.768] -- 0:00:44
826500 -- (-1319.480) [-1315.142] (-1334.171) (-1314.903) * [-1316.004] (-1324.997) (-1320.169) (-1317.302) -- 0:00:44
827000 -- (-1327.659) [-1320.428] (-1343.442) (-1317.293) * (-1333.323) (-1319.113) [-1321.595] (-1318.262) -- 0:00:44
827500 -- (-1327.854) (-1322.935) [-1310.510] (-1319.293) * (-1324.480) (-1320.200) [-1316.610] (-1337.793) -- 0:00:44
828000 -- (-1328.291) (-1318.500) (-1317.109) [-1318.143] * (-1333.974) [-1312.668] (-1310.450) (-1323.706) -- 0:00:44
828500 -- [-1309.710] (-1318.284) (-1308.329) (-1318.178) * (-1321.007) (-1308.487) [-1308.845] (-1312.522) -- 0:00:44
829000 -- (-1332.942) (-1322.822) [-1312.840] (-1322.140) * (-1325.784) (-1314.659) [-1316.913] (-1325.812) -- 0:00:44
829500 -- (-1316.737) (-1321.753) [-1309.795] (-1318.344) * (-1322.954) (-1325.947) [-1315.636] (-1309.861) -- 0:00:43
830000 -- (-1318.822) [-1322.608] (-1309.443) (-1320.428) * [-1318.621] (-1312.748) (-1316.557) (-1322.927) -- 0:00:43
Average standard deviation of split frequencies: 0.009286
830500 -- (-1316.611) [-1316.197] (-1314.952) (-1331.620) * [-1313.304] (-1309.273) (-1314.872) (-1332.324) -- 0:00:43
831000 -- [-1310.616] (-1320.924) (-1312.269) (-1321.148) * (-1311.832) (-1310.064) [-1309.873] (-1319.915) -- 0:00:43
831500 -- [-1308.960] (-1314.964) (-1322.600) (-1321.602) * [-1318.649] (-1330.883) (-1312.524) (-1325.328) -- 0:00:43
832000 -- (-1315.470) (-1319.830) [-1318.513] (-1323.103) * [-1314.098] (-1324.890) (-1319.719) (-1336.299) -- 0:00:43
832500 -- (-1320.607) [-1316.004] (-1315.795) (-1312.529) * (-1315.065) (-1315.375) [-1311.966] (-1317.687) -- 0:00:43
833000 -- (-1319.341) [-1320.758] (-1305.920) (-1317.407) * [-1324.324] (-1313.975) (-1318.214) (-1308.119) -- 0:00:43
833500 -- (-1339.485) [-1305.906] (-1313.413) (-1345.659) * (-1312.526) [-1304.546] (-1331.600) (-1317.472) -- 0:00:42
834000 -- (-1326.852) [-1313.344] (-1317.128) (-1339.163) * (-1326.775) [-1314.216] (-1322.260) (-1311.970) -- 0:00:42
834500 -- (-1312.577) [-1317.746] (-1303.897) (-1326.967) * (-1318.286) [-1312.935] (-1324.428) (-1321.713) -- 0:00:42
835000 -- (-1314.616) (-1319.057) (-1314.648) [-1321.865] * [-1304.696] (-1312.010) (-1325.747) (-1323.272) -- 0:00:42
Average standard deviation of split frequencies: 0.009278
835500 -- (-1320.561) (-1311.815) [-1320.417] (-1325.519) * (-1319.031) [-1313.894] (-1317.992) (-1317.625) -- 0:00:42
836000 -- (-1326.046) [-1314.230] (-1322.341) (-1324.941) * (-1318.134) [-1311.812] (-1329.522) (-1325.761) -- 0:00:42
836500 -- (-1329.575) (-1309.040) (-1325.471) [-1320.512] * (-1318.487) (-1321.187) (-1327.710) [-1310.654] -- 0:00:42
837000 -- (-1330.492) (-1314.037) [-1308.024] (-1332.168) * (-1310.429) (-1321.460) (-1326.958) [-1323.641] -- 0:00:42
837500 -- (-1313.615) (-1315.320) [-1310.839] (-1325.129) * (-1323.654) (-1320.259) [-1313.188] (-1316.619) -- 0:00:41
838000 -- (-1317.343) (-1306.268) [-1309.059] (-1322.449) * (-1329.427) [-1318.893] (-1326.089) (-1310.797) -- 0:00:41
838500 -- (-1316.162) (-1316.208) [-1305.733] (-1319.888) * (-1327.300) (-1315.748) [-1313.317] (-1317.973) -- 0:00:41
839000 -- (-1325.009) (-1320.687) (-1323.409) [-1310.344] * (-1345.796) (-1318.753) (-1321.134) [-1313.573] -- 0:00:41
839500 -- [-1325.938] (-1316.406) (-1313.632) (-1321.703) * (-1317.659) [-1317.895] (-1313.943) (-1317.017) -- 0:00:41
840000 -- (-1340.257) (-1309.969) [-1304.752] (-1314.849) * (-1325.142) (-1324.899) [-1320.378] (-1317.846) -- 0:00:41
Average standard deviation of split frequencies: 0.009613
840500 -- [-1312.518] (-1322.119) (-1306.891) (-1319.613) * [-1323.318] (-1340.411) (-1315.520) (-1329.525) -- 0:00:41
841000 -- (-1320.339) (-1312.320) [-1317.202] (-1316.304) * (-1318.266) (-1333.098) (-1321.600) [-1313.226] -- 0:00:41
841500 -- (-1323.777) [-1316.969] (-1316.141) (-1344.529) * (-1330.913) [-1307.532] (-1328.608) (-1315.960) -- 0:00:40
842000 -- (-1344.657) (-1319.126) [-1317.870] (-1329.407) * (-1347.840) (-1319.477) (-1316.253) [-1321.682] -- 0:00:40
842500 -- (-1310.792) (-1321.399) (-1321.614) [-1317.805] * [-1304.805] (-1312.216) (-1328.949) (-1312.918) -- 0:00:40
843000 -- (-1317.964) (-1318.169) (-1321.131) [-1315.107] * (-1316.008) (-1335.017) [-1320.516] (-1314.678) -- 0:00:40
843500 -- [-1317.731] (-1320.166) (-1325.008) (-1312.688) * (-1324.061) (-1324.074) [-1313.387] (-1320.293) -- 0:00:40
844000 -- (-1322.102) (-1324.823) (-1332.259) [-1314.529] * (-1328.474) (-1318.013) (-1313.214) [-1316.487] -- 0:00:40
844500 -- (-1316.376) [-1319.926] (-1325.325) (-1315.259) * [-1310.862] (-1320.185) (-1318.916) (-1315.960) -- 0:00:40
845000 -- (-1317.561) (-1325.483) (-1334.794) [-1310.586] * [-1315.076] (-1326.518) (-1309.844) (-1317.668) -- 0:00:39
Average standard deviation of split frequencies: 0.008867
845500 -- (-1320.971) (-1325.530) (-1338.872) [-1307.267] * [-1314.022] (-1327.382) (-1321.287) (-1313.685) -- 0:00:39
846000 -- [-1308.238] (-1324.971) (-1330.494) (-1315.021) * [-1320.043] (-1325.026) (-1328.771) (-1321.260) -- 0:00:39
846500 -- [-1317.789] (-1329.593) (-1325.266) (-1317.128) * (-1312.942) [-1317.700] (-1331.433) (-1329.907) -- 0:00:39
847000 -- (-1309.496) (-1318.808) (-1324.111) [-1312.186] * (-1318.449) (-1308.840) (-1340.469) [-1325.833] -- 0:00:39
847500 -- (-1312.633) [-1321.375] (-1323.329) (-1312.582) * (-1329.776) [-1314.884] (-1333.884) (-1329.533) -- 0:00:39
848000 -- (-1333.945) (-1320.855) [-1309.001] (-1311.151) * (-1315.856) [-1309.486] (-1326.030) (-1325.705) -- 0:00:39
848500 -- (-1331.143) [-1316.751] (-1321.573) (-1311.583) * (-1321.753) [-1314.629] (-1333.782) (-1320.934) -- 0:00:39
849000 -- (-1322.409) (-1312.085) [-1315.118] (-1319.662) * (-1321.467) [-1324.761] (-1330.542) (-1320.106) -- 0:00:38
849500 -- (-1320.010) [-1317.606] (-1319.144) (-1323.009) * [-1318.258] (-1324.496) (-1332.636) (-1317.208) -- 0:00:38
850000 -- (-1319.459) (-1326.955) [-1313.623] (-1317.481) * (-1327.717) (-1313.892) (-1318.854) [-1316.509] -- 0:00:38
Average standard deviation of split frequencies: 0.009685
850500 -- [-1315.849] (-1312.766) (-1316.749) (-1316.562) * (-1329.062) [-1313.763] (-1339.684) (-1309.132) -- 0:00:38
851000 -- (-1349.133) (-1316.767) [-1315.000] (-1332.098) * (-1330.597) [-1316.122] (-1324.541) (-1315.841) -- 0:00:38
851500 -- (-1320.713) (-1314.447) [-1318.199] (-1312.342) * (-1314.546) [-1321.626] (-1324.764) (-1315.100) -- 0:00:38
852000 -- (-1335.355) (-1323.346) [-1315.539] (-1317.171) * (-1322.202) (-1328.183) [-1315.073] (-1318.885) -- 0:00:38
852500 -- (-1329.855) (-1317.186) [-1321.656] (-1314.331) * [-1321.124] (-1320.317) (-1313.853) (-1315.308) -- 0:00:38
853000 -- [-1313.881] (-1325.229) (-1331.462) (-1320.937) * (-1323.878) (-1320.724) (-1330.397) [-1310.416] -- 0:00:37
853500 -- (-1316.117) (-1306.437) (-1322.314) [-1310.551] * (-1325.563) (-1323.990) (-1327.557) [-1309.058] -- 0:00:37
854000 -- [-1316.184] (-1322.653) (-1321.424) (-1316.798) * (-1325.788) (-1326.897) (-1311.897) [-1304.766] -- 0:00:37
854500 -- (-1321.310) (-1324.498) (-1309.849) [-1313.159] * (-1319.311) (-1331.032) (-1316.261) [-1313.140] -- 0:00:37
855000 -- (-1308.919) (-1324.425) [-1313.906] (-1332.325) * (-1335.162) (-1323.742) (-1317.619) [-1317.178] -- 0:00:37
Average standard deviation of split frequencies: 0.009187
855500 -- [-1303.586] (-1313.719) (-1331.262) (-1326.661) * (-1337.874) (-1317.403) [-1310.569] (-1339.131) -- 0:00:37
856000 -- (-1314.296) [-1311.926] (-1315.453) (-1313.377) * (-1312.757) [-1315.748] (-1323.854) (-1308.160) -- 0:00:37
856500 -- (-1314.537) [-1309.253] (-1326.978) (-1315.889) * (-1327.040) (-1330.125) [-1326.651] (-1320.987) -- 0:00:37
857000 -- (-1309.808) (-1314.721) (-1316.218) [-1310.870] * (-1329.546) (-1324.542) (-1315.087) [-1320.158] -- 0:00:36
857500 -- (-1312.039) (-1319.647) [-1308.475] (-1318.103) * (-1317.956) [-1306.631] (-1333.929) (-1306.655) -- 0:00:36
858000 -- (-1310.465) [-1310.620] (-1312.100) (-1321.487) * (-1321.885) [-1314.478] (-1325.147) (-1315.724) -- 0:00:36
858500 -- (-1318.149) (-1307.876) [-1305.528] (-1315.259) * (-1316.812) [-1310.574] (-1327.089) (-1314.029) -- 0:00:36
859000 -- (-1312.213) (-1314.344) [-1315.664] (-1316.646) * (-1335.011) [-1312.298] (-1314.999) (-1314.819) -- 0:00:36
859500 -- (-1322.424) (-1324.705) [-1304.865] (-1310.858) * (-1330.048) [-1323.532] (-1309.835) (-1311.175) -- 0:00:36
860000 -- (-1320.117) (-1317.517) (-1320.227) [-1321.757] * (-1322.297) (-1322.873) [-1308.171] (-1308.298) -- 0:00:36
Average standard deviation of split frequencies: 0.009363
860500 -- (-1310.808) (-1324.470) (-1317.442) [-1309.173] * (-1331.023) (-1317.052) (-1330.422) [-1310.403] -- 0:00:35
861000 -- (-1315.470) (-1336.258) [-1308.794] (-1323.770) * (-1318.453) (-1318.237) (-1319.139) [-1301.750] -- 0:00:35
861500 -- (-1321.598) [-1322.138] (-1318.549) (-1325.173) * (-1328.352) [-1310.133] (-1320.076) (-1316.618) -- 0:00:35
862000 -- (-1323.644) [-1315.705] (-1314.854) (-1323.415) * (-1329.835) [-1315.312] (-1339.224) (-1316.753) -- 0:00:35
862500 -- (-1323.915) [-1312.345] (-1321.424) (-1324.476) * (-1312.554) [-1312.630] (-1315.146) (-1313.746) -- 0:00:35
863000 -- (-1314.090) (-1310.344) (-1332.115) [-1314.299] * (-1320.780) [-1309.641] (-1320.399) (-1314.376) -- 0:00:35
863500 -- [-1310.346] (-1321.903) (-1331.965) (-1321.925) * (-1313.831) (-1326.488) [-1308.761] (-1311.013) -- 0:00:35
864000 -- [-1312.505] (-1323.889) (-1346.513) (-1325.110) * (-1333.810) (-1314.923) [-1316.563] (-1327.852) -- 0:00:35
864500 -- [-1315.705] (-1331.690) (-1340.330) (-1318.289) * [-1319.704] (-1321.114) (-1318.706) (-1315.728) -- 0:00:34
865000 -- (-1311.643) [-1313.536] (-1331.544) (-1313.131) * [-1315.440] (-1319.839) (-1319.339) (-1316.438) -- 0:00:34
Average standard deviation of split frequencies: 0.009384
865500 -- (-1311.992) (-1312.516) (-1334.837) [-1306.313] * (-1342.140) [-1320.481] (-1325.545) (-1328.965) -- 0:00:34
866000 -- (-1314.158) (-1322.431) (-1319.521) [-1317.319] * (-1337.744) (-1318.937) [-1313.471] (-1341.120) -- 0:00:34
866500 -- [-1306.964] (-1312.716) (-1315.455) (-1319.960) * (-1311.655) [-1314.608] (-1321.424) (-1350.702) -- 0:00:34
867000 -- (-1309.620) (-1321.719) [-1306.232] (-1335.494) * [-1312.083] (-1325.038) (-1308.439) (-1318.649) -- 0:00:34
867500 -- [-1314.676] (-1319.376) (-1325.337) (-1328.261) * [-1311.772] (-1324.532) (-1315.712) (-1313.965) -- 0:00:34
868000 -- (-1313.365) (-1314.570) (-1319.975) [-1310.075] * [-1309.989] (-1312.696) (-1322.759) (-1309.854) -- 0:00:34
868500 -- [-1315.324] (-1332.547) (-1316.099) (-1335.535) * [-1312.440] (-1315.281) (-1324.560) (-1313.121) -- 0:00:33
869000 -- (-1323.016) [-1325.850] (-1317.573) (-1320.777) * [-1311.794] (-1314.373) (-1323.015) (-1330.906) -- 0:00:33
869500 -- (-1317.419) (-1321.010) [-1314.414] (-1326.008) * [-1308.159] (-1308.260) (-1316.893) (-1326.163) -- 0:00:33
870000 -- (-1320.664) [-1326.659] (-1320.792) (-1317.099) * (-1316.453) [-1310.145] (-1319.494) (-1331.746) -- 0:00:33
Average standard deviation of split frequencies: 0.009539
870500 -- [-1311.500] (-1339.536) (-1323.000) (-1315.500) * (-1317.770) [-1309.944] (-1328.076) (-1322.676) -- 0:00:33
871000 -- (-1321.858) [-1320.649] (-1325.071) (-1310.485) * [-1311.249] (-1313.021) (-1316.691) (-1318.332) -- 0:00:33
871500 -- (-1323.201) (-1325.122) (-1319.448) [-1314.190] * [-1310.143] (-1327.523) (-1321.787) (-1312.080) -- 0:00:33
872000 -- (-1316.022) (-1331.678) (-1322.102) [-1318.434] * (-1340.111) [-1313.087] (-1324.389) (-1322.847) -- 0:00:33
872500 -- [-1316.784] (-1318.681) (-1327.100) (-1316.211) * (-1314.108) [-1316.817] (-1327.817) (-1316.121) -- 0:00:32
873000 -- (-1315.276) (-1316.972) [-1320.624] (-1318.239) * (-1319.518) (-1318.351) [-1309.311] (-1317.689) -- 0:00:32
873500 -- [-1313.045] (-1315.998) (-1319.904) (-1312.825) * (-1308.131) [-1324.132] (-1312.475) (-1325.229) -- 0:00:32
874000 -- (-1315.100) (-1318.244) (-1326.143) [-1313.930] * (-1307.117) (-1323.790) (-1325.967) [-1309.609] -- 0:00:32
874500 -- (-1319.842) [-1303.230] (-1311.451) (-1309.465) * (-1328.549) (-1321.778) (-1318.120) [-1309.490] -- 0:00:32
875000 -- (-1319.298) (-1322.956) [-1314.934] (-1320.773) * (-1319.827) (-1325.805) (-1325.476) [-1308.021] -- 0:00:32
Average standard deviation of split frequencies: 0.009789
875500 -- [-1315.527] (-1331.059) (-1321.400) (-1313.653) * (-1327.267) [-1323.867] (-1320.005) (-1312.453) -- 0:00:32
876000 -- (-1324.579) (-1317.899) (-1328.218) [-1311.807] * (-1330.560) (-1314.995) (-1315.386) [-1311.062] -- 0:00:31
876500 -- (-1324.059) (-1317.539) [-1312.183] (-1310.424) * (-1336.046) (-1313.219) (-1309.305) [-1314.132] -- 0:00:31
877000 -- (-1327.089) [-1315.811] (-1325.096) (-1326.008) * (-1329.931) (-1311.189) (-1327.972) [-1312.556] -- 0:00:31
877500 -- (-1323.078) (-1320.801) [-1317.476] (-1325.331) * (-1337.151) (-1316.548) (-1313.889) [-1315.075] -- 0:00:31
878000 -- (-1320.939) (-1314.876) [-1305.223] (-1319.179) * (-1319.622) [-1312.389] (-1332.824) (-1325.804) -- 0:00:31
878500 -- (-1316.264) (-1336.866) (-1310.949) [-1311.098] * [-1316.487] (-1313.409) (-1331.732) (-1330.105) -- 0:00:31
879000 -- (-1325.689) (-1328.516) (-1320.867) [-1313.578] * [-1327.582] (-1320.539) (-1338.181) (-1337.862) -- 0:00:31
879500 -- (-1334.917) (-1321.253) (-1322.430) [-1316.019] * (-1325.178) (-1314.983) [-1324.339] (-1332.051) -- 0:00:31
880000 -- (-1319.246) (-1329.103) [-1309.682] (-1314.255) * (-1327.026) [-1317.171] (-1319.673) (-1321.513) -- 0:00:30
Average standard deviation of split frequencies: 0.010272
880500 -- (-1317.309) (-1308.712) (-1318.638) [-1305.828] * [-1316.056] (-1330.605) (-1324.128) (-1318.372) -- 0:00:30
881000 -- (-1321.567) (-1329.582) [-1310.572] (-1325.778) * [-1310.074] (-1322.991) (-1328.717) (-1324.760) -- 0:00:30
881500 -- (-1315.596) (-1327.029) [-1316.741] (-1314.676) * (-1308.134) (-1323.065) (-1332.065) [-1311.405] -- 0:00:30
882000 -- [-1310.191] (-1322.971) (-1308.531) (-1314.533) * [-1303.423] (-1318.437) (-1333.242) (-1313.066) -- 0:00:30
882500 -- [-1317.840] (-1320.004) (-1332.266) (-1328.304) * [-1318.876] (-1337.976) (-1323.328) (-1313.861) -- 0:00:30
883000 -- (-1314.916) (-1320.192) (-1319.180) [-1310.848] * (-1315.181) (-1322.540) (-1317.213) [-1309.028] -- 0:00:30
883500 -- (-1324.112) (-1324.059) (-1315.137) [-1315.609] * (-1313.061) [-1317.025] (-1331.889) (-1313.410) -- 0:00:30
884000 -- [-1314.131] (-1328.103) (-1321.518) (-1322.803) * (-1320.399) [-1315.413] (-1316.060) (-1322.917) -- 0:00:29
884500 -- (-1320.507) (-1327.386) (-1334.975) [-1308.781] * [-1310.523] (-1323.757) (-1324.227) (-1326.729) -- 0:00:29
885000 -- (-1312.900) (-1321.458) (-1328.082) [-1317.283] * [-1313.159] (-1314.811) (-1315.962) (-1322.209) -- 0:00:29
Average standard deviation of split frequencies: 0.009456
885500 -- (-1309.190) [-1314.036] (-1323.604) (-1315.689) * (-1311.374) [-1315.496] (-1316.836) (-1341.773) -- 0:00:29
886000 -- [-1324.353] (-1315.040) (-1309.899) (-1311.433) * [-1311.957] (-1324.454) (-1317.838) (-1327.671) -- 0:00:29
886500 -- (-1319.712) (-1317.744) (-1313.986) [-1326.262] * [-1305.213] (-1312.622) (-1329.418) (-1331.477) -- 0:00:29
887000 -- (-1315.613) (-1326.814) (-1312.209) [-1310.941] * (-1316.678) [-1313.679] (-1321.148) (-1324.508) -- 0:00:29
887500 -- (-1313.675) (-1317.802) [-1314.852] (-1322.432) * (-1323.829) (-1319.051) [-1308.779] (-1316.650) -- 0:00:29
888000 -- [-1301.203] (-1320.773) (-1327.201) (-1319.384) * [-1316.623] (-1323.204) (-1315.801) (-1319.921) -- 0:00:28
888500 -- (-1317.076) [-1314.808] (-1322.797) (-1341.581) * [-1312.221] (-1315.759) (-1317.003) (-1333.262) -- 0:00:28
889000 -- [-1327.069] (-1320.903) (-1311.399) (-1332.012) * (-1318.004) (-1323.858) [-1315.465] (-1316.677) -- 0:00:28
889500 -- (-1324.353) [-1319.168] (-1325.516) (-1326.375) * (-1314.956) [-1319.238] (-1317.101) (-1325.369) -- 0:00:28
890000 -- (-1323.160) [-1311.033] (-1315.139) (-1319.315) * (-1310.235) (-1317.620) (-1331.167) [-1313.369] -- 0:00:28
Average standard deviation of split frequencies: 0.009671
890500 -- (-1327.336) [-1316.693] (-1314.950) (-1314.753) * (-1325.720) [-1319.085] (-1316.523) (-1329.170) -- 0:00:28
891000 -- (-1320.972) (-1318.228) (-1325.789) [-1324.386] * (-1319.072) (-1317.813) [-1318.710] (-1318.809) -- 0:00:28
891500 -- (-1310.298) [-1307.207] (-1331.736) (-1309.678) * (-1313.712) (-1324.684) (-1324.743) [-1308.725] -- 0:00:27
892000 -- (-1317.573) [-1305.794] (-1326.170) (-1321.802) * (-1329.725) (-1317.209) (-1310.957) [-1307.591] -- 0:00:27
892500 -- (-1331.360) (-1327.602) (-1312.055) [-1316.081] * (-1311.482) (-1319.536) (-1311.621) [-1313.619] -- 0:00:27
893000 -- [-1315.676] (-1319.785) (-1325.784) (-1322.088) * (-1318.179) [-1306.291] (-1317.876) (-1331.949) -- 0:00:27
893500 -- (-1318.118) [-1312.298] (-1310.458) (-1321.155) * (-1330.277) [-1312.577] (-1312.644) (-1314.350) -- 0:00:27
894000 -- (-1324.238) (-1320.534) [-1312.946] (-1315.393) * (-1315.386) [-1308.947] (-1312.901) (-1324.139) -- 0:00:27
894500 -- (-1332.607) (-1322.815) [-1310.997] (-1324.269) * (-1329.593) (-1320.224) [-1310.370] (-1315.178) -- 0:00:27
895000 -- (-1314.793) [-1307.871] (-1320.858) (-1313.710) * (-1319.711) (-1312.308) (-1318.991) [-1316.763] -- 0:00:27
Average standard deviation of split frequencies: 0.010140
895500 -- (-1327.428) (-1327.725) (-1313.161) [-1315.243] * (-1328.805) (-1314.749) [-1311.929] (-1308.779) -- 0:00:26
896000 -- (-1318.282) (-1334.204) [-1313.830] (-1317.453) * (-1324.379) (-1331.455) (-1321.223) [-1305.790] -- 0:00:26
896500 -- (-1310.367) (-1321.149) (-1312.318) [-1312.659] * (-1329.025) (-1318.096) [-1314.800] (-1319.439) -- 0:00:26
897000 -- (-1316.416) [-1309.217] (-1325.646) (-1318.292) * (-1326.793) (-1316.348) (-1315.108) [-1319.939] -- 0:00:26
897500 -- (-1328.321) [-1314.599] (-1311.334) (-1305.229) * (-1313.235) (-1319.423) (-1312.825) [-1312.673] -- 0:00:26
898000 -- (-1320.897) (-1315.822) [-1310.292] (-1311.481) * (-1326.144) [-1321.551] (-1334.907) (-1321.309) -- 0:00:26
898500 -- [-1322.454] (-1315.807) (-1333.423) (-1315.156) * (-1324.967) (-1340.901) (-1313.675) [-1316.366] -- 0:00:26
899000 -- [-1312.630] (-1326.092) (-1321.064) (-1318.530) * (-1328.883) (-1323.431) (-1315.824) [-1323.223] -- 0:00:26
899500 -- [-1318.181] (-1327.461) (-1321.913) (-1321.757) * (-1341.118) (-1315.040) (-1313.363) [-1320.298] -- 0:00:25
900000 -- (-1318.921) [-1317.495] (-1324.892) (-1312.165) * (-1342.583) (-1327.730) [-1321.682] (-1328.804) -- 0:00:25
Average standard deviation of split frequencies: 0.010230
900500 -- (-1312.159) (-1320.012) (-1331.996) [-1308.477] * (-1326.342) [-1316.368] (-1337.363) (-1319.677) -- 0:00:25
901000 -- (-1319.648) [-1312.835] (-1316.609) (-1323.644) * (-1316.936) (-1309.309) [-1306.079] (-1319.438) -- 0:00:25
901500 -- (-1321.419) (-1329.294) [-1314.722] (-1317.667) * (-1330.667) [-1309.733] (-1316.836) (-1318.992) -- 0:00:25
902000 -- (-1317.458) (-1323.221) (-1311.968) [-1313.687] * (-1317.788) (-1325.966) [-1324.801] (-1341.241) -- 0:00:25
902500 -- [-1312.840] (-1325.364) (-1323.242) (-1316.969) * (-1311.514) (-1328.537) [-1309.252] (-1333.650) -- 0:00:25
903000 -- (-1325.407) [-1310.742] (-1319.380) (-1316.496) * (-1333.505) (-1318.523) [-1312.910] (-1320.748) -- 0:00:25
903500 -- (-1314.157) [-1308.068] (-1328.473) (-1311.953) * (-1326.624) (-1316.269) [-1314.373] (-1310.541) -- 0:00:24
904000 -- [-1314.342] (-1313.449) (-1332.880) (-1306.918) * (-1317.585) [-1310.795] (-1314.774) (-1320.464) -- 0:00:24
904500 -- (-1316.305) [-1312.781] (-1323.380) (-1340.661) * (-1315.333) [-1309.471] (-1319.296) (-1320.434) -- 0:00:24
905000 -- (-1317.448) (-1323.166) (-1327.316) [-1323.745] * (-1307.816) [-1313.293] (-1304.947) (-1318.668) -- 0:00:24
Average standard deviation of split frequencies: 0.010525
905500 -- [-1318.793] (-1320.993) (-1331.923) (-1313.459) * [-1311.271] (-1319.178) (-1322.495) (-1315.423) -- 0:00:24
906000 -- (-1309.748) (-1318.084) (-1324.604) [-1312.210] * (-1327.179) (-1323.397) (-1326.374) [-1304.278] -- 0:00:24
906500 -- [-1316.147] (-1312.505) (-1312.056) (-1321.142) * (-1321.493) (-1332.232) (-1330.382) [-1307.294] -- 0:00:24
907000 -- [-1322.047] (-1318.163) (-1334.619) (-1317.981) * (-1319.440) (-1328.093) (-1325.877) [-1308.075] -- 0:00:23
907500 -- (-1319.142) (-1315.761) [-1317.328] (-1337.793) * (-1324.697) (-1313.811) [-1311.344] (-1349.963) -- 0:00:23
908000 -- (-1319.880) (-1315.198) (-1319.068) [-1325.032] * (-1317.972) (-1317.345) [-1316.533] (-1326.671) -- 0:00:23
908500 -- (-1315.685) [-1311.838] (-1313.568) (-1321.638) * (-1326.184) (-1325.475) (-1317.203) [-1310.521] -- 0:00:23
909000 -- [-1324.509] (-1311.958) (-1307.509) (-1325.199) * (-1319.842) (-1321.562) (-1320.267) [-1308.954] -- 0:00:23
909500 -- [-1313.395] (-1333.316) (-1318.726) (-1322.855) * (-1315.713) [-1321.908] (-1318.081) (-1323.646) -- 0:00:23
910000 -- (-1314.330) [-1313.509] (-1315.978) (-1330.431) * [-1313.352] (-1321.398) (-1322.540) (-1321.134) -- 0:00:23
Average standard deviation of split frequencies: 0.010329
910500 -- [-1306.622] (-1317.914) (-1309.022) (-1333.903) * [-1308.534] (-1311.856) (-1316.777) (-1322.455) -- 0:00:23
911000 -- (-1329.317) [-1322.999] (-1318.024) (-1314.157) * (-1324.975) (-1323.158) (-1326.316) [-1313.097] -- 0:00:22
911500 -- (-1313.629) [-1310.876] (-1326.422) (-1328.252) * (-1322.838) [-1315.155] (-1316.421) (-1324.515) -- 0:00:22
912000 -- [-1323.259] (-1313.913) (-1315.517) (-1331.725) * (-1319.504) (-1323.419) [-1312.960] (-1317.092) -- 0:00:22
912500 -- (-1335.155) [-1309.191] (-1324.861) (-1324.946) * (-1317.567) (-1320.644) (-1308.678) [-1315.962] -- 0:00:22
913000 -- (-1322.980) [-1306.317] (-1326.372) (-1317.613) * [-1304.820] (-1325.808) (-1318.828) (-1311.797) -- 0:00:22
913500 -- (-1311.909) (-1326.170) (-1318.245) [-1313.414] * (-1316.077) (-1314.021) (-1309.031) [-1311.868] -- 0:00:22
914000 -- (-1310.555) (-1336.679) [-1313.855] (-1326.077) * (-1305.552) [-1320.326] (-1313.609) (-1324.866) -- 0:00:22
914500 -- (-1321.731) (-1311.934) (-1337.973) [-1316.729] * (-1318.629) (-1329.638) (-1308.636) [-1307.470] -- 0:00:21
915000 -- (-1323.379) [-1314.244] (-1310.737) (-1325.935) * (-1324.673) (-1315.121) (-1311.079) [-1315.724] -- 0:00:21
Average standard deviation of split frequencies: 0.010293
915500 -- (-1333.468) (-1318.421) (-1315.938) [-1315.106] * (-1323.966) (-1327.976) [-1312.685] (-1320.058) -- 0:00:21
916000 -- [-1316.640] (-1330.647) (-1320.815) (-1328.046) * (-1320.581) (-1337.568) (-1324.734) [-1317.483] -- 0:00:21
916500 -- [-1322.908] (-1340.395) (-1324.510) (-1311.169) * (-1328.899) (-1326.011) [-1310.784] (-1327.590) -- 0:00:21
917000 -- [-1316.629] (-1317.413) (-1309.373) (-1331.497) * (-1315.834) (-1322.241) (-1315.386) [-1318.575] -- 0:00:21
917500 -- (-1311.034) [-1306.935] (-1320.055) (-1324.353) * [-1315.362] (-1337.513) (-1306.915) (-1327.327) -- 0:00:21
918000 -- [-1311.837] (-1314.066) (-1314.857) (-1315.048) * [-1309.351] (-1308.811) (-1317.879) (-1319.099) -- 0:00:21
918500 -- [-1313.360] (-1325.076) (-1318.779) (-1321.370) * (-1318.052) (-1325.375) (-1314.846) [-1315.290] -- 0:00:20
919000 -- (-1307.921) (-1326.772) (-1328.557) [-1318.198] * [-1312.597] (-1310.891) (-1317.395) (-1338.492) -- 0:00:20
919500 -- [-1315.116] (-1328.339) (-1325.673) (-1309.426) * [-1316.127] (-1323.899) (-1316.631) (-1335.767) -- 0:00:20
920000 -- (-1327.954) [-1306.244] (-1313.076) (-1321.922) * (-1323.351) [-1310.191] (-1311.416) (-1332.803) -- 0:00:20
Average standard deviation of split frequencies: 0.010194
920500 -- (-1329.797) (-1313.372) (-1306.588) [-1304.388] * (-1322.588) (-1318.456) [-1301.739] (-1331.968) -- 0:00:20
921000 -- (-1323.758) (-1321.639) (-1325.392) [-1307.879] * (-1334.083) [-1311.341] (-1313.688) (-1336.962) -- 0:00:20
921500 -- (-1323.162) [-1311.940] (-1325.689) (-1314.772) * (-1330.700) [-1313.540] (-1312.162) (-1328.061) -- 0:00:20
922000 -- (-1331.059) [-1307.521] (-1318.610) (-1321.158) * (-1327.204) (-1320.649) [-1313.953] (-1329.381) -- 0:00:20
922500 -- [-1324.872] (-1318.778) (-1319.126) (-1329.862) * (-1333.243) (-1317.076) (-1306.773) [-1318.292] -- 0:00:19
923000 -- (-1324.079) (-1317.631) [-1314.414] (-1323.307) * (-1329.214) (-1320.861) [-1308.530] (-1330.728) -- 0:00:19
923500 -- (-1322.197) [-1306.404] (-1313.471) (-1315.897) * (-1323.527) [-1311.953] (-1317.284) (-1316.125) -- 0:00:19
924000 -- (-1318.215) (-1336.616) [-1317.791] (-1324.820) * (-1311.736) (-1313.959) [-1308.324] (-1322.031) -- 0:00:19
924500 -- (-1320.923) (-1324.957) [-1308.299] (-1338.271) * (-1316.831) [-1306.327] (-1314.044) (-1326.732) -- 0:00:19
925000 -- (-1320.291) [-1316.324] (-1308.336) (-1316.280) * (-1315.879) (-1320.384) (-1316.002) [-1316.742] -- 0:00:19
Average standard deviation of split frequencies: 0.009606
925500 -- (-1315.955) (-1320.249) [-1312.434] (-1316.272) * (-1323.983) (-1317.431) (-1314.700) [-1315.873] -- 0:00:19
926000 -- (-1321.496) (-1309.252) (-1324.567) [-1315.570] * (-1325.231) (-1335.148) [-1310.990] (-1322.948) -- 0:00:19
926500 -- (-1326.438) (-1321.434) [-1310.329] (-1312.883) * (-1316.631) (-1325.544) [-1319.769] (-1327.913) -- 0:00:18
927000 -- (-1322.067) (-1313.105) (-1343.170) [-1313.218] * (-1313.988) (-1330.396) [-1318.871] (-1316.038) -- 0:00:18
927500 -- (-1326.966) (-1338.740) (-1312.026) [-1316.339] * (-1322.763) (-1312.314) (-1322.468) [-1308.984] -- 0:00:18
928000 -- [-1313.187] (-1350.049) (-1341.215) (-1304.182) * (-1336.645) [-1308.782] (-1316.777) (-1327.761) -- 0:00:18
928500 -- (-1325.617) (-1333.040) (-1314.085) [-1318.772] * (-1327.406) [-1304.898] (-1313.917) (-1318.241) -- 0:00:18
929000 -- (-1318.965) (-1326.722) (-1317.828) [-1310.520] * (-1314.953) [-1308.056] (-1310.259) (-1324.562) -- 0:00:18
929500 -- (-1326.530) (-1326.929) (-1313.795) [-1313.374] * (-1307.989) (-1325.378) (-1309.904) [-1308.055] -- 0:00:18
930000 -- (-1334.929) [-1307.147] (-1312.706) (-1326.310) * (-1316.217) (-1319.299) [-1313.289] (-1321.861) -- 0:00:17
Average standard deviation of split frequencies: 0.008897
930500 -- (-1334.363) [-1312.769] (-1312.538) (-1333.042) * (-1316.683) (-1317.069) (-1329.731) [-1316.167] -- 0:00:17
931000 -- (-1313.344) [-1307.984] (-1315.596) (-1337.708) * (-1324.578) (-1317.336) [-1316.081] (-1306.061) -- 0:00:17
931500 -- [-1311.638] (-1326.938) (-1316.424) (-1322.497) * [-1318.243] (-1313.395) (-1319.005) (-1319.135) -- 0:00:17
932000 -- (-1319.111) [-1307.017] (-1318.472) (-1322.744) * (-1316.277) [-1310.094] (-1317.801) (-1318.708) -- 0:00:17
932500 -- (-1311.160) (-1310.635) (-1322.389) [-1310.712] * (-1327.883) (-1314.468) (-1312.665) [-1319.038] -- 0:00:17
933000 -- (-1324.214) (-1318.017) [-1312.507] (-1320.434) * (-1311.399) (-1311.654) [-1321.505] (-1327.042) -- 0:00:17
933500 -- (-1306.109) [-1301.429] (-1319.893) (-1325.115) * [-1305.439] (-1317.203) (-1314.691) (-1316.602) -- 0:00:17
934000 -- [-1311.529] (-1316.455) (-1323.908) (-1326.569) * (-1316.253) [-1316.365] (-1319.592) (-1316.554) -- 0:00:16
934500 -- (-1309.630) (-1316.456) [-1326.112] (-1325.359) * (-1316.762) (-1314.493) [-1316.801] (-1331.602) -- 0:00:16
935000 -- (-1321.454) (-1316.282) [-1312.640] (-1318.430) * (-1325.322) [-1310.366] (-1318.253) (-1324.894) -- 0:00:16
Average standard deviation of split frequencies: 0.008715
935500 -- [-1313.669] (-1315.585) (-1323.909) (-1329.611) * (-1323.907) [-1314.999] (-1334.471) (-1318.597) -- 0:00:16
936000 -- (-1320.552) (-1319.460) (-1325.645) [-1317.464] * (-1308.406) (-1312.084) (-1347.875) [-1310.787] -- 0:00:16
936500 -- (-1317.368) [-1311.443] (-1317.709) (-1310.674) * (-1313.669) (-1313.414) (-1336.138) [-1313.879] -- 0:00:16
937000 -- [-1317.042] (-1318.759) (-1316.996) (-1320.103) * (-1326.067) [-1327.205] (-1334.402) (-1312.334) -- 0:00:16
937500 -- (-1315.734) [-1312.077] (-1315.459) (-1322.843) * (-1330.936) [-1312.542] (-1315.732) (-1315.314) -- 0:00:16
938000 -- (-1318.863) (-1316.451) (-1313.937) [-1312.742] * (-1347.470) [-1308.598] (-1313.485) (-1309.865) -- 0:00:15
938500 -- (-1319.489) [-1311.511] (-1336.260) (-1310.027) * (-1322.909) (-1322.055) [-1311.745] (-1315.640) -- 0:00:15
939000 -- [-1319.690] (-1318.656) (-1326.966) (-1324.885) * (-1326.261) [-1312.720] (-1311.100) (-1323.219) -- 0:00:15
939500 -- (-1326.094) (-1327.865) (-1326.745) [-1320.709] * (-1324.136) (-1338.710) (-1306.428) [-1306.037] -- 0:00:15
940000 -- (-1310.978) (-1315.031) (-1328.375) [-1318.499] * [-1316.206] (-1324.225) (-1328.138) (-1327.704) -- 0:00:15
Average standard deviation of split frequencies: 0.009217
940500 -- (-1312.825) [-1314.301] (-1327.200) (-1321.663) * [-1305.533] (-1316.839) (-1324.945) (-1326.324) -- 0:00:15
941000 -- [-1306.751] (-1335.042) (-1319.492) (-1327.558) * [-1308.880] (-1331.327) (-1318.173) (-1323.930) -- 0:00:15
941500 -- (-1317.340) [-1310.712] (-1324.269) (-1318.623) * (-1340.078) (-1337.202) (-1327.013) [-1310.718] -- 0:00:15
942000 -- (-1313.783) (-1308.503) (-1333.764) [-1313.194] * [-1318.913] (-1315.110) (-1308.989) (-1319.505) -- 0:00:14
942500 -- (-1322.970) (-1312.937) [-1313.777] (-1327.353) * (-1316.107) (-1311.072) (-1321.021) [-1308.395] -- 0:00:14
943000 -- (-1310.759) [-1317.080] (-1327.195) (-1324.578) * (-1316.150) [-1309.669] (-1317.829) (-1319.821) -- 0:00:14
943500 -- [-1309.985] (-1314.022) (-1315.664) (-1323.202) * (-1310.232) (-1329.148) (-1322.954) [-1310.936] -- 0:00:14
944000 -- (-1315.748) (-1331.057) [-1306.879] (-1316.428) * [-1314.140] (-1333.854) (-1318.622) (-1320.677) -- 0:00:14
944500 -- [-1309.163] (-1315.540) (-1320.777) (-1319.164) * (-1325.471) (-1338.556) (-1312.257) [-1319.015] -- 0:00:14
945000 -- (-1316.617) [-1321.637] (-1318.343) (-1325.842) * (-1328.279) (-1332.291) [-1310.433] (-1324.639) -- 0:00:14
Average standard deviation of split frequencies: 0.009490
945500 -- (-1316.628) [-1316.296] (-1330.228) (-1322.422) * (-1309.190) (-1318.480) [-1305.724] (-1319.897) -- 0:00:14
946000 -- (-1317.961) (-1328.533) [-1316.815] (-1330.658) * (-1316.070) (-1328.654) (-1326.678) [-1320.404] -- 0:00:13
946500 -- (-1320.873) (-1327.139) (-1323.961) [-1317.567] * (-1329.048) [-1320.934] (-1316.515) (-1311.656) -- 0:00:13
947000 -- (-1324.888) (-1341.374) [-1313.723] (-1309.723) * [-1313.204] (-1338.956) (-1303.876) (-1329.180) -- 0:00:13
947500 -- (-1312.722) (-1318.954) (-1311.960) [-1311.030] * [-1312.642] (-1327.609) (-1322.407) (-1321.971) -- 0:00:13
948000 -- (-1309.624) [-1333.416] (-1318.031) (-1317.497) * [-1311.089] (-1310.144) (-1337.888) (-1322.897) -- 0:00:13
948500 -- [-1313.911] (-1319.615) (-1319.815) (-1329.857) * (-1329.972) [-1309.741] (-1317.173) (-1306.828) -- 0:00:13
949000 -- (-1321.881) [-1313.685] (-1309.642) (-1340.658) * [-1307.327] (-1304.157) (-1326.557) (-1322.110) -- 0:00:13
949500 -- (-1314.550) (-1314.689) [-1326.339] (-1339.446) * (-1332.467) [-1324.834] (-1318.301) (-1321.122) -- 0:00:12
950000 -- (-1311.429) (-1316.549) [-1319.113] (-1319.679) * (-1330.828) (-1321.918) (-1312.459) [-1324.693] -- 0:00:12
Average standard deviation of split frequencies: 0.009227
950500 -- (-1316.509) (-1312.030) (-1331.953) [-1320.044] * (-1335.970) (-1325.182) [-1314.909] (-1319.471) -- 0:00:12
951000 -- (-1307.892) (-1323.423) (-1323.155) [-1310.288] * [-1308.484] (-1320.271) (-1326.265) (-1318.729) -- 0:00:12
951500 -- (-1314.908) [-1326.446] (-1314.215) (-1334.674) * [-1310.823] (-1324.856) (-1322.102) (-1319.335) -- 0:00:12
952000 -- (-1315.071) (-1319.269) (-1316.469) [-1310.188] * [-1310.159] (-1308.138) (-1309.152) (-1320.004) -- 0:00:12
952500 -- (-1322.320) (-1329.013) [-1307.705] (-1307.381) * [-1309.266] (-1315.367) (-1337.808) (-1323.001) -- 0:00:12
953000 -- (-1319.802) [-1309.610] (-1317.557) (-1319.789) * (-1312.157) (-1322.522) [-1310.839] (-1315.258) -- 0:00:12
953500 -- (-1319.651) [-1313.531] (-1314.654) (-1312.803) * (-1310.867) (-1313.901) [-1306.496] (-1317.309) -- 0:00:11
954000 -- (-1319.198) (-1319.214) [-1311.788] (-1321.476) * (-1319.199) (-1323.082) (-1314.775) [-1315.613] -- 0:00:11
954500 -- (-1310.059) [-1316.798] (-1319.817) (-1319.209) * (-1324.380) [-1316.069] (-1320.659) (-1316.976) -- 0:00:11
955000 -- [-1318.374] (-1314.448) (-1311.522) (-1328.230) * (-1311.087) [-1310.756] (-1324.912) (-1321.865) -- 0:00:11
Average standard deviation of split frequencies: 0.009817
955500 -- (-1323.875) (-1325.706) [-1322.201] (-1304.133) * [-1303.949] (-1324.391) (-1318.083) (-1305.519) -- 0:00:11
956000 -- (-1323.557) (-1317.157) [-1308.567] (-1319.754) * [-1308.020] (-1306.952) (-1311.064) (-1310.747) -- 0:00:11
956500 -- (-1325.935) (-1316.706) (-1318.921) [-1317.157] * [-1313.121] (-1317.297) (-1319.343) (-1315.567) -- 0:00:11
957000 -- (-1322.483) [-1312.447] (-1319.637) (-1336.200) * (-1314.468) (-1316.620) (-1324.123) [-1306.982] -- 0:00:11
957500 -- (-1315.147) [-1305.776] (-1336.677) (-1331.929) * (-1322.667) (-1317.039) (-1316.576) [-1308.259] -- 0:00:10
958000 -- (-1312.286) (-1314.207) [-1305.177] (-1317.482) * (-1319.565) (-1320.609) [-1317.380] (-1321.613) -- 0:00:10
958500 -- [-1313.498] (-1327.260) (-1311.782) (-1318.989) * (-1313.604) [-1320.067] (-1314.332) (-1318.296) -- 0:00:10
959000 -- (-1314.691) [-1316.263] (-1314.107) (-1318.042) * (-1315.958) (-1316.441) (-1311.392) [-1306.448] -- 0:00:10
959500 -- (-1323.454) (-1314.353) (-1313.548) [-1309.823] * (-1321.085) [-1315.701] (-1329.637) (-1328.421) -- 0:00:10
960000 -- [-1315.219] (-1311.711) (-1328.115) (-1318.374) * (-1323.074) (-1313.932) (-1312.769) [-1317.658] -- 0:00:10
Average standard deviation of split frequencies: 0.009814
960500 -- (-1318.480) (-1314.444) (-1321.223) [-1308.440] * [-1318.065] (-1323.053) (-1309.175) (-1315.144) -- 0:00:10
961000 -- (-1321.538) (-1323.092) [-1314.727] (-1307.723) * [-1312.307] (-1332.291) (-1311.391) (-1320.216) -- 0:00:10
961500 -- (-1325.997) [-1313.637] (-1315.949) (-1307.580) * [-1315.491] (-1323.865) (-1316.494) (-1335.106) -- 0:00:09
962000 -- (-1308.618) (-1317.349) [-1312.220] (-1316.667) * [-1314.078] (-1319.781) (-1327.819) (-1327.792) -- 0:00:09
962500 -- (-1316.207) (-1318.981) [-1307.122] (-1317.068) * (-1322.792) (-1317.198) (-1318.721) [-1309.479] -- 0:00:09
963000 -- (-1326.528) (-1321.901) [-1313.032] (-1305.591) * (-1309.491) (-1317.238) (-1317.009) [-1305.535] -- 0:00:09
963500 -- (-1325.257) (-1326.525) (-1320.108) [-1313.090] * (-1313.387) (-1326.646) (-1325.316) [-1312.379] -- 0:00:09
964000 -- (-1309.675) [-1317.057] (-1313.447) (-1319.006) * (-1313.112) (-1329.038) (-1335.175) [-1315.671] -- 0:00:09
964500 -- (-1312.739) [-1306.710] (-1317.575) (-1325.806) * (-1319.327) [-1315.149] (-1336.697) (-1322.006) -- 0:00:09
965000 -- [-1318.975] (-1318.159) (-1320.107) (-1315.832) * (-1328.649) [-1308.445] (-1328.776) (-1320.567) -- 0:00:08
Average standard deviation of split frequencies: 0.009605
965500 -- (-1322.553) [-1313.140] (-1305.661) (-1310.330) * (-1331.152) (-1323.362) (-1317.811) [-1325.762] -- 0:00:08
966000 -- (-1312.316) (-1307.294) (-1316.448) [-1321.416] * (-1315.847) (-1335.854) [-1310.195] (-1330.514) -- 0:00:08
966500 -- [-1311.995] (-1316.773) (-1312.961) (-1314.193) * (-1324.938) (-1324.923) (-1313.173) [-1325.411] -- 0:00:08
967000 -- [-1318.579] (-1331.626) (-1307.786) (-1325.877) * (-1331.459) [-1310.966] (-1339.433) (-1318.459) -- 0:00:08
967500 -- (-1315.048) (-1336.158) [-1313.121] (-1319.148) * [-1317.806] (-1324.835) (-1322.603) (-1323.938) -- 0:00:08
968000 -- (-1322.434) [-1314.781] (-1309.751) (-1326.289) * (-1324.943) [-1315.331] (-1313.868) (-1306.239) -- 0:00:08
968500 -- [-1313.779] (-1317.487) (-1327.182) (-1314.723) * (-1328.314) [-1319.440] (-1316.391) (-1310.288) -- 0:00:08
969000 -- (-1314.149) [-1322.104] (-1311.481) (-1324.938) * (-1339.455) (-1317.730) (-1329.483) [-1306.292] -- 0:00:07
969500 -- [-1316.531] (-1315.914) (-1341.847) (-1319.577) * (-1313.022) [-1318.094] (-1314.572) (-1325.755) -- 0:00:07
970000 -- (-1320.066) [-1312.582] (-1332.951) (-1330.581) * (-1313.480) (-1334.832) [-1318.373] (-1317.650) -- 0:00:07
Average standard deviation of split frequencies: 0.009470
970500 -- [-1312.083] (-1307.223) (-1322.092) (-1330.436) * (-1322.031) [-1310.019] (-1318.768) (-1314.537) -- 0:00:07
971000 -- [-1318.027] (-1333.832) (-1318.208) (-1320.346) * (-1314.805) [-1313.151] (-1326.466) (-1316.088) -- 0:00:07
971500 -- (-1312.915) (-1317.691) (-1319.592) [-1312.953] * (-1334.863) [-1307.500] (-1323.609) (-1315.395) -- 0:00:07
972000 -- (-1313.297) (-1317.119) [-1315.412] (-1311.379) * [-1308.997] (-1318.817) (-1309.823) (-1306.155) -- 0:00:07
972500 -- (-1330.254) [-1317.160] (-1332.331) (-1319.657) * (-1307.789) (-1317.083) [-1310.292] (-1304.344) -- 0:00:07
973000 -- (-1321.294) (-1321.729) (-1320.189) [-1317.247] * (-1323.483) [-1311.218] (-1317.826) (-1319.125) -- 0:00:06
973500 -- (-1329.029) (-1330.405) [-1318.456] (-1314.647) * (-1317.593) (-1314.320) (-1318.068) [-1306.666] -- 0:00:06
974000 -- (-1308.883) (-1339.193) (-1314.113) [-1318.286] * [-1319.701] (-1315.428) (-1318.285) (-1323.869) -- 0:00:06
974500 -- (-1319.971) [-1319.060] (-1316.969) (-1322.413) * [-1312.354] (-1319.651) (-1343.063) (-1318.568) -- 0:00:06
975000 -- [-1310.710] (-1313.954) (-1316.901) (-1332.095) * (-1321.562) (-1321.292) [-1314.512] (-1320.972) -- 0:00:06
Average standard deviation of split frequencies: 0.009261
975500 -- (-1325.613) [-1318.946] (-1312.007) (-1312.562) * [-1315.857] (-1332.303) (-1310.565) (-1330.768) -- 0:00:06
976000 -- (-1314.083) (-1314.718) [-1315.049] (-1314.809) * [-1320.955] (-1316.263) (-1320.046) (-1313.372) -- 0:00:06
976500 -- (-1329.014) [-1318.108] (-1324.663) (-1319.707) * (-1320.785) (-1320.834) [-1309.418] (-1325.860) -- 0:00:06
977000 -- (-1319.349) (-1308.359) (-1337.230) [-1307.585] * (-1313.183) (-1317.900) [-1313.267] (-1315.343) -- 0:00:05
977500 -- [-1317.581] (-1329.770) (-1313.068) (-1328.526) * [-1302.723] (-1332.045) (-1312.306) (-1313.014) -- 0:00:05
978000 -- [-1312.602] (-1314.846) (-1318.640) (-1314.322) * (-1317.453) (-1329.779) [-1304.850] (-1314.032) -- 0:00:05
978500 -- (-1330.500) (-1340.773) [-1310.367] (-1318.738) * (-1324.271) (-1329.817) (-1311.927) [-1314.079] -- 0:00:05
979000 -- (-1325.371) (-1317.745) (-1328.568) [-1319.627] * (-1316.299) [-1323.967] (-1333.597) (-1321.933) -- 0:00:05
979500 -- (-1311.302) (-1310.528) (-1314.418) [-1306.207] * (-1316.409) (-1327.295) [-1315.670] (-1322.118) -- 0:00:05
980000 -- [-1319.673] (-1318.360) (-1317.930) (-1313.648) * (-1331.131) (-1318.449) (-1320.525) [-1318.473] -- 0:00:05
Average standard deviation of split frequencies: 0.009439
980500 -- (-1327.188) (-1316.094) [-1306.674] (-1324.311) * (-1321.203) (-1317.964) (-1315.334) [-1310.419] -- 0:00:05
981000 -- [-1316.029] (-1320.386) (-1320.553) (-1320.212) * [-1321.927] (-1330.825) (-1315.640) (-1313.503) -- 0:00:04
981500 -- (-1323.703) (-1313.233) (-1321.017) [-1304.980] * [-1315.756] (-1319.413) (-1320.156) (-1311.935) -- 0:00:04
982000 -- (-1325.187) (-1319.178) [-1310.243] (-1316.314) * (-1321.763) (-1321.554) [-1318.299] (-1346.327) -- 0:00:04
982500 -- (-1319.887) (-1315.841) (-1319.735) [-1311.558] * (-1310.163) (-1322.286) [-1321.963] (-1336.520) -- 0:00:04
983000 -- (-1313.960) [-1305.758] (-1321.356) (-1323.960) * (-1325.848) [-1309.509] (-1318.316) (-1312.870) -- 0:00:04
983500 -- (-1315.234) (-1323.774) (-1318.903) [-1311.161] * [-1314.363] (-1308.500) (-1310.465) (-1322.784) -- 0:00:04
984000 -- (-1326.029) (-1326.459) [-1320.116] (-1311.477) * [-1310.122] (-1309.018) (-1319.583) (-1316.316) -- 0:00:04
984500 -- (-1315.360) (-1332.591) (-1316.554) [-1307.912] * (-1315.685) [-1314.267] (-1319.260) (-1318.958) -- 0:00:03
985000 -- (-1324.031) (-1319.684) (-1324.731) [-1303.494] * (-1330.297) [-1310.838] (-1318.668) (-1312.631) -- 0:00:03
Average standard deviation of split frequencies: 0.009844
985500 -- (-1320.309) (-1326.307) (-1333.353) [-1316.049] * (-1333.179) (-1311.231) (-1310.843) [-1322.604] -- 0:00:03
986000 -- (-1309.405) [-1315.140] (-1334.224) (-1321.580) * [-1310.824] (-1316.555) (-1318.656) (-1323.449) -- 0:00:03
986500 -- (-1319.669) (-1315.877) [-1320.995] (-1324.935) * [-1317.172] (-1340.271) (-1326.530) (-1313.223) -- 0:00:03
987000 -- (-1320.558) (-1324.102) [-1307.355] (-1342.995) * (-1308.470) (-1318.997) (-1340.846) [-1319.286] -- 0:00:03
987500 -- (-1322.144) (-1323.731) [-1307.578] (-1331.857) * (-1315.821) (-1336.831) (-1321.694) [-1310.430] -- 0:00:03
988000 -- [-1310.881] (-1338.184) (-1313.945) (-1328.153) * (-1319.945) (-1335.590) (-1333.133) [-1307.741] -- 0:00:03
988500 -- (-1328.484) (-1313.102) [-1306.868] (-1317.354) * (-1314.887) (-1327.825) (-1318.457) [-1322.197] -- 0:00:02
989000 -- (-1331.011) (-1318.173) (-1310.708) [-1306.246] * [-1306.115] (-1335.112) (-1318.050) (-1311.128) -- 0:00:02
989500 -- (-1324.081) (-1319.700) [-1309.430] (-1316.001) * [-1311.824] (-1327.116) (-1322.784) (-1316.748) -- 0:00:02
990000 -- (-1334.127) (-1325.520) [-1309.465] (-1323.078) * [-1313.236] (-1327.770) (-1323.395) (-1311.130) -- 0:00:02
Average standard deviation of split frequencies: 0.009413
990500 -- (-1326.002) [-1318.581] (-1308.861) (-1319.208) * (-1313.029) (-1335.195) [-1306.215] (-1307.692) -- 0:00:02
991000 -- (-1310.689) [-1316.645] (-1317.320) (-1319.398) * (-1308.320) (-1326.260) (-1311.304) [-1314.950] -- 0:00:02
991500 -- (-1312.926) (-1313.192) [-1310.468] (-1311.693) * [-1313.298] (-1326.885) (-1319.200) (-1317.296) -- 0:00:02
992000 -- (-1329.281) [-1313.463] (-1323.958) (-1316.589) * (-1331.236) (-1322.959) (-1339.924) [-1319.277] -- 0:00:02
992500 -- (-1318.114) (-1321.054) (-1319.460) [-1312.056] * [-1320.712] (-1331.046) (-1323.227) (-1325.380) -- 0:00:01
993000 -- (-1322.912) (-1319.589) (-1313.131) [-1305.850] * (-1329.257) (-1315.583) [-1314.563] (-1321.960) -- 0:00:01
993500 -- (-1334.519) (-1313.389) [-1312.602] (-1315.460) * (-1326.702) [-1318.083] (-1323.541) (-1317.625) -- 0:00:01
994000 -- (-1317.918) (-1315.833) (-1318.503) [-1318.849] * (-1331.138) [-1311.440] (-1338.344) (-1325.661) -- 0:00:01
994500 -- [-1323.942] (-1304.638) (-1317.412) (-1314.200) * [-1317.604] (-1310.787) (-1326.588) (-1323.083) -- 0:00:01
995000 -- (-1330.086) [-1306.797] (-1319.461) (-1317.954) * (-1319.262) (-1327.781) [-1316.492] (-1320.224) -- 0:00:01
Average standard deviation of split frequencies: 0.009939
995500 -- [-1316.752] (-1321.069) (-1322.578) (-1335.028) * (-1314.723) [-1311.243] (-1320.447) (-1338.334) -- 0:00:01
996000 -- (-1323.689) [-1316.211] (-1308.891) (-1330.432) * (-1321.103) [-1323.478] (-1329.818) (-1329.056) -- 0:00:01
996500 -- (-1325.000) [-1312.829] (-1320.648) (-1335.661) * (-1317.355) [-1314.824] (-1321.604) (-1313.788) -- 0:00:00
997000 -- (-1315.642) (-1323.801) [-1314.150] (-1320.569) * (-1321.944) (-1317.754) [-1308.786] (-1313.422) -- 0:00:00
997500 -- (-1331.157) [-1317.282] (-1313.927) (-1315.678) * (-1320.013) (-1306.815) [-1309.098] (-1318.354) -- 0:00:00
998000 -- (-1329.505) [-1319.901] (-1328.598) (-1317.209) * [-1310.813] (-1323.399) (-1315.751) (-1317.422) -- 0:00:00
998500 -- (-1313.713) (-1319.610) [-1308.249] (-1326.841) * (-1314.223) (-1331.237) (-1317.680) [-1313.806] -- 0:00:00
999000 -- (-1312.145) (-1327.737) (-1329.171) [-1316.129] * [-1299.423] (-1313.729) (-1319.431) (-1309.142) -- 0:00:00
999500 -- [-1310.007] (-1313.867) (-1322.237) (-1318.897) * (-1318.301) [-1317.007] (-1315.656) (-1323.743) -- 0:00:00
1000000 -- (-1309.035) (-1330.680) (-1312.426) [-1312.222] * (-1327.470) (-1315.141) [-1315.485] (-1321.399) -- 0:00:00
Average standard deviation of split frequencies: 0.009700
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1309.034606 -- 26.594024
Chain 1 -- -1309.034611 -- 26.594024
Chain 2 -- -1330.680368 -- 22.284842
Chain 2 -- -1330.680370 -- 22.284842
Chain 3 -- -1312.426199 -- 26.177382
Chain 3 -- -1312.426200 -- 26.177382
Chain 4 -- -1312.222497 -- 26.287790
Chain 4 -- -1312.222497 -- 26.287790
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1327.470337 -- 21.995481
Chain 1 -- -1327.470339 -- 21.995481
Chain 2 -- -1315.141385 -- 27.176797
Chain 2 -- -1315.141381 -- 27.176797
Chain 3 -- -1315.485443 -- 28.359916
Chain 3 -- -1315.485443 -- 28.359916
Chain 4 -- -1321.399091 -- 30.516808
Chain 4 -- -1321.399091 -- 30.516808
Analysis completed in 4 mins 17 seconds
Analysis used 257.19 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1298.09
Likelihood of best state for "cold" chain of run 2 was -1297.99
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
56.6 % ( 48 %) Dirichlet(Revmat{all})
73.6 % ( 61 %) Slider(Revmat{all})
28.2 % ( 29 %) Dirichlet(Pi{all})
29.7 % ( 27 %) Slider(Pi{all})
35.9 % ( 28 %) Multiplier(Alpha{1,2})
48.7 % ( 26 %) Multiplier(Alpha{3})
41.6 % ( 28 %) Slider(Pinvar{all})
36.6 % ( 38 %) ExtSPR(Tau{all},V{all})
13.9 % ( 15 %) ExtTBR(Tau{all},V{all})
46.5 % ( 42 %) NNI(Tau{all},V{all})
35.6 % ( 41 %) ParsSPR(Tau{all},V{all})
27.1 % ( 27 %) Multiplier(V{all})
57.4 % ( 52 %) Nodeslider(V{all})
26.7 % ( 34 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
57.5 % ( 42 %) Dirichlet(Revmat{all})
74.0 % ( 61 %) Slider(Revmat{all})
28.0 % ( 36 %) Dirichlet(Pi{all})
30.0 % ( 23 %) Slider(Pi{all})
35.9 % ( 14 %) Multiplier(Alpha{1,2})
48.0 % ( 23 %) Multiplier(Alpha{3})
41.2 % ( 21 %) Slider(Pinvar{all})
37.0 % ( 30 %) ExtSPR(Tau{all},V{all})
14.1 % ( 12 %) ExtTBR(Tau{all},V{all})
46.6 % ( 53 %) NNI(Tau{all},V{all})
35.5 % ( 34 %) ParsSPR(Tau{all},V{all})
27.2 % ( 25 %) Multiplier(V{all})
56.9 % ( 57 %) Nodeslider(V{all})
26.8 % ( 23 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.69 0.43 0.24
2 | 167210 0.70 0.44
3 | 167094 166315 0.70
4 | 166126 166365 166890
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.69 0.43 0.24
2 | 167020 0.70 0.44
3 | 166534 166944 0.69
4 | 166208 166259 167035
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1311.41
| 2 |
| 1 2 |
| 2 22 2 |
| 1 11 2 11 2 11|
|1 2 2 1 2 2 2 1 2 2 2 12 |
| 1 12 1 1 12 2|
| 1 2 1 2 * 2 1 2 1 1 2 2 11 |
| 22 2* 1 12 1 2 22 1 1 2 11 122 2 |
|2 1 1 12 2 1 2 1 |
| 211 11 22 2 1 1 1 1 2 |
| 2 1 2 2 12 1 1 |
| 2 1 2 1 *1 1 |
| 1 2 1 2 |
| 1 2 2 |
| 1 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1316.85
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1306.37 -1329.16
2 -1305.53 -1330.75
--------------------------------------
TOTAL -1305.86 -1330.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.444227 0.011605 0.261739 0.666272 0.429258 1224.47 1300.84 1.000
r(A<->C){all} 0.027604 0.000330 0.000031 0.062834 0.024025 896.01 919.87 1.000
r(A<->G){all} 0.232289 0.005979 0.098468 0.385381 0.223423 390.59 612.71 1.000
r(A<->T){all} 0.120904 0.002830 0.022085 0.223053 0.114900 580.43 583.37 1.000
r(C<->G){all} 0.016864 0.000219 0.000014 0.046095 0.013064 906.67 953.09 1.000
r(C<->T){all} 0.353792 0.008648 0.178064 0.530277 0.348018 292.34 400.46 1.000
r(G<->T){all} 0.248547 0.005582 0.116603 0.400646 0.244688 613.98 648.02 1.000
pi(A){all} 0.282877 0.000303 0.248506 0.315433 0.282114 1215.62 1266.11 1.000
pi(C){all} 0.314354 0.000316 0.279639 0.348046 0.314162 1210.96 1286.99 1.001
pi(G){all} 0.226806 0.000249 0.194368 0.255550 0.226801 937.05 1095.29 1.000
pi(T){all} 0.175963 0.000201 0.149332 0.204586 0.175491 1195.07 1263.91 1.000
alpha{1,2} 0.114375 0.000793 0.067296 0.171206 0.109706 1127.65 1294.31 1.000
alpha{3} 1.625997 0.428499 0.598230 2.914526 1.527999 1174.48 1270.62 1.001
pinvar{all} 0.756703 0.001424 0.678591 0.821768 0.758687 1228.50 1364.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- ...********
13 -- .....******
14 -- .....***.**
15 -- .....**....
16 -- ...**......
17 -- ..*********
18 -- .*.********
19 -- .**........
20 -- ...*.******
21 -- .......*..*
22 -- .........**
23 -- ...*****.**
24 -- .......*.**
25 -- .......*.*.
26 -- .....***..*
27 -- ......**...
28 -- .....**..*.
29 -- ......**.**
30 -- .....***.*.
31 -- .....***...
32 -- ...*.***.**
33 -- .....*****.
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2556 0.851432 0.014133 0.841439 0.861426 2
13 2320 0.772818 0.028265 0.752831 0.792805 2
14 2017 0.671885 0.012719 0.662891 0.680879 2
15 1950 0.649567 0.007537 0.644237 0.654897 2
16 1619 0.539307 0.002355 0.537642 0.540973 2
17 943 0.314124 0.007066 0.309127 0.319121 2
18 930 0.309793 0.007537 0.304464 0.315123 2
19 919 0.306129 0.000471 0.305796 0.306462 2
20 767 0.255496 0.020257 0.241173 0.269820 2
21 682 0.227182 0.006595 0.222518 0.231845 2
22 562 0.187209 0.008480 0.181213 0.193205 2
23 544 0.181213 0.024497 0.163891 0.198534 2
24 450 0.149900 0.000942 0.149234 0.150566 2
25 442 0.147235 0.010364 0.139907 0.154564 2
26 425 0.141572 0.006124 0.137242 0.145903 2
27 413 0.137575 0.000471 0.137242 0.137908 2
28 405 0.134910 0.003298 0.132578 0.137242 2
29 385 0.128248 0.025910 0.109927 0.146569 2
30 368 0.122585 0.008480 0.116589 0.128581 2
31 356 0.118588 0.005653 0.114590 0.122585 2
32 305 0.101599 0.011777 0.093271 0.109927 2
33 301 0.100266 0.000471 0.099933 0.100600 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.007896 0.000038 0.000015 0.020091 0.006356 1.000 2
length{all}[2] 0.007632 0.000037 0.000003 0.019837 0.006032 1.000 2
length{all}[3] 0.011697 0.000060 0.000480 0.026254 0.010054 1.001 2
length{all}[4] 0.007585 0.000040 0.000009 0.019655 0.006002 1.000 2
length{all}[5] 0.007672 0.000034 0.000053 0.018511 0.006321 1.000 2
length{all}[6] 0.024867 0.000188 0.003083 0.051585 0.022263 1.000 2
length{all}[7] 0.030366 0.000237 0.006730 0.060533 0.027137 1.000 2
length{all}[8] 0.043741 0.000374 0.012692 0.079156 0.040460 1.000 2
length{all}[9] 0.088655 0.001263 0.033008 0.160250 0.082261 1.000 2
length{all}[10] 0.086857 0.001140 0.029911 0.153640 0.080514 1.000 2
length{all}[11] 0.028890 0.000208 0.005761 0.057194 0.026505 1.000 2
length{all}[12] 0.013584 0.000085 0.000085 0.031081 0.011545 1.000 2
length{all}[13] 0.026401 0.000257 0.001242 0.056893 0.023556 1.000 2
length{all}[14] 0.025759 0.000295 0.000046 0.057689 0.022448 1.000 2
length{all}[15] 0.014944 0.000121 0.000158 0.035535 0.012473 1.000 2
length{all}[16] 0.009135 0.000057 0.000005 0.023575 0.007215 1.000 2
length{all}[17] 0.005004 0.000028 0.000000 0.014791 0.003464 0.999 2
length{all}[18] 0.004916 0.000023 0.000002 0.014719 0.003487 1.001 2
length{all}[19] 0.004800 0.000027 0.000001 0.014533 0.003099 0.999 2
length{all}[20] 0.006625 0.000040 0.000001 0.018253 0.004864 0.999 2
length{all}[21] 0.009846 0.000085 0.000016 0.025722 0.007397 0.999 2
length{all}[22] 0.009677 0.000102 0.000031 0.028637 0.006125 1.004 2
length{all}[23] 0.012204 0.000072 0.000008 0.027648 0.010520 1.001 2
length{all}[24] 0.008481 0.000064 0.000011 0.025154 0.006389 0.999 2
length{all}[25] 0.008173 0.000060 0.000011 0.024137 0.006019 0.998 2
length{all}[26] 0.009031 0.000083 0.000042 0.026777 0.005788 0.998 2
length{all}[27] 0.011425 0.000093 0.000002 0.030267 0.009010 0.998 2
length{all}[28] 0.007749 0.000053 0.000000 0.022537 0.005692 0.998 2
length{all}[29] 0.010212 0.000082 0.000049 0.030942 0.007976 0.997 2
length{all}[30] 0.007901 0.000055 0.000052 0.022562 0.005893 0.999 2
length{all}[31] 0.007304 0.000047 0.000017 0.021191 0.005638 0.998 2
length{all}[32] 0.008135 0.000054 0.000013 0.024523 0.005917 0.998 2
length{all}[33] 0.009756 0.000061 0.000042 0.025879 0.008284 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.009700
Maximum standard deviation of split frequencies = 0.028265
Average PSRF for parameter values ( excluding NA and >10.0 ) = 0.999
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
|---------------------------------------------------------------------- C3 (3)
|
| /-------------- C4 (4)
+ /--------------------54-------------------+
| | \-------------- C5 (5)
| |
| | /-------------- C6 (6)
| | /------65-----+
| | | \-------------- C7 (7)
\------85-----+ |
| |---------------------------- C8 (8)
| /------67-----+
| | |---------------------------- C10 (10)
| | |
\------77-----+ \---------------------------- C11 (11)
|
\------------------------------------------ C9 (9)
Phylogram (based on average branch lengths):
/--- C1 (1)
|
|--- C2 (2)
|
|----- C3 (3)
|
| /--- C4 (4)
+ /---+
| | \--- C5 (5)
| |
| | /----------- C6 (6)
| | /------+
| | | \------------- C7 (7)
\-----+ |
| |--------------------- C8 (8)
| /----------+
| | |----------------------------------------- C10 (10)
| | |
\-----------+ \-------------- C11 (11)
|
\------------------------------------------ C9 (9)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (1685 trees sampled):
50 % credible set contains 325 trees
90 % credible set contains 1385 trees
95 % credible set contains 1535 trees
99 % credible set contains 1655 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 645
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sequences read..
Counting site patterns.. 0:00
94 patterns at 215 / 215 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
91744 bytes for conP
12784 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
275232 bytes for conP, adjusted
0.004959 0.003779 0.010098 0.008404 0.005970 0.003890 0.005440 0.012982 0.011910 0.009971 0.019866 0.028055 0.042229 0.065951 0.024900 0.055881 0.300000 1.300000
ntime & nrate & np: 16 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 18
lnL0 = -1373.637486
Iterating by ming2
Initial: fx= 1373.637486
x= 0.00496 0.00378 0.01010 0.00840 0.00597 0.00389 0.00544 0.01298 0.01191 0.00997 0.01987 0.02806 0.04223 0.06595 0.02490 0.05588 0.30000 1.30000
1 h-m-p 0.0000 0.0002 200.4796 +YCC 1372.264305 2 0.0001 27 | 0/18
2 h-m-p 0.0000 0.0002 271.9439 YCCC 1370.540630 3 0.0001 53 | 0/18
3 h-m-p 0.0000 0.0001 338.8027 +YYYYYC 1367.871542 5 0.0001 80 | 0/18
4 h-m-p 0.0000 0.0000 4921.4194 +YYYYCC 1364.123011 5 0.0000 108 | 0/18
5 h-m-p 0.0000 0.0000 10918.7014 +YYYYY 1359.207747 4 0.0000 134 | 0/18
6 h-m-p 0.0000 0.0000 12802.4074 +YYCCC 1355.129672 4 0.0000 162 | 0/18
7 h-m-p 0.0000 0.0000 3488.4655 +YYCYC 1353.390312 4 0.0000 189 | 0/18
8 h-m-p 0.0000 0.0000 4199.9091 +YYYYYYCCCC 1349.874756 9 0.0000 223 | 0/18
9 h-m-p 0.0000 0.0002 1911.4195 +YYCCC 1342.680589 4 0.0001 251 | 0/18
10 h-m-p 0.0000 0.0002 627.3617 YCCCC 1340.202387 4 0.0001 279 | 0/18
11 h-m-p 0.0001 0.0004 393.0801 CCCCC 1337.926525 4 0.0001 308 | 0/18
12 h-m-p 0.0001 0.0003 559.0335 CCCCC 1336.028099 4 0.0001 337 | 0/18
13 h-m-p 0.0001 0.0006 196.3260 CCCC 1335.194864 3 0.0001 364 | 0/18
14 h-m-p 0.0001 0.0007 75.8800 YCYCCC 1334.570511 5 0.0003 393 | 0/18
15 h-m-p 0.0000 0.0011 615.4530 ++CYYCYCCCC 1316.106981 8 0.0009 429 | 0/18
16 h-m-p 0.0000 0.0000 25467.7818 +YYYYCCC 1308.810697 6 0.0000 459 | 0/18
17 h-m-p 0.0001 0.0006 340.0651 CCCCC 1307.740217 4 0.0002 488 | 0/18
18 h-m-p 0.0002 0.0009 30.7025 CCCC 1307.643513 3 0.0002 515 | 0/18
19 h-m-p 0.0003 0.0099 18.7324 ++YYYYYYCCCC 1304.483049 10 0.0050 551 | 0/18
20 h-m-p 0.0224 0.1118 0.8563 CYCCC 1301.862433 4 0.0431 579 | 0/18
21 h-m-p 0.0509 0.2547 0.3878 YCCCCC 1297.351270 5 0.1067 627 | 0/18
22 h-m-p 0.1003 1.2894 0.4123 +YCCC 1281.143845 3 0.6335 672 | 0/18
23 h-m-p 0.2076 1.0382 0.1351 +YCCCC 1277.597602 4 0.5795 719 | 0/18
24 h-m-p 0.1726 0.8631 0.2219 YCCC 1275.634988 3 0.2819 763 | 0/18
25 h-m-p 0.5584 2.7922 0.0880 +YYCCCC 1270.491195 5 1.7197 811 | 0/18
26 h-m-p 1.0232 7.1446 0.1479 YYCCC 1267.763299 4 1.4349 856 | 0/18
27 h-m-p 0.9406 4.7028 0.1088 CCCC 1266.029927 3 1.4287 901 | 0/18
28 h-m-p 0.8372 4.1862 0.0621 CCCC 1265.370376 3 1.0908 946 | 0/18
29 h-m-p 1.0972 5.4861 0.0588 CCCC 1264.882562 3 1.2842 991 | 0/18
30 h-m-p 1.6000 8.0000 0.0449 CCC 1264.635336 2 2.3955 1034 | 0/18
31 h-m-p 1.6000 8.0000 0.0137 CYC 1264.457475 2 2.2080 1076 | 0/18
32 h-m-p 1.6000 8.0000 0.0038 YCC 1264.261271 2 2.6109 1118 | 0/18
33 h-m-p 0.5236 8.0000 0.0188 +YC 1264.005082 1 4.7521 1159 | 0/18
34 h-m-p 1.4923 8.0000 0.0600 +YCCC 1263.564512 3 4.1261 1204 | 0/18
35 h-m-p 1.6000 8.0000 0.0289 YC 1263.171113 1 3.2422 1244 | 0/18
36 h-m-p 1.5011 8.0000 0.0625 YC 1262.834476 1 2.6043 1284 | 0/18
37 h-m-p 1.6000 8.0000 0.0037 CCC 1262.733095 2 1.9939 1327 | 0/18
38 h-m-p 1.5098 8.0000 0.0049 +CC 1262.637504 1 5.9264 1369 | 0/18
39 h-m-p 0.8679 8.0000 0.0333 +YCC 1262.419365 2 4.4709 1412 | 0/18
40 h-m-p 1.6000 8.0000 0.0404 CCC 1262.256427 2 2.1336 1455 | 0/18
41 h-m-p 1.6000 8.0000 0.0156 YCC 1262.175835 2 2.7690 1497 | 0/18
42 h-m-p 1.6000 8.0000 0.0067 YCCC 1262.076562 3 3.3474 1541 | 0/18
43 h-m-p 1.3225 8.0000 0.0170 +YCC 1261.945398 2 3.5135 1584 | 0/18
44 h-m-p 1.6000 8.0000 0.0063 CYC 1261.901406 2 1.7932 1626 | 0/18
45 h-m-p 1.6000 8.0000 0.0025 CC 1261.885261 1 2.1516 1667 | 0/18
46 h-m-p 1.6000 8.0000 0.0018 YC 1261.875153 1 2.9508 1707 | 0/18
47 h-m-p 1.4838 8.0000 0.0036 YC 1261.869986 1 2.3945 1747 | 0/18
48 h-m-p 1.6000 8.0000 0.0019 C 1261.869075 0 1.4484 1786 | 0/18
49 h-m-p 1.6000 8.0000 0.0003 C 1261.868995 0 1.6114 1825 | 0/18
50 h-m-p 1.6000 8.0000 0.0001 C 1261.868942 0 2.5122 1864 | 0/18
51 h-m-p 1.6000 8.0000 0.0001 C 1261.868922 0 1.5577 1903 | 0/18
52 h-m-p 1.6000 8.0000 0.0000 C 1261.868917 0 2.3940 1942 | 0/18
53 h-m-p 1.6000 8.0000 0.0000 C 1261.868916 0 1.3754 1981 | 0/18
54 h-m-p 1.6000 8.0000 0.0000 C 1261.868916 0 1.6667 2020 | 0/18
55 h-m-p 1.6000 8.0000 0.0000 Y 1261.868916 0 1.1334 2059 | 0/18
56 h-m-p 1.6000 8.0000 0.0000 -C 1261.868916 0 0.1000 2099 | 0/18
57 h-m-p 0.3845 8.0000 0.0000 ----------Y 1261.868916 0 0.0000 2148
Out..
lnL = -1261.868916
2149 lfun, 2149 eigenQcodon, 34384 P(t)
Time used: 0:10
Model 1: NearlyNeutral
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
0.004959 0.003779 0.010098 0.008404 0.005970 0.003890 0.005440 0.012982 0.011910 0.009971 0.019866 0.028055 0.042229 0.065951 0.024900 0.055881 1.799958 0.816750 0.136540
ntime & nrate & np: 16 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.423923
np = 19
lnL0 = -1274.892019
Iterating by ming2
Initial: fx= 1274.892019
x= 0.00496 0.00378 0.01010 0.00840 0.00597 0.00389 0.00544 0.01298 0.01191 0.00997 0.01987 0.02806 0.04223 0.06595 0.02490 0.05588 1.79996 0.81675 0.13654
1 h-m-p 0.0000 0.0004 212.6555 +YCCCC 1273.374964 4 0.0001 32 | 0/19
2 h-m-p 0.0000 0.0002 229.8044 +YYCCCC 1270.754190 5 0.0001 63 | 0/19
3 h-m-p 0.0000 0.0002 459.8907 +YYCYCCC 1264.417758 6 0.0002 95 | 0/19
4 h-m-p 0.0000 0.0000 19510.4581 +YYCCC 1262.316327 4 0.0000 124 | 0/19
5 h-m-p 0.0000 0.0000 4353.8167 +CYCC 1261.037077 3 0.0000 152 | 0/19
6 h-m-p 0.0000 0.0002 78.4860 CCCC 1260.905194 3 0.0001 180 | 0/19
7 h-m-p 0.0001 0.0008 36.3976 CC 1260.855823 1 0.0001 204 | 0/19
8 h-m-p 0.0001 0.0012 50.6146 +YCC 1260.739897 2 0.0002 230 | 0/19
9 h-m-p 0.0001 0.0006 59.8778 YYC 1260.694371 2 0.0001 254 | 0/19
10 h-m-p 0.0001 0.0015 43.2417 YCC 1260.631540 2 0.0002 279 | 0/19
11 h-m-p 0.0003 0.0014 13.7408 CC 1260.625103 1 0.0001 303 | 0/19
12 h-m-p 0.0001 0.0096 13.5954 +YC 1260.608029 1 0.0003 327 | 0/19
13 h-m-p 0.0004 0.0068 10.0985 CC 1260.602974 1 0.0002 351 | 0/19
14 h-m-p 0.0002 0.0150 6.6056 CY 1260.597779 1 0.0003 375 | 0/19
15 h-m-p 0.0001 0.0052 17.7593 +CC 1260.578007 1 0.0004 400 | 0/19
16 h-m-p 0.0003 0.0187 23.2580 ++YC 1260.377678 1 0.0027 425 | 0/19
17 h-m-p 0.0006 0.0124 103.9950 +CCCCC 1258.840066 4 0.0043 456 | 0/19
18 h-m-p 0.0002 0.0012 455.7645 CCCCC 1258.387071 4 0.0003 486 | 0/19
19 h-m-p 0.0031 0.0153 7.6690 -CC 1258.381694 1 0.0003 511 | 0/19
20 h-m-p 0.0054 2.6807 0.8227 +++YCCCC 1256.571594 4 0.7706 543 | 0/19
21 h-m-p 0.4016 2.0081 0.0364 CCCCC 1256.154444 4 0.5663 592 | 0/19
22 h-m-p 0.2175 6.8819 0.0946 +CCC 1256.029444 2 1.0155 638 | 0/19
23 h-m-p 1.6000 8.0000 0.0181 CC 1255.906718 1 1.4409 681 | 0/19
24 h-m-p 1.6000 8.0000 0.0037 YCCC 1255.849069 3 0.9619 727 | 0/19
25 h-m-p 0.1569 8.0000 0.0226 +CC 1255.838777 1 0.8899 771 | 0/19
26 h-m-p 1.6000 8.0000 0.0105 YC 1255.836163 1 1.0281 813 | 0/19
27 h-m-p 1.6000 8.0000 0.0024 C 1255.834243 0 1.6944 854 | 0/19
28 h-m-p 1.1376 8.0000 0.0036 +CC 1255.828992 1 4.1161 898 | 0/19
29 h-m-p 1.6000 8.0000 0.0061 YC 1255.827428 1 0.8325 940 | 0/19
30 h-m-p 0.6530 8.0000 0.0078 C 1255.827266 0 0.6861 981 | 0/19
31 h-m-p 1.6000 8.0000 0.0008 Y 1255.827241 0 0.6632 1022 | 0/19
32 h-m-p 1.6000 8.0000 0.0002 Y 1255.827239 0 0.6550 1063 | 0/19
33 h-m-p 1.6000 8.0000 0.0000 Y 1255.827239 0 0.9798 1104 | 0/19
34 h-m-p 1.6000 8.0000 0.0000 Y 1255.827239 0 0.7112 1145 | 0/19
35 h-m-p 1.6000 8.0000 0.0000 -Y 1255.827239 0 0.1000 1187 | 0/19
36 h-m-p 0.1014 8.0000 0.0000 -C 1255.827239 0 0.0063 1229
Out..
lnL = -1255.827239
1230 lfun, 3690 eigenQcodon, 39360 P(t)
Time used: 0:21
Model 2: PositiveSelection
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
initial w for M2:NSpselection reset.
0.004959 0.003779 0.010098 0.008404 0.005970 0.003890 0.005440 0.012982 0.011910 0.009971 0.019866 0.028055 0.042229 0.065951 0.024900 0.055881 1.907237 1.098208 0.580294 0.458835 2.948231
ntime & nrate & np: 16 3 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.211976
np = 21
lnL0 = -1316.607053
Iterating by ming2
Initial: fx= 1316.607053
x= 0.00496 0.00378 0.01010 0.00840 0.00597 0.00389 0.00544 0.01298 0.01191 0.00997 0.01987 0.02806 0.04223 0.06595 0.02490 0.05588 1.90724 1.09821 0.58029 0.45883 2.94823
1 h-m-p 0.0000 0.0008 205.3481 +YYCCC 1315.588175 4 0.0001 33 | 0/21
2 h-m-p 0.0000 0.0002 129.8332 YCCCC 1315.041990 4 0.0001 64 | 0/21
3 h-m-p 0.0001 0.0007 75.6478 CCCC 1314.622260 3 0.0002 94 | 0/21
4 h-m-p 0.0001 0.0005 166.1746 CCC 1314.347269 2 0.0001 122 | 0/21
5 h-m-p 0.0001 0.0004 131.0259 YCCCC 1313.927389 4 0.0002 153 | 0/21
6 h-m-p 0.0001 0.0005 258.7712 YCCC 1313.036833 3 0.0002 182 | 0/21
7 h-m-p 0.0000 0.0002 795.6727 YCCCC 1311.739291 4 0.0001 213 | 0/21
8 h-m-p 0.0000 0.0002 1084.5424 +YYYCYCYC 1307.586081 7 0.0001 247 | 0/21
9 h-m-p 0.0000 0.0000 23368.6056 ++ 1300.812867 m 0.0000 271 | 1/21
10 h-m-p 0.0001 0.0005 1065.3793 YYCC 1300.586094 3 0.0000 299 | 1/21
11 h-m-p 0.0001 0.0007 23.5576 CCCC 1300.506727 3 0.0002 329 | 1/21
12 h-m-p 0.0001 0.0020 34.3864 CCC 1300.428364 2 0.0002 357 | 1/21
13 h-m-p 0.0001 0.0105 61.4182 +++YYYCCC 1297.043796 5 0.0055 391 | 1/21
14 h-m-p 0.0000 0.0002 1050.6021 YCYCCC 1295.916040 5 0.0001 423 | 1/21
15 h-m-p 0.0003 0.0013 160.0248 CYC 1295.822765 2 0.0001 450 | 1/21
16 h-m-p 0.0002 0.0014 66.8285 YCC 1295.772836 2 0.0001 477 | 1/21
17 h-m-p 0.0002 0.0068 29.9317 +YYC 1295.599768 2 0.0009 504 | 1/21
18 h-m-p 0.0005 0.0033 48.6081 CCCC 1295.393807 3 0.0007 534 | 1/21
19 h-m-p 0.0004 0.0503 87.2148 +++CYCCC 1279.662850 4 0.0310 568 | 1/21
20 h-m-p 0.1072 0.5361 3.7148 +CYC 1269.731566 2 0.4366 596 | 1/21
21 h-m-p 0.0290 0.1451 1.3762 ++ 1268.268691 m 0.1451 620 | 2/21
22 h-m-p 0.0447 0.9666 3.4855 ++YYCCCC 1262.875439 5 0.5743 654 | 2/21
23 h-m-p 0.1731 0.8654 3.0600 CYCCCC 1260.650873 5 0.3085 687 | 2/21
24 h-m-p 1.1455 8.0000 0.8240 YCCCC 1259.007639 4 0.6785 718 | 2/21
25 h-m-p 0.6177 3.0884 0.2880 YCCCC 1257.874343 4 1.4158 768 | 1/21
26 h-m-p 0.0003 0.0013 375.2687 YCCC 1257.769650 3 0.0001 816 | 1/21
27 h-m-p 0.1931 8.0000 0.2174 +CYCC 1257.094353 3 0.9427 846 | 1/21
28 h-m-p 0.6778 8.0000 0.3024 YCCC 1256.446823 3 1.4734 895 | 1/21
29 h-m-p 0.7778 3.8892 0.1455 CCCC 1256.128364 3 1.3961 945 | 1/21
30 h-m-p 1.0765 6.1956 0.1887 YCCC 1255.996757 3 0.7359 994 | 1/21
31 h-m-p 0.9482 8.0000 0.1464 CCC 1255.926032 2 1.2135 1042 | 1/21
32 h-m-p 1.4369 8.0000 0.1237 C 1255.882498 0 1.4369 1086 | 1/21
33 h-m-p 1.4242 7.1211 0.0475 C 1255.869857 0 1.5058 1130 | 1/21
34 h-m-p 1.6000 8.0000 0.0117 C 1255.863213 0 1.5492 1174 | 1/21
35 h-m-p 1.6000 8.0000 0.0092 CC 1255.854079 1 2.0855 1220 | 1/21
36 h-m-p 1.6000 8.0000 0.0025 CCC 1255.841850 2 2.0594 1268 | 1/21
37 h-m-p 0.2682 8.0000 0.0189 +YC 1255.829145 1 2.5981 1314 | 1/21
38 h-m-p 1.6000 8.0000 0.0071 YC 1255.827362 1 1.0997 1359 | 1/21
39 h-m-p 1.6000 8.0000 0.0024 YC 1255.827243 1 1.0378 1404 | 1/21
40 h-m-p 1.6000 8.0000 0.0003 Y 1255.827239 0 1.1929 1448 | 1/21
41 h-m-p 1.6000 8.0000 0.0001 C 1255.827239 0 1.2945 1492 | 1/21
42 h-m-p 1.6000 8.0000 0.0000 Y 1255.827239 0 1.2612 1536 | 1/21
43 h-m-p 1.6000 8.0000 0.0000 C 1255.827239 0 1.6000 1580 | 1/21
44 h-m-p 1.6000 8.0000 0.0000 ------Y 1255.827239 0 0.0001 1630
Out..
lnL = -1255.827239
1631 lfun, 6524 eigenQcodon, 78288 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1268.005252 S = -1226.338767 -32.836649
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 94 patterns 0:43
did 20 / 94 patterns 0:43
did 30 / 94 patterns 0:43
did 40 / 94 patterns 0:43
did 50 / 94 patterns 0:43
did 60 / 94 patterns 0:44
did 70 / 94 patterns 0:44
did 80 / 94 patterns 0:44
did 90 / 94 patterns 0:44
did 94 / 94 patterns 0:44
Time used: 0:44
Model 3: discrete
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
0.004959 0.003779 0.010098 0.008404 0.005970 0.003890 0.005440 0.012982 0.011910 0.009971 0.019866 0.028055 0.042229 0.065951 0.024900 0.055881 1.907238 0.923969 0.634343 0.032409 0.081105 0.113291
ntime & nrate & np: 16 4 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 17.524134
np = 22
lnL0 = -1261.859118
Iterating by ming2
Initial: fx= 1261.859118
x= 0.00496 0.00378 0.01010 0.00840 0.00597 0.00389 0.00544 0.01298 0.01191 0.00997 0.01987 0.02806 0.04223 0.06595 0.02490 0.05588 1.90724 0.92397 0.63434 0.03241 0.08111 0.11329
1 h-m-p 0.0000 0.0002 158.1757 +CYC 1261.338691 2 0.0000 31 | 0/22
2 h-m-p 0.0000 0.0002 109.2685 CCCC 1261.079020 3 0.0001 62 | 0/22
3 h-m-p 0.0001 0.0005 59.6476 CCCC 1260.849881 3 0.0002 93 | 0/22
4 h-m-p 0.0000 0.0001 253.8345 +YCCC 1260.550043 3 0.0001 124 | 0/22
5 h-m-p 0.0000 0.0000 328.1649 ++ 1260.205371 m 0.0000 149 | 1/22
6 h-m-p 0.0004 0.0105 11.7902 YCC 1260.064063 2 0.0009 177 | 1/22
7 h-m-p 0.0001 0.0005 54.8464 CCC 1259.915859 2 0.0001 206 | 1/22
8 h-m-p 0.0001 0.0004 87.7970 CCC 1259.709597 2 0.0001 235 | 1/22
9 h-m-p 0.0001 0.0005 49.8712 YYC 1259.645299 2 0.0001 262 | 1/22
10 h-m-p 0.0001 0.0007 37.2774 YYC 1259.615887 2 0.0001 289 | 1/22
11 h-m-p 0.0000 0.0010 65.2896 CCC 1259.588592 2 0.0001 318 | 1/22
12 h-m-p 0.0001 0.0059 33.3129 +CCC 1259.530893 2 0.0004 348 | 1/22
13 h-m-p 0.0001 0.0004 174.8753 YCC 1259.496364 2 0.0000 376 | 1/22
14 h-m-p 0.0001 0.0010 69.6763 CYC 1259.465545 2 0.0001 404 | 1/22
15 h-m-p 0.0001 0.0041 77.2199 YCC 1259.410413 2 0.0002 432 | 1/22
16 h-m-p 0.0002 0.0035 89.3379 +YCCCC 1258.687766 4 0.0016 465 | 1/22
17 h-m-p 0.0000 0.0001 1536.5028 ++ 1257.942070 m 0.0001 490 | 2/22
18 h-m-p 0.0006 0.0031 127.0704 CC 1257.910573 1 0.0001 517 | 2/22
19 h-m-p 0.0019 0.0095 8.2963 YC 1257.901841 1 0.0003 543 | 2/22
20 h-m-p 0.0028 1.4186 3.4482 +++CCC 1256.602437 2 0.1845 575 | 2/22
21 h-m-p 1.2870 6.4352 0.3676 CCC 1255.709703 2 1.3372 604 | 2/22
22 h-m-p 0.6135 3.0676 0.7365 YCCC 1255.572995 3 0.2902 654 | 2/22
23 h-m-p 1.3731 6.8654 0.0795 YC 1255.494973 1 0.6907 700 | 2/22
24 h-m-p 0.1881 8.0000 0.2918 YC 1255.473793 1 0.3881 746 | 2/22
25 h-m-p 1.6000 8.0000 0.0319 YC 1255.463990 1 1.1959 792 | 2/22
26 h-m-p 1.6000 8.0000 0.0165 CC 1255.462667 1 1.3075 839 | 2/22
27 h-m-p 1.6000 8.0000 0.0020 YC 1255.462564 1 1.1058 885 | 2/22
28 h-m-p 1.6000 8.0000 0.0008 Y 1255.462558 0 0.9838 930 | 2/22
29 h-m-p 1.6000 8.0000 0.0002 Y 1255.462558 0 1.1695 975 | 2/22
30 h-m-p 1.6000 8.0000 0.0000 Y 1255.462558 0 0.7068 1020 | 2/22
31 h-m-p 1.6000 8.0000 0.0000 -Y 1255.462558 0 0.1992 1066 | 2/22
32 h-m-p 0.3243 8.0000 0.0000 C 1255.462558 0 0.3243 1111 | 2/22
33 h-m-p 0.3493 8.0000 0.0000 --------------C 1255.462558 0 0.0000 1170
Out..
lnL = -1255.462558
1171 lfun, 4684 eigenQcodon, 56208 P(t)
Time used: 0:59
Model 7: beta
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
0.004959 0.003779 0.010098 0.008404 0.005970 0.003890 0.005440 0.012982 0.011910 0.009971 0.019866 0.028055 0.042229 0.065951 0.024900 0.055881 1.841129 1.091300 1.180709
ntime & nrate & np: 16 1 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.674208
np = 19
lnL0 = -1290.564676
Iterating by ming2
Initial: fx= 1290.564676
x= 0.00496 0.00378 0.01010 0.00840 0.00597 0.00389 0.00544 0.01298 0.01191 0.00997 0.01987 0.02806 0.04223 0.06595 0.02490 0.05588 1.84113 1.09130 1.18071
1 h-m-p 0.0000 0.0003 168.2985 +CYC 1289.971459 2 0.0000 28 | 0/19
2 h-m-p 0.0000 0.0002 106.6494 CCCC 1289.709200 3 0.0001 56 | 0/19
3 h-m-p 0.0001 0.0007 47.6038 CCCC 1289.567028 3 0.0002 84 | 0/19
4 h-m-p 0.0001 0.0011 116.4738 CYC 1289.472590 2 0.0001 109 | 0/19
5 h-m-p 0.0001 0.0009 93.2045 YCCC 1289.302844 3 0.0001 136 | 0/19
6 h-m-p 0.0001 0.0015 147.8700 YCCC 1288.976201 3 0.0002 163 | 0/19
7 h-m-p 0.0001 0.0003 346.4046 CCCC 1288.553364 3 0.0001 191 | 0/19
8 h-m-p 0.0001 0.0003 423.4521 YCYCCC 1287.614397 5 0.0002 221 | 0/19
9 h-m-p 0.0000 0.0003 3369.8921 +CYYYCCC 1280.137216 6 0.0002 253 | 0/19
10 h-m-p 0.0000 0.0001 9326.8298 +YCYCCC 1272.690756 5 0.0000 285 | 0/19
11 h-m-p 0.0000 0.0000 10702.3625 CYCCCC 1271.261081 5 0.0000 316 | 0/19
12 h-m-p 0.0001 0.0005 53.2026 YYC 1271.222205 2 0.0001 340 | 0/19
13 h-m-p 0.0001 0.0019 58.2743 YC 1271.156645 1 0.0001 363 | 0/19
14 h-m-p 0.0002 0.0025 43.3286 YCC 1271.072440 2 0.0003 388 | 0/19
15 h-m-p 0.0001 0.0007 102.7706 YCCCC 1270.878834 4 0.0002 417 | 0/19
16 h-m-p 0.0000 0.0006 1375.4848 ++CYCCC 1267.163939 4 0.0004 448 | 0/19
17 h-m-p 0.0001 0.0003 3501.4544 CCC 1265.466622 2 0.0001 474 | 0/19
18 h-m-p 0.0003 0.0014 780.9744 CYCCC 1264.437719 4 0.0002 503 | 0/19
19 h-m-p 0.1396 2.2813 1.2202 +YCYCCCC 1260.602775 6 0.8130 536 | 0/19
20 h-m-p 0.5939 2.9694 1.2662 YCC 1259.465558 2 0.4009 561 | 0/19
21 h-m-p 0.7400 3.6998 0.1687 CCCCC 1258.491842 4 0.9178 591 | 0/19
22 h-m-p 0.8808 8.0000 0.1758 YCC 1258.119793 2 1.4992 635 | 0/19
23 h-m-p 1.6000 8.0000 0.0280 CCC 1257.916774 2 1.4391 680 | 0/19
24 h-m-p 1.3107 8.0000 0.0308 CC 1257.816201 1 1.3197 723 | 0/19
25 h-m-p 0.7818 8.0000 0.0519 +YC 1257.754507 1 2.4124 766 | 0/19
26 h-m-p 0.6256 8.0000 0.2002 +YCCC 1257.503454 3 4.4595 813 | 0/19
27 h-m-p 0.4925 2.4627 1.0603 +YYCYCCC 1256.685923 6 1.6830 865 | 0/19
28 h-m-p 0.0169 0.0843 9.8121 CYCCC 1256.598541 4 0.0250 894 | 0/19
29 h-m-p 0.0516 0.2578 1.8246 +YYYYYYYYCY 1256.028079 10 0.2321 928 | 0/19
30 h-m-p 0.0470 0.2352 0.2038 YYCC 1256.010251 3 0.0340 954 | 0/19
31 h-m-p 0.0130 1.0768 0.5317 ++YCCC 1255.623882 3 0.1633 1002 | 0/19
32 h-m-p 1.6000 8.0000 0.0180 CC 1255.523281 1 2.2337 1045 | 0/19
33 h-m-p 0.8317 4.1586 0.0404 CC 1255.482916 1 1.3045 1088 | 0/19
34 h-m-p 1.1398 8.0000 0.0462 YCC 1255.474582 2 0.7399 1132 | 0/19
35 h-m-p 1.6000 8.0000 0.0069 YC 1255.472011 1 1.1564 1174 | 0/19
36 h-m-p 1.6000 8.0000 0.0022 C 1255.471691 0 1.3748 1215 | 0/19
37 h-m-p 1.6000 8.0000 0.0006 C 1255.471635 0 1.7028 1256 | 0/19
38 h-m-p 1.1921 8.0000 0.0008 ++ 1255.471547 m 8.0000 1297 | 0/19
39 h-m-p 1.6000 8.0000 0.0025 YC 1255.471407 1 3.5283 1339 | 0/19
40 h-m-p 1.6000 8.0000 0.0018 C 1255.471356 0 1.8475 1380 | 0/19
41 h-m-p 1.6000 8.0000 0.0006 C 1255.471344 0 1.4684 1421 | 0/19
42 h-m-p 1.0882 8.0000 0.0008 +C 1255.471324 0 4.3696 1463 | 0/19
43 h-m-p 1.2751 8.0000 0.0026 -----------C 1255.471324 0 0.0000 1515 | 0/19
44 h-m-p 0.0160 8.0000 0.0012 ++C 1255.471314 0 0.3034 1558 | 0/19
45 h-m-p 1.6000 8.0000 0.0000 Y 1255.471314 0 0.3023 1599 | 0/19
46 h-m-p 1.6000 8.0000 0.0000 C 1255.471314 0 0.4669 1640 | 0/19
47 h-m-p 0.3062 8.0000 0.0000 C 1255.471314 0 0.2951 1681 | 0/19
48 h-m-p 0.3626 8.0000 0.0000 Y 1255.471314 0 0.2267 1722 | 0/19
49 h-m-p 0.2248 8.0000 0.0000 Y 1255.471314 0 0.5098 1763 | 0/19
50 h-m-p 1.0584 8.0000 0.0000 C 1255.471314 0 1.4983 1804 | 0/19
51 h-m-p 1.6000 8.0000 0.0000 C 1255.471314 0 1.6000 1845 | 0/19
52 h-m-p 1.5395 8.0000 0.0000 C 1255.471314 0 1.3591 1886 | 0/19
53 h-m-p 1.6000 8.0000 0.0000 C 1255.471314 0 1.6000 1927 | 0/19
54 h-m-p 1.3637 8.0000 0.0000 Y 1255.471314 0 0.7266 1968 | 0/19
55 h-m-p 1.6000 8.0000 0.0000 ++ 1255.471314 m 8.0000 2009 | 0/19
56 h-m-p 0.1172 8.0000 0.0000 --C 1255.471314 0 0.0018 2052
Out..
lnL = -1255.471314
2053 lfun, 22583 eigenQcodon, 328480 P(t)
Time used: 2:31
Model 8: beta&w>1
TREE # 1
(1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
initial w for M8:NSbetaw>1 reset.
0.004959 0.003779 0.010098 0.008404 0.005970 0.003890 0.005440 0.012982 0.011910 0.009971 0.019866 0.028055 0.042229 0.065951 0.024900 0.055881 1.842980 0.900000 0.318342 1.765725 2.851152
ntime & nrate & np: 16 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.368142
np = 21
lnL0 = -1278.072970
Iterating by ming2
Initial: fx= 1278.072970
x= 0.00496 0.00378 0.01010 0.00840 0.00597 0.00389 0.00544 0.01298 0.01191 0.00997 0.01987 0.02806 0.04223 0.06595 0.02490 0.05588 1.84298 0.90000 0.31834 1.76572 2.85115
1 h-m-p 0.0000 0.0006 316.8808 ++CYCCC 1273.337993 4 0.0001 35 | 0/21
2 h-m-p 0.0001 0.0003 270.8140 +YYYCCC 1267.592605 5 0.0002 67 | 0/21
3 h-m-p 0.0000 0.0001 605.0017 YCCC 1266.623814 3 0.0000 96 | 0/21
4 h-m-p 0.0000 0.0001 377.5017 +YC 1264.906772 1 0.0001 122 | 0/21
5 h-m-p 0.0000 0.0000 173.5227 ++ 1264.599348 m 0.0000 146 | 0/21
6 h-m-p 0.0000 0.0000 129.0785
h-m-p: 0.00000000e+00 0.00000000e+00 1.29078458e+02 1264.599348
.. | 0/21
7 h-m-p 0.0000 0.0001 188.0799 +CYYCCC 1263.196632 5 0.0001 200 | 0/21
8 h-m-p 0.0000 0.0000 315.4481 ++ 1262.238627 m 0.0000 224 | 1/21
9 h-m-p 0.0000 0.0002 116.5610 CCCC 1262.032612 3 0.0000 254 | 1/21
10 h-m-p 0.0000 0.0003 202.6015 +YCC 1261.546627 2 0.0001 282 | 1/21
11 h-m-p 0.0000 0.0001 325.9367 CCC 1261.330668 2 0.0000 310 | 1/21
12 h-m-p 0.0000 0.0002 172.3365 YCCCC 1261.020561 4 0.0001 341 | 1/21
13 h-m-p 0.0001 0.0009 107.3168 YCCC 1260.488698 3 0.0003 370 | 1/21
14 h-m-p 0.0000 0.0002 346.3638 YCCCC 1259.970910 4 0.0001 401 | 1/21
15 h-m-p 0.0000 0.0001 732.7267 CCCC 1259.662566 3 0.0000 431 | 1/21
16 h-m-p 0.0001 0.0007 275.9102 +YYYYCCCCCC 1258.043111 9 0.0003 470 | 1/21
17 h-m-p 0.0007 0.0034 37.1952 YCCC 1258.007110 3 0.0001 499 | 1/21
18 h-m-p 0.0001 0.0013 33.7056 CCC 1257.975567 2 0.0001 527 | 1/21
19 h-m-p 0.0014 0.0200 2.6507 CC 1257.972124 1 0.0003 553 | 1/21
20 h-m-p 0.0002 0.0031 4.7072 YC 1257.970170 1 0.0001 578 | 1/21
21 h-m-p 0.0002 0.0876 2.7223 YC 1257.967634 1 0.0003 603 | 1/21
22 h-m-p 0.0006 0.0561 1.4366 CC 1257.964993 1 0.0008 629 | 1/21
23 h-m-p 0.0004 0.1219 2.6854 +++YC 1257.792728 1 0.0180 657 | 1/21
24 h-m-p 0.0003 0.0026 171.4518 +YYCC 1257.191295 3 0.0009 686 | 1/21
25 h-m-p 0.0003 0.0014 180.7478 YYC 1257.062269 2 0.0002 712 | 1/21
26 h-m-p 0.0502 1.7155 0.7059 +YCCCC 1256.846677 4 0.4298 744 | 1/21
27 h-m-p 0.4101 2.0629 0.7399 CYCCC 1256.660180 4 0.6027 795 | 1/21
28 h-m-p 0.2428 1.2139 1.1117 +YYCYCCC 1255.730704 6 0.8162 849 | 1/21
29 h-m-p 0.0418 0.2092 2.0200 CYY 1255.699672 2 0.0405 876 | 1/21
30 h-m-p 0.1172 0.5860 0.5237 YCYCYC 1255.568327 5 0.2147 907 | 1/21
31 h-m-p 1.6000 8.0000 0.0230 YCC 1255.509617 2 0.6702 954 | 1/21
32 h-m-p 0.2568 2.7750 0.0599 YCYC 1255.486440 3 0.6900 1002 | 1/21
33 h-m-p 1.6000 8.0000 0.0238 YC 1255.475528 1 0.7339 1047 | 1/21
34 h-m-p 0.8316 6.1918 0.0210 YY 1255.473418 1 0.8316 1092 | 1/21
35 h-m-p 1.6000 8.0000 0.0067 YC 1255.472817 1 1.0940 1137 | 1/21
36 h-m-p 0.7394 8.0000 0.0099 CC 1255.472476 1 1.2175 1183 | 1/21
37 h-m-p 1.6000 8.0000 0.0062 CC 1255.472211 1 2.3077 1229 | 1/21
38 h-m-p 1.6000 8.0000 0.0028 Y 1255.472119 0 1.2067 1273 | 1/21
39 h-m-p 0.5795 8.0000 0.0057 C 1255.472070 0 0.7208 1317 | 1/21
40 h-m-p 1.6000 8.0000 0.0006 Y 1255.472056 0 1.0681 1361 | 1/21
41 h-m-p 0.4559 8.0000 0.0015 ++Y 1255.472011 0 5.8766 1407 | 1/21
42 h-m-p 1.4577 8.0000 0.0059 -Y 1255.472011 0 0.0550 1452 | 1/21
43 h-m-p 0.0698 8.0000 0.0047 Y 1255.472011 0 0.1653 1496 | 1/21
44 h-m-p 0.1776 8.0000 0.0044 ---------Y 1255.472011 0 0.0000 1549 | 1/21
45 h-m-p 0.0160 8.0000 0.0013 +++Y 1255.471997 0 0.7399 1596 | 1/21
46 h-m-p 1.6000 8.0000 0.0004 Y 1255.471996 0 0.6637 1640 | 1/21
47 h-m-p 0.4815 8.0000 0.0006 +C 1255.471995 0 1.8643 1685 | 1/21
48 h-m-p 1.6000 8.0000 0.0002 C 1255.471995 0 1.8387 1729 | 1/21
49 h-m-p 0.4011 8.0000 0.0011 +++ 1255.471989 m 8.0000 1774 | 1/21
50 h-m-p 0.1156 8.0000 0.0779 ++CY 1255.471887 1 3.4535 1822 | 1/21
51 h-m-p 1.6000 8.0000 0.1135 C 1255.471882 0 0.3298 1866 | 1/21
52 h-m-p 1.3957 8.0000 0.0268 Y 1255.471864 0 1.0389 1910 | 1/21
53 h-m-p 0.6504 8.0000 0.0429 +Y 1255.471804 0 4.5284 1955 | 1/21
54 h-m-p 1.6000 8.0000 0.0528 YC 1255.471785 1 0.8903 2000 | 1/21
55 h-m-p 1.6000 8.0000 0.0224 +Y 1255.471735 0 4.6431 2045 | 1/21
56 h-m-p 1.3163 8.0000 0.0790 -------Y 1255.471735 0 0.0000 2096 | 1/21
57 h-m-p 0.0160 8.0000 5.1961 -------------.. | 1/21
58 h-m-p 0.0000 0.0097 3.0126 Y 1255.471719 0 0.0000 2175 | 1/21
59 h-m-p 0.0000 0.0115 0.5102 C 1255.471716 0 0.0000 2199 | 1/21
60 h-m-p 0.0004 0.1877 0.1898 Y 1255.471715 0 0.0001 2243 | 1/21
61 h-m-p 0.0002 0.0993 0.1767 C 1255.471715 0 0.0000 2287 | 1/21
62 h-m-p 0.0007 0.3295 0.0640 -C 1255.471714 0 0.0000 2332 | 1/21
63 h-m-p 0.0018 0.9093 0.0423 --Y 1255.471714 0 0.0001 2378 | 1/21
64 h-m-p 0.0013 0.6706 0.0617 -Y 1255.471714 0 0.0000 2423 | 1/21
65 h-m-p 0.0042 2.1125 0.0467 --C 1255.471714 0 0.0001 2469 | 1/21
66 h-m-p 0.0016 0.7753 0.0747 --C 1255.471714 0 0.0000 2515 | 1/21
67 h-m-p 0.0005 0.2445 0.3179 --C 1255.471714 0 0.0000 2561 | 1/21
68 h-m-p 0.0006 0.3206 0.5907 --Y 1255.471714 0 0.0000 2607 | 1/21
69 h-m-p 0.0005 0.2399 0.6355 --Y 1255.471714 0 0.0000 2653 | 1/21
70 h-m-p 0.0044 2.2225 0.0498 --Y 1255.471714 0 0.0000 2699 | 1/21
71 h-m-p 0.0007 0.3481 0.0807 --C 1255.471714 0 0.0000 2745 | 1/21
72 h-m-p 0.0029 1.4304 0.0508 --Y 1255.471714 0 0.0000 2791 | 1/21
73 h-m-p 0.0052 2.6174 0.0342 --Y 1255.471714 0 0.0002 2837 | 1/21
74 h-m-p 0.0156 7.8053 0.0324 -C 1255.471714 0 0.0012 2882 | 1/21
75 h-m-p 0.0160 8.0000 0.1662 Y 1255.471708 0 0.0097 2926 | 1/21
76 h-m-p 0.0015 0.2959 1.0585 -C 1255.471707 0 0.0001 2971 | 1/21
77 h-m-p 0.1807 8.0000 0.0008 C 1255.471707 0 0.0379 2995 | 1/21
78 h-m-p 0.0562 8.0000 0.0005 ++++ 1255.471706 m 8.0000 3041 | 1/21
79 h-m-p 0.7126 8.0000 0.0057 ++ 1255.471696 m 8.0000 3085 | 1/21
80 h-m-p 0.3333 8.0000 0.1377 +Y 1255.471642 0 2.4057 3130 | 1/21
81 h-m-p 0.4883 2.4414 0.4024 +C 1255.471506 0 1.9531 3175 | 1/21
82 h-m-p 0.0735 0.3674 0.5347 ++ 1255.471431 m 0.3674 3219 | 1/21
83 h-m-p 0.0000 0.0001 15585.9881 -Y 1255.471362 0 0.0000 3264 | 1/21
84 h-m-p 1.6000 8.0000 0.0038 C 1255.471276 0 1.5809 3288 | 1/21
85 h-m-p 1.6000 8.0000 0.0018 C 1255.471275 0 0.3897 3332 | 1/21
86 h-m-p 0.1882 8.0000 0.0037 --------------C 1255.471275 0 0.0000 3390 | 1/21
87 h-m-p 0.0160 8.0000 0.0012 ++Y 1255.471274 0 0.4178 3436 | 1/21
88 h-m-p 1.4832 8.0000 0.0003 C 1255.471274 0 0.4801 3480 | 1/21
89 h-m-p 0.9717 8.0000 0.0002 Y 1255.471274 0 0.4268 3524 | 1/21
90 h-m-p 0.6247 8.0000 0.0001 Y 1255.471274 0 0.4770 3568 | 1/21
91 h-m-p 0.5686 8.0000 0.0001 C 1255.471273 0 0.6867 3612 | 1/21
92 h-m-p 0.7562 8.0000 0.0001 Y 1255.471273 0 1.2109 3656 | 1/21
93 h-m-p 1.3132 8.0000 0.0001 Y 1255.471272 0 2.8729 3700 | 1/21
94 h-m-p 1.6000 8.0000 0.0001 ++ 1255.471257 m 8.0000 3744 | 1/21
95 h-m-p 1.6000 8.0000 0.0002 +YC 1255.471174 1 4.5803 3790 | 1/21
96 h-m-p 1.2051 8.0000 0.0008 YC 1255.471091 1 2.3292 3835 | 1/21
97 h-m-p 1.6000 8.0000 0.0002 C 1255.471088 0 2.4979 3879 | 1/21
98 h-m-p 1.6000 8.0000 0.0002 -C 1255.471088 0 0.1156 3924 | 1/21
99 h-m-p 0.1362 8.0000 0.0002 C 1255.471088 0 0.0292 3968 | 1/21
100 h-m-p 0.0299 8.0000 0.0002 --------------.. | 1/21
101 h-m-p 0.0002 0.0947 0.3929 --C 1255.471088 0 0.0000 4070 | 1/21
102 h-m-p 0.0002 0.1228 0.0783 Y 1255.471088 0 0.0000 4114 | 1/21
103 h-m-p 0.0007 0.3347 0.0688 -C 1255.471088 0 0.0001 4159 | 1/21
104 h-m-p 0.0010 0.4846 0.0146 -C 1255.471088 0 0.0001 4204 | 1/21
105 h-m-p 0.0008 0.3781 0.0096 -----------.. | 1/21
106 h-m-p 0.0022 1.1065 0.1571 ------------ | 1/21
107 h-m-p 0.0022 1.1065 0.1571 ------------
Out..
lnL = -1255.471088
4366 lfun, 52392 eigenQcodon, 768416 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1270.127289 S = -1226.717361 -35.210860
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 94 patterns 6:07
did 20 / 94 patterns 6:07
did 30 / 94 patterns 6:07
did 40 / 94 patterns 6:07
did 50 / 94 patterns 6:08
did 60 / 94 patterns 6:08
did 70 / 94 patterns 6:08
did 80 / 94 patterns 6:08
did 90 / 94 patterns 6:08
did 94 / 94 patterns 6:08
Time used: 6:08
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=215
D_melanogaster_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_sechellia_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_simulans_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_yakuba_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_erecta_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_biarmipes_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_suzukii_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
D_eugracilis_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_ficusphila_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_elegans_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_takahashii_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
************************************************:*
D_melanogaster_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_sechellia_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_simulans_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_yakuba_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_erecta_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_biarmipes_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_suzukii_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_eugracilis_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_ficusphila_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
D_elegans_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_takahashii_Zasp66-PI YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
**************************************:***********
D_melanogaster_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
D_sechellia_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
D_simulans_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
D_yakuba_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
D_erecta_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
D_biarmipes_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
D_suzukii_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ
D_eugracilis_Zasp66-PI NSPIGLYSNSNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSSYGQ
D_ficusphila_Zasp66-PI NSPIGLYSNHNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ
D_elegans_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGN
D_takahashii_Zasp66-PI NSPIGLYSNNNIEDTIRSTVPYKQTVQYDPRNSDTYRAIQEEGGYSNYGQ
********* *************:*********:************.**:
D_melanogaster_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_sechellia_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_simulans_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_yakuba_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_erecta_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_biarmipes_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_suzukii_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPASAPVSRPPYNVVNTHDENIRQSG
D_eugracilis_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_ficusphila_Zasp66-PI SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_elegans_Zasp66-PI AAPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
D_takahashii_Zasp66-PI SSPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG
::**********:*************.***********************
D_melanogaster_Zasp66-PI SFNRLMYSVIGATEY
D_sechellia_Zasp66-PI SFNRLMYSVIGATEY
D_simulans_Zasp66-PI SFNRLMYSVIGATEY
D_yakuba_Zasp66-PI SFNRLMYSVIGATEY
D_erecta_Zasp66-PI SFNRLMYSVIGATEY
D_biarmipes_Zasp66-PI SFNRLMYSVIGATEY
D_suzukii_Zasp66-PI SFNRLMYSVIGATEY
D_eugracilis_Zasp66-PI SFNRLMYSVIGATEY
D_ficusphila_Zasp66-PI SFNRLMYSVIGATEY
D_elegans_Zasp66-PI SFNRLMYSVIGATEY
D_takahashii_Zasp66-PI SFNRLMYSVIGATEY
***************
>D_melanogaster_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC >D_sechellia_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCATGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC >D_simulans_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCTTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTGATTGGTGCCACCGAGTAC >D_yakuba_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG ACACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC >D_erecta_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG AAACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAA TCCTCGCCACAGGAAGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC >D_biarmipes_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCTACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC GAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTCATTGGTGCCACCGAGTAC >D_suzukii_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC GAATAGATTGGTTCCAGGAAAGAAACCAGCTTCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC >D_eugracilis_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG ATACCTACAGAGCCATTCAAGAGGAGGGCGGCTACAGCAGCTATGGCCAA TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAAGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGACGAGAACATACGCCAGAGCGGC TCTTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC >D_ficusphila_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG AAACCTACAGAGCCATCCAAGAGGAGGGCGGCTACAGCAACTATGGCCAG TCCTCGCCACAGGAGGTGACCATTCCTGTGCAGACTAAGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTTTCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC >D_elegans_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG ATCAACAGTTCCCTATAAGAAAACTGTCCAGTACGATCCCAGGAACAGCG ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTACGGCAAT GCCGCGCCACAGGAAGTAACCATACCTGTGCAGACTAGGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCATGATGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAATAC >D_takahashii_Zasp66-PI ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCCTATAAGCAAACTGTCCAGTACGATCCCAGGAACAGCG ATACCTACAGAGCCATTCAAGAAGAGGGCGGCTACAGCAACTATGGCCAG TCCTCGCCACAGGAAGTAACCATTCCTGTGCAGACTAGGGTCTATCAGCC CAATAGATTGGTTCCAGGAAAGAAACCAGTATCAGCGCCAGTATCCCGGC CGCCGTACAATGTGGTAAACACCCACGACGAGAACATACGCCAGAGCGGC TCCTTCAATCGTCTCATGTACAGCGTTATTGGTGCCACCGAGTAC
>D_melanogaster_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_sechellia_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_simulans_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_yakuba_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_erecta_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_biarmipes_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_suzukii_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPASAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_eugracilis_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNSNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSSYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_ficusphila_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF NSPIGLYSNHNIEDTIRSTVPYKKTVQYDPRNSETYRAIQEEGGYSNYGQ SSPQEVTIPVQTKVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_elegans_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKKTVQYDPRNSDTYRAIQEEGGYSNYGN AAPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY >D_takahashii_Zasp66-PI MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPYKQTVQYDPRNSDTYRAIQEEGGYSNYGQ SSPQEVTIPVQTRVYQPNRLVPGKKPVSAPVSRPPYNVVNTHDENIRQSG SFNRLMYSVIGATEY
#NEXUS
[ID: 3280031110]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_Zasp66-PI
D_sechellia_Zasp66-PI
D_simulans_Zasp66-PI
D_yakuba_Zasp66-PI
D_erecta_Zasp66-PI
D_biarmipes_Zasp66-PI
D_suzukii_Zasp66-PI
D_eugracilis_Zasp66-PI
D_ficusphila_Zasp66-PI
D_elegans_Zasp66-PI
D_takahashii_Zasp66-PI
;
end;
begin trees;
translate
1 D_melanogaster_Zasp66-PI,
2 D_sechellia_Zasp66-PI,
3 D_simulans_Zasp66-PI,
4 D_yakuba_Zasp66-PI,
5 D_erecta_Zasp66-PI,
6 D_biarmipes_Zasp66-PI,
7 D_suzukii_Zasp66-PI,
8 D_eugracilis_Zasp66-PI,
9 D_ficusphila_Zasp66-PI,
10 D_elegans_Zasp66-PI,
11 D_takahashii_Zasp66-PI
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.006356273,2:0.006032485,3:0.01005436,((4:0.006002331,5:0.006320608)0.539:0.007214904,(((6:0.02226299,7:0.02713673)0.650:0.01247317,8:0.04046019,10:0.08051351,11:0.0265054)0.672:0.0224485,9:0.08226132)0.773:0.02355579)0.851:0.01154542);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.006356273,2:0.006032485,3:0.01005436,((4:0.006002331,5:0.006320608):0.007214904,(((6:0.02226299,7:0.02713673):0.01247317,8:0.04046019,10:0.08051351,11:0.0265054):0.0224485,9:0.08226132):0.02355579):0.01154542);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1306.37 -1329.16
2 -1305.53 -1330.75
--------------------------------------
TOTAL -1305.86 -1330.24
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.444227 0.011605 0.261739 0.666272 0.429258 1224.47 1300.84 1.000
r(A<->C){all} 0.027604 0.000330 0.000031 0.062834 0.024025 896.01 919.87 1.000
r(A<->G){all} 0.232289 0.005979 0.098468 0.385381 0.223423 390.59 612.71 1.000
r(A<->T){all} 0.120904 0.002830 0.022085 0.223053 0.114900 580.43 583.37 1.000
r(C<->G){all} 0.016864 0.000219 0.000014 0.046095 0.013064 906.67 953.09 1.000
r(C<->T){all} 0.353792 0.008648 0.178064 0.530277 0.348018 292.34 400.46 1.000
r(G<->T){all} 0.248547 0.005582 0.116603 0.400646 0.244688 613.98 648.02 1.000
pi(A){all} 0.282877 0.000303 0.248506 0.315433 0.282114 1215.62 1266.11 1.000
pi(C){all} 0.314354 0.000316 0.279639 0.348046 0.314162 1210.96 1286.99 1.001
pi(G){all} 0.226806 0.000249 0.194368 0.255550 0.226801 937.05 1095.29 1.000
pi(T){all} 0.175963 0.000201 0.149332 0.204586 0.175491 1195.07 1263.91 1.000
alpha{1,2} 0.114375 0.000793 0.067296 0.171206 0.109706 1127.65 1294.31 1.000
alpha{3} 1.625997 0.428499 0.598230 2.914526 1.527999 1174.48 1270.62 1.001
pinvar{all} 0.756703 0.001424 0.678591 0.821768 0.758687 1228.50 1364.75 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/442/Zasp66-PI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 215
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 0 0 0 0 0 2 | Tyr TAT 3 3 3 3 3 3 | Cys TGT 0 0 0 0 0 0
TTC 4 4 4 4 4 4 | TCC 7 7 7 7 7 6 | TAC 15 15 15 15 15 15 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 1 1 1 1 1 1 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 2 | TCG 3 3 3 3 3 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 0 | Pro CCT 1 1 3 1 1 1 | His CAT 1 2 1 1 1 1 | Arg CGT 2 2 2 3 3 1
CTC 2 2 2 2 2 2 | CCC 8 8 6 8 8 7 | CAC 6 5 6 6 6 6 | CGC 4 4 4 3 3 4
CTA 0 0 0 0 1 0 | CCA 7 7 7 7 7 7 | Gln CAA 5 5 5 5 5 4 | CGA 0 0 0 0 0 1
CTG 4 4 4 4 3 4 | CCG 4 4 4 4 4 5 | CAG 8 8 8 8 8 9 | CGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 4 4 4 4 3 | Thr ACT 4 4 4 4 4 4 | Asn AAT 4 4 4 4 4 4 | Ser AGT 1 1 1 1 1 1
ATC 3 4 4 4 4 5 | ACC 6 6 6 6 6 6 | AAC 10 10 10 10 10 10 | AGC 4 4 4 4 4 4
ATA 1 1 1 1 1 1 | ACA 3 3 3 3 3 3 | Lys AAA 4 4 4 4 4 4 | Arg AGA 3 3 3 3 3 3
Met ATG 4 4 4 4 4 4 | ACG 1 1 1 1 1 1 | AAG 9 9 9 9 9 9 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 3 5 5 4 | Ala GCT 1 1 1 1 1 1 | Asp GAT 3 3 3 3 3 5 | Gly GGT 2 2 2 2 2 2
GTC 6 6 6 6 6 7 | GCC 6 6 6 6 6 6 | GAC 6 6 6 7 6 5 | GGC 7 7 7 7 7 7
GTA 3 3 3 3 3 4 | GCA 0 0 0 0 0 0 | Glu GAA 4 4 4 3 4 2 | GGA 3 3 3 3 3 3
GTG 8 8 8 6 6 5 | GCG 2 2 2 2 2 2 | GAG 8 8 8 8 8 9 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 | Ser TCT 0 1 0 0 0 | Tyr TAT 4 3 3 4 3 | Cys TGT 0 0 0 0 0
TTC 4 4 4 4 4 | TCC 6 5 7 5 7 | TAC 14 15 15 14 15 | TGC 1 1 1 1 1
Leu TTA 0 0 0 0 0 | TCA 2 2 2 2 1 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 2 2 2 2 | TCG 3 3 2 2 3 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 1 0 0 | Pro CCT 2 3 2 1 1 | His CAT 1 2 1 2 1 | Arg CGT 1 1 2 1 1
CTC 2 2 1 2 2 | CCC 7 7 8 8 8 | CAC 6 5 7 5 6 | CGC 4 4 3 4 4
CTA 0 0 0 1 0 | CCA 7 7 6 7 8 | Gln CAA 4 5 4 4 5 | CGA 1 1 1 0 1
CTG 4 4 4 3 4 | CCG 4 3 4 4 3 | CAG 9 8 9 8 9 | CGG 1 1 1 2 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 4 4 3 3 4 | Thr ACT 4 4 4 4 4 | Asn AAT 4 4 4 5 4 | Ser AGT 1 1 1 1 1
ATC 4 4 5 4 4 | ACC 6 6 6 6 6 | AAC 10 8 9 10 10 | AGC 4 6 4 4 4
ATA 1 1 1 2 1 | ACA 3 3 3 3 3 | Lys AAA 4 4 4 4 3 | Arg AGA 3 3 3 3 3
Met ATG 4 4 4 4 4 | ACG 1 1 1 1 1 | AAG 9 9 9 8 8 | AGG 2 2 2 3 3
----------------------------------------------------------------------------------------------------------------------
Val GTT 5 5 5 4 4 | Ala GCT 2 1 1 1 1 | Asp GAT 6 3 3 4 3 | Gly GGT 2 2 2 2 2
GTC 6 6 6 6 7 | GCC 6 6 6 7 6 | GAC 5 7 7 6 7 | GGC 7 7 7 7 7
GTA 3 4 2 4 4 | GCA 0 0 0 0 0 | Glu GAA 3 2 1 5 3 | GGA 3 3 3 3 3
GTG 5 5 7 6 5 | GCG 2 2 2 3 2 | GAG 7 9 10 6 8 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Zasp66-PI
position 1: T:0.16744 C:0.24651 A:0.29767 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.40000 G:0.13953
position 3: T:0.13953 C:0.44186 A:0.15814 G:0.26047
Average T:0.17209 C:0.31318 A:0.28527 G:0.22946
#2: D_sechellia_Zasp66-PI
position 1: T:0.16744 C:0.24651 A:0.29767 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.40000 G:0.13953
position 3: T:0.13953 C:0.44186 A:0.15814 G:0.26047
Average T:0.17209 C:0.31318 A:0.28527 G:0.22946
#3: D_simulans_Zasp66-PI
position 1: T:0.16744 C:0.24651 A:0.29767 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.40000 G:0.13953
position 3: T:0.14419 C:0.43721 A:0.15814 G:0.26047
Average T:0.17364 C:0.31163 A:0.28527 G:0.22946
#4: D_yakuba_Zasp66-PI
position 1: T:0.16744 C:0.24651 A:0.29767 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.40000 G:0.13953
position 3: T:0.14884 C:0.44651 A:0.15349 G:0.25116
Average T:0.17519 C:0.31473 A:0.28372 G:0.22636
#5: D_erecta_Zasp66-PI
position 1: T:0.16744 C:0.24651 A:0.29767 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.40000 G:0.13953
position 3: T:0.14884 C:0.44186 A:0.16279 G:0.24651
Average T:0.17519 C:0.31318 A:0.28682 G:0.22481
#6: D_biarmipes_Zasp66-PI
position 1: T:0.16744 C:0.24651 A:0.29767 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.40000 G:0.13953
position 3: T:0.14884 C:0.44186 A:0.15349 G:0.25581
Average T:0.17519 C:0.31318 A:0.28372 G:0.22791
#7: D_suzukii_Zasp66-PI
position 1: T:0.16744 C:0.24651 A:0.29767 G:0.28837
position 2: T:0.20465 C:0.25581 A:0.40000 G:0.13953
position 3: T:0.16744 C:0.42791 A:0.15814 G:0.24651
Average T:0.17984 C:0.31008 A:0.28527 G:0.22481
#8: D_eugracilis_Zasp66-PI
position 1: T:0.16744 C:0.24651 A:0.29767 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.39070 G:0.14884
position 3: T:0.15814 C:0.43256 A:0.16279 G:0.24651
Average T:0.17829 C:0.31008 A:0.28372 G:0.22791
#9: D_ficusphila_Zasp66-PI
position 1: T:0.16744 C:0.25116 A:0.29302 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.40000 G:0.13953
position 3: T:0.14884 C:0.44651 A:0.13953 G:0.26512
Average T:0.17519 C:0.31628 A:0.27752 G:0.23101
#10: D_elegans_Zasp66-PI
position 1: T:0.15814 C:0.24186 A:0.30233 G:0.29767
position 2: T:0.20930 C:0.25116 A:0.39535 G:0.14419
position 3: T:0.14884 C:0.43256 A:0.17674 G:0.24186
Average T:0.17209 C:0.30853 A:0.29147 G:0.22791
#11: D_takahashii_Zasp66-PI
position 1: T:0.16744 C:0.25116 A:0.29302 G:0.28837
position 2: T:0.20930 C:0.25116 A:0.39535 G:0.14419
position 3: T:0.13488 C:0.45581 A:0.16279 G:0.24651
Average T:0.17054 C:0.31938 A:0.28372 G:0.22636
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 3 | Tyr Y TAT 35 | Cys C TGT 0
TTC 44 | TCC 71 | TAC 163 | TGC 11
Leu L TTA 0 | TCA 15 | *** * TAA 0 | *** * TGA 0
TTG 22 | TCG 30 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 17 | His H CAT 14 | Arg R CGT 19
CTC 21 | CCC 83 | CAC 64 | CGC 41
CTA 2 | CCA 77 | Gln Q CAA 51 | CGA 5
CTG 42 | CCG 43 | CAG 92 | CGG 12
------------------------------------------------------------------------------
Ile I ATT 42 | Thr T ACT 44 | Asn N AAT 45 | Ser S AGT 11
ATC 45 | ACC 66 | AAC 107 | AGC 46
ATA 12 | ACA 33 | Lys K AAA 43 | Arg R AGA 33
Met M ATG 44 | ACG 11 | AAG 97 | AGG 24
------------------------------------------------------------------------------
Val V GTT 46 | Ala A GCT 12 | Asp D GAT 39 | Gly G GGT 22
GTC 68 | GCC 67 | GAC 68 | GGC 77
GTA 36 | GCA 0 | Glu E GAA 35 | GGA 33
GTG 69 | GCG 23 | GAG 89 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.16660 C:0.24693 A:0.29725 G:0.28922
position 2: T:0.20888 C:0.25159 A:0.39831 G:0.14123
position 3: T:0.14799 C:0.44059 A:0.15856 G:0.25285
Average T:0.17449 C:0.31304 A:0.28471 G:0.22777
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Zasp66-PI
D_sechellia_Zasp66-PI -1.0000 (0.0000 0.0134)
D_simulans_Zasp66-PI -1.0000 (0.0000 0.0202)-1.0000 (0.0000 0.0202)
D_yakuba_Zasp66-PI 0.0746 (0.0020 0.0271) 0.0746 (0.0020 0.0271) 0.0594 (0.0020 0.0341)
D_erecta_Zasp66-PI -1.0000 (0.0000 0.0341)-1.0000 (0.0000 0.0341)-1.0000 (0.0000 0.0411) 0.3024 (0.0020 0.0067)
D_biarmipes_Zasp66-PI 0.0240 (0.0020 0.0844) 0.0240 (0.0020 0.0844) 0.0220 (0.0020 0.0919)-1.0000 (0.0000 0.0844) 0.0240 (0.0020 0.0844)
D_suzukii_Zasp66-PI 0.0613 (0.0061 0.0994) 0.0613 (0.0061 0.0994) 0.0569 (0.0061 0.1070) 0.0441 (0.0041 0.0919) 0.0663 (0.0061 0.0919) 0.0736 (0.0041 0.0551)
D_eugracilis_Zasp66-PI 0.0613 (0.0061 0.0994) 0.0613 (0.0061 0.0994) 0.0569 (0.0061 0.1070) 0.0441 (0.0041 0.0919) 0.0663 (0.0061 0.0918) 0.0409 (0.0041 0.0993) 0.1170 (0.0081 0.0695)
D_ficusphila_Zasp66-PI 0.0408 (0.0041 0.0994) 0.0408 (0.0041 0.0994) 0.0379 (0.0041 0.1070) 0.0612 (0.0061 0.0994) 0.0379 (0.0041 0.1070) 0.0531 (0.0061 0.1146) 0.0953 (0.0102 0.1069) 0.0833 (0.0102 0.1223)
D_elegans_Zasp66-PI 0.1143 (0.0122 0.1070) 0.1332 (0.0122 0.0918) 0.1066 (0.0122 0.1147) 0.0887 (0.0102 0.1147) 0.1231 (0.0122 0.0994) 0.0832 (0.0102 0.1224) 0.1559 (0.0143 0.0917) 0.1249 (0.0143 0.1145) 0.1120 (0.0164 0.1461)
D_takahashii_Zasp66-PI 0.0875 (0.0061 0.0696) 0.0875 (0.0061 0.0696) 0.0792 (0.0061 0.0769) 0.0583 (0.0041 0.0696) 0.0875 (0.0061 0.0696) 0.0583 (0.0041 0.0695) 0.1307 (0.0081 0.0622) 0.1308 (0.0081 0.0622) 0.0954 (0.0102 0.1068) 0.1112 (0.0102 0.0916)
Model 0: one-ratio
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
lnL(ntime: 16 np: 18): -1261.868916 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004758 0.004752 0.009537 0.009212 0.005162 0.004777 0.004740 0.016971 0.017270 0.009518 0.024186 0.024232 0.043496 0.073777 0.029036 0.059985 1.799958 0.064818
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.34141
(1: 0.004758, 2: 0.004752, 3: 0.009537, ((4: 0.004777, 5: 0.004740): 0.005162, (((6: 0.024186, 7: 0.024232): 0.009518, 8: 0.043496, 10: 0.073777, 11: 0.029036): 0.017270, 9: 0.059985): 0.016971): 0.009212);
(D_melanogaster_Zasp66-PI: 0.004758, D_sechellia_Zasp66-PI: 0.004752, D_simulans_Zasp66-PI: 0.009537, ((D_yakuba_Zasp66-PI: 0.004777, D_erecta_Zasp66-PI: 0.004740): 0.005162, (((D_biarmipes_Zasp66-PI: 0.024186, D_suzukii_Zasp66-PI: 0.024232): 0.009518, D_eugracilis_Zasp66-PI: 0.043496, D_elegans_Zasp66-PI: 0.073777, D_takahashii_Zasp66-PI: 0.029036): 0.017270, D_ficusphila_Zasp66-PI: 0.059985): 0.016971): 0.009212);
Detailed output identifying parameters
kappa (ts/tv) = 1.79996
omega (dN/dS) = 0.06482
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.005 517.8 127.2 0.0648 0.0004 0.0064 0.2 0.8
12..2 0.005 517.8 127.2 0.0648 0.0004 0.0064 0.2 0.8
12..3 0.010 517.8 127.2 0.0648 0.0008 0.0128 0.4 1.6
12..13 0.009 517.8 127.2 0.0648 0.0008 0.0123 0.4 1.6
13..14 0.005 517.8 127.2 0.0648 0.0004 0.0069 0.2 0.9
14..4 0.005 517.8 127.2 0.0648 0.0004 0.0064 0.2 0.8
14..5 0.005 517.8 127.2 0.0648 0.0004 0.0063 0.2 0.8
13..15 0.017 517.8 127.2 0.0648 0.0015 0.0227 0.8 2.9
15..16 0.017 517.8 127.2 0.0648 0.0015 0.0231 0.8 2.9
16..17 0.010 517.8 127.2 0.0648 0.0008 0.0127 0.4 1.6
17..6 0.024 517.8 127.2 0.0648 0.0021 0.0323 1.1 4.1
17..7 0.024 517.8 127.2 0.0648 0.0021 0.0324 1.1 4.1
16..8 0.043 517.8 127.2 0.0648 0.0038 0.0582 2.0 7.4
16..10 0.074 517.8 127.2 0.0648 0.0064 0.0987 3.3 12.6
16..11 0.029 517.8 127.2 0.0648 0.0025 0.0388 1.3 4.9
15..9 0.060 517.8 127.2 0.0648 0.0052 0.0802 2.7 10.2
tree length for dN: 0.0296
tree length for dS: 0.4565
Time used: 0:10
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
lnL(ntime: 16 np: 19): -1255.827239 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004811 0.004804 0.009644 0.009322 0.005222 0.004790 0.004799 0.017409 0.017565 0.009670 0.024392 0.024417 0.044369 0.075381 0.029403 0.061068 1.907237 0.924410 0.005365
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.34707
(1: 0.004811, 2: 0.004804, 3: 0.009644, ((4: 0.004790, 5: 0.004799): 0.005222, (((6: 0.024392, 7: 0.024417): 0.009670, 8: 0.044369, 10: 0.075381, 11: 0.029403): 0.017565, 9: 0.061068): 0.017409): 0.009322);
(D_melanogaster_Zasp66-PI: 0.004811, D_sechellia_Zasp66-PI: 0.004804, D_simulans_Zasp66-PI: 0.009644, ((D_yakuba_Zasp66-PI: 0.004790, D_erecta_Zasp66-PI: 0.004799): 0.005222, (((D_biarmipes_Zasp66-PI: 0.024392, D_suzukii_Zasp66-PI: 0.024417): 0.009670, D_eugracilis_Zasp66-PI: 0.044369, D_elegans_Zasp66-PI: 0.075381, D_takahashii_Zasp66-PI: 0.029403): 0.017565, D_ficusphila_Zasp66-PI: 0.061068): 0.017409): 0.009322);
Detailed output identifying parameters
kappa (ts/tv) = 1.90724
dN/dS (w) for site classes (K=2)
p: 0.92441 0.07559
w: 0.00537 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.005 516.2 128.8 0.0805 0.0005 0.0061 0.3 0.8
12..2 0.005 516.2 128.8 0.0805 0.0005 0.0061 0.3 0.8
12..3 0.010 516.2 128.8 0.0805 0.0010 0.0122 0.5 1.6
12..13 0.009 516.2 128.8 0.0805 0.0009 0.0118 0.5 1.5
13..14 0.005 516.2 128.8 0.0805 0.0005 0.0066 0.3 0.8
14..4 0.005 516.2 128.8 0.0805 0.0005 0.0060 0.3 0.8
14..5 0.005 516.2 128.8 0.0805 0.0005 0.0061 0.3 0.8
13..15 0.017 516.2 128.8 0.0805 0.0018 0.0220 0.9 2.8
15..16 0.018 516.2 128.8 0.0805 0.0018 0.0222 0.9 2.9
16..17 0.010 516.2 128.8 0.0805 0.0010 0.0122 0.5 1.6
17..6 0.024 516.2 128.8 0.0805 0.0025 0.0308 1.3 4.0
17..7 0.024 516.2 128.8 0.0805 0.0025 0.0308 1.3 4.0
16..8 0.044 516.2 128.8 0.0805 0.0045 0.0560 2.3 7.2
16..10 0.075 516.2 128.8 0.0805 0.0077 0.0951 4.0 12.3
16..11 0.029 516.2 128.8 0.0805 0.0030 0.0371 1.5 4.8
15..9 0.061 516.2 128.8 0.0805 0.0062 0.0771 3.2 9.9
Time used: 0:21
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
lnL(ntime: 16 np: 21): -1255.827239 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004811 0.004804 0.009644 0.009322 0.005222 0.004790 0.004799 0.017409 0.017565 0.009671 0.024392 0.024417 0.044369 0.075381 0.029403 0.061068 1.907238 0.924410 0.023460 0.005365 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.34707
(1: 0.004811, 2: 0.004804, 3: 0.009644, ((4: 0.004790, 5: 0.004799): 0.005222, (((6: 0.024392, 7: 0.024417): 0.009671, 8: 0.044369, 10: 0.075381, 11: 0.029403): 0.017565, 9: 0.061068): 0.017409): 0.009322);
(D_melanogaster_Zasp66-PI: 0.004811, D_sechellia_Zasp66-PI: 0.004804, D_simulans_Zasp66-PI: 0.009644, ((D_yakuba_Zasp66-PI: 0.004790, D_erecta_Zasp66-PI: 0.004799): 0.005222, (((D_biarmipes_Zasp66-PI: 0.024392, D_suzukii_Zasp66-PI: 0.024417): 0.009671, D_eugracilis_Zasp66-PI: 0.044369, D_elegans_Zasp66-PI: 0.075381, D_takahashii_Zasp66-PI: 0.029403): 0.017565, D_ficusphila_Zasp66-PI: 0.061068): 0.017409): 0.009322);
Detailed output identifying parameters
kappa (ts/tv) = 1.90724
dN/dS (w) for site classes (K=3)
p: 0.92441 0.02346 0.05213
w: 0.00537 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.005 516.2 128.8 0.0806 0.0005 0.0061 0.3 0.8
12..2 0.005 516.2 128.8 0.0806 0.0005 0.0061 0.3 0.8
12..3 0.010 516.2 128.8 0.0806 0.0010 0.0122 0.5 1.6
12..13 0.009 516.2 128.8 0.0806 0.0009 0.0118 0.5 1.5
13..14 0.005 516.2 128.8 0.0806 0.0005 0.0066 0.3 0.8
14..4 0.005 516.2 128.8 0.0806 0.0005 0.0060 0.3 0.8
14..5 0.005 516.2 128.8 0.0806 0.0005 0.0061 0.3 0.8
13..15 0.017 516.2 128.8 0.0806 0.0018 0.0220 0.9 2.8
15..16 0.018 516.2 128.8 0.0806 0.0018 0.0222 0.9 2.9
16..17 0.010 516.2 128.8 0.0806 0.0010 0.0122 0.5 1.6
17..6 0.024 516.2 128.8 0.0806 0.0025 0.0308 1.3 4.0
17..7 0.024 516.2 128.8 0.0806 0.0025 0.0308 1.3 4.0
16..8 0.044 516.2 128.8 0.0806 0.0045 0.0560 2.3 7.2
16..10 0.075 516.2 128.8 0.0806 0.0077 0.0951 4.0 12.3
16..11 0.029 516.2 128.8 0.0806 0.0030 0.0371 1.5 4.8
15..9 0.061 516.2 128.8 0.0806 0.0062 0.0771 3.2 9.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PI)
Pr(w>1) post mean +- SE for w
134 E 0.568 1.500 +- 0.890
150 Q 0.572 1.519 +- 0.941
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.688 0.201 0.061 0.023 0.011 0.006 0.004 0.003 0.002 0.002
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004 0.995
sum of density on p0-p1 = 1.000000
Time used: 0:44
Model 3: discrete (3 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
lnL(ntime: 16 np: 22): -1255.462558 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004801 0.004795 0.009624 0.009301 0.005211 0.004794 0.004786 0.017300 0.017510 0.009628 0.024356 0.024384 0.044169 0.074978 0.029335 0.060815 1.841129 0.722284 0.172021 0.000001 0.000001 0.657553
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.34579
(1: 0.004801, 2: 0.004795, 3: 0.009624, ((4: 0.004794, 5: 0.004786): 0.005211, (((6: 0.024356, 7: 0.024384): 0.009628, 8: 0.044169, 10: 0.074978, 11: 0.029335): 0.017510, 9: 0.060815): 0.017300): 0.009301);
(D_melanogaster_Zasp66-PI: 0.004801, D_sechellia_Zasp66-PI: 0.004795, D_simulans_Zasp66-PI: 0.009624, ((D_yakuba_Zasp66-PI: 0.004794, D_erecta_Zasp66-PI: 0.004786): 0.005211, (((D_biarmipes_Zasp66-PI: 0.024356, D_suzukii_Zasp66-PI: 0.024384): 0.009628, D_eugracilis_Zasp66-PI: 0.044169, D_elegans_Zasp66-PI: 0.074978, D_takahashii_Zasp66-PI: 0.029335): 0.017510, D_ficusphila_Zasp66-PI: 0.060815): 0.017300): 0.009301);
Detailed output identifying parameters
kappa (ts/tv) = 1.84113
dN/dS (w) for site classes (K=3)
p: 0.72228 0.17202 0.10569
w: 0.00000 0.00000 0.65755
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.005 517.2 127.8 0.0695 0.0004 0.0063 0.2 0.8
12..2 0.005 517.2 127.8 0.0695 0.0004 0.0063 0.2 0.8
12..3 0.010 517.2 127.8 0.0695 0.0009 0.0126 0.5 1.6
12..13 0.009 517.2 127.8 0.0695 0.0008 0.0122 0.4 1.6
13..14 0.005 517.2 127.8 0.0695 0.0005 0.0068 0.2 0.9
14..4 0.005 517.2 127.8 0.0695 0.0004 0.0063 0.2 0.8
14..5 0.005 517.2 127.8 0.0695 0.0004 0.0063 0.2 0.8
13..15 0.017 517.2 127.8 0.0695 0.0016 0.0227 0.8 2.9
15..16 0.018 517.2 127.8 0.0695 0.0016 0.0230 0.8 2.9
16..17 0.010 517.2 127.8 0.0695 0.0009 0.0126 0.5 1.6
17..6 0.024 517.2 127.8 0.0695 0.0022 0.0320 1.1 4.1
17..7 0.024 517.2 127.8 0.0695 0.0022 0.0320 1.2 4.1
16..8 0.044 517.2 127.8 0.0695 0.0040 0.0580 2.1 7.4
16..10 0.075 517.2 127.8 0.0695 0.0068 0.0984 3.5 12.6
16..11 0.029 517.2 127.8 0.0695 0.0027 0.0385 1.4 4.9
15..9 0.061 517.2 127.8 0.0695 0.0055 0.0798 2.9 10.2
Naive Empirical Bayes (NEB) analysis
Time used: 0:59
Model 7: beta (10 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
lnL(ntime: 16 np: 19): -1255.471314 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004787 0.004780 0.009596 0.009275 0.005195 0.004778 0.004773 0.017258 0.017463 0.009601 0.024283 0.024310 0.044054 0.074787 0.029251 0.060653 1.842980 0.011316 0.182968
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.34484
(1: 0.004787, 2: 0.004780, 3: 0.009596, ((4: 0.004778, 5: 0.004773): 0.005195, (((6: 0.024283, 7: 0.024310): 0.009601, 8: 0.044054, 10: 0.074787, 11: 0.029251): 0.017463, 9: 0.060653): 0.017258): 0.009275);
(D_melanogaster_Zasp66-PI: 0.004787, D_sechellia_Zasp66-PI: 0.004780, D_simulans_Zasp66-PI: 0.009596, ((D_yakuba_Zasp66-PI: 0.004778, D_erecta_Zasp66-PI: 0.004773): 0.005195, (((D_biarmipes_Zasp66-PI: 0.024283, D_suzukii_Zasp66-PI: 0.024310): 0.009601, D_eugracilis_Zasp66-PI: 0.044054, D_elegans_Zasp66-PI: 0.074787, D_takahashii_Zasp66-PI: 0.029251): 0.017463, D_ficusphila_Zasp66-PI: 0.060653): 0.017258): 0.009275);
Detailed output identifying parameters
kappa (ts/tv) = 1.84298
Parameters in M7 (beta):
p = 0.01132 q = 0.18297
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00009 0.68662
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.005 517.1 127.9 0.0687 0.0004 0.0063 0.2 0.8
12..2 0.005 517.1 127.9 0.0687 0.0004 0.0063 0.2 0.8
12..3 0.010 517.1 127.9 0.0687 0.0009 0.0126 0.4 1.6
12..13 0.009 517.1 127.9 0.0687 0.0008 0.0122 0.4 1.6
13..14 0.005 517.1 127.9 0.0687 0.0005 0.0068 0.2 0.9
14..4 0.005 517.1 127.9 0.0687 0.0004 0.0063 0.2 0.8
14..5 0.005 517.1 127.9 0.0687 0.0004 0.0063 0.2 0.8
13..15 0.017 517.1 127.9 0.0687 0.0016 0.0227 0.8 2.9
15..16 0.017 517.1 127.9 0.0687 0.0016 0.0230 0.8 2.9
16..17 0.010 517.1 127.9 0.0687 0.0009 0.0126 0.4 1.6
17..6 0.024 517.1 127.9 0.0687 0.0022 0.0320 1.1 4.1
17..7 0.024 517.1 127.9 0.0687 0.0022 0.0320 1.1 4.1
16..8 0.044 517.1 127.9 0.0687 0.0040 0.0580 2.1 7.4
16..10 0.075 517.1 127.9 0.0687 0.0068 0.0984 3.5 12.6
16..11 0.029 517.1 127.9 0.0687 0.0026 0.0385 1.4 4.9
15..9 0.061 517.1 127.9 0.0687 0.0055 0.0798 2.8 10.2
Time used: 2:31
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, 3, ((4, 5), (((6, 7), 8, 10, 11), 9))); MP score: 68
check convergence..
lnL(ntime: 16 np: 21): -1255.471088 +0.000000
12..1 12..2 12..3 12..13 13..14 14..4 14..5 13..15 15..16 16..17 17..6 17..7 16..8 16..10 16..11 15..9
0.004789 0.004783 0.009600 0.009279 0.005198 0.004781 0.004775 0.017266 0.017471 0.009606 0.024295 0.024322 0.044073 0.074820 0.029264 0.060680 1.842939 0.999183 0.010943 0.178471 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.34500
(1: 0.004789, 2: 0.004783, 3: 0.009600, ((4: 0.004781, 5: 0.004775): 0.005198, (((6: 0.024295, 7: 0.024322): 0.009606, 8: 0.044073, 10: 0.074820, 11: 0.029264): 0.017471, 9: 0.060680): 0.017266): 0.009279);
(D_melanogaster_Zasp66-PI: 0.004789, D_sechellia_Zasp66-PI: 0.004783, D_simulans_Zasp66-PI: 0.009600, ((D_yakuba_Zasp66-PI: 0.004781, D_erecta_Zasp66-PI: 0.004775): 0.005198, (((D_biarmipes_Zasp66-PI: 0.024295, D_suzukii_Zasp66-PI: 0.024322): 0.009606, D_eugracilis_Zasp66-PI: 0.044073, D_elegans_Zasp66-PI: 0.074820, D_takahashii_Zasp66-PI: 0.029264): 0.017471, D_ficusphila_Zasp66-PI: 0.060680): 0.017266): 0.009279);
Detailed output identifying parameters
kappa (ts/tv) = 1.84294
Parameters in M8 (beta&w>1):
p0 = 0.99918 p = 0.01094 q = 0.17847
(p1 = 0.00082) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09992 0.09992 0.09992 0.09992 0.09992 0.09992 0.09992 0.09992 0.09992 0.09992 0.00082
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00006 0.68115 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.005 517.1 127.9 0.0689 0.0004 0.0063 0.2 0.8
12..2 0.005 517.1 127.9 0.0689 0.0004 0.0063 0.2 0.8
12..3 0.010 517.1 127.9 0.0689 0.0009 0.0126 0.4 1.6
12..13 0.009 517.1 127.9 0.0689 0.0008 0.0122 0.4 1.6
13..14 0.005 517.1 127.9 0.0689 0.0005 0.0068 0.2 0.9
14..4 0.005 517.1 127.9 0.0689 0.0004 0.0063 0.2 0.8
14..5 0.005 517.1 127.9 0.0689 0.0004 0.0063 0.2 0.8
13..15 0.017 517.1 127.9 0.0689 0.0016 0.0227 0.8 2.9
15..16 0.017 517.1 127.9 0.0689 0.0016 0.0230 0.8 2.9
16..17 0.010 517.1 127.9 0.0689 0.0009 0.0126 0.5 1.6
17..6 0.024 517.1 127.9 0.0689 0.0022 0.0320 1.1 4.1
17..7 0.024 517.1 127.9 0.0689 0.0022 0.0320 1.1 4.1
16..8 0.044 517.1 127.9 0.0689 0.0040 0.0580 2.1 7.4
16..10 0.075 517.1 127.9 0.0689 0.0068 0.0984 3.5 12.6
16..11 0.029 517.1 127.9 0.0689 0.0027 0.0385 1.4 4.9
15..9 0.061 517.1 127.9 0.0689 0.0055 0.0798 2.8 10.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PI)
Pr(w>1) post mean +- SE for w
134 E 0.676 1.319 +- 0.778
150 Q 0.673 1.320 +- 0.796
163 K 0.591 1.181 +- 0.745
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.001 0.006 0.029 0.079 0.164 0.285 0.437
ws: 0.828 0.130 0.027 0.008 0.003 0.001 0.001 0.001 0.000 0.000
Time used: 6:08
Model 1: NearlyNeutral -1255.827239 Model 2: PositiveSelection -1255.827239 Model 0: one-ratio -1261.868916 Model 3: discrete -1255.462558 Model 7: beta -1255.471314 Model 8: beta&w>1 -1255.471088 Model 0 vs 1 12.083353999999872 Model 2 vs 1 0.0 Model 8 vs 7 4.519999997683044E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
