--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Dec 09 20:49:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/442/Zasp66-PG/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1036.13 -1056.01
2 -1035.57 -1055.58
--------------------------------------
TOTAL -1035.81 -1055.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.502454 0.013206 0.303897 0.738691 0.485575 847.82 1111.12 1.000
r(A<->C){all} 0.014359 0.000152 0.000001 0.038374 0.011240 829.56 918.44 1.001
r(A<->G){all} 0.184487 0.004569 0.064227 0.319684 0.176656 451.92 533.18 1.003
r(A<->T){all} 0.127286 0.003022 0.032680 0.233709 0.121646 607.80 625.99 1.000
r(C<->G){all} 0.024685 0.000401 0.000011 0.064211 0.019767 586.56 802.94 1.000
r(C<->T){all} 0.388413 0.010098 0.200378 0.592322 0.383256 374.90 452.64 1.000
r(G<->T){all} 0.260770 0.007080 0.105653 0.426002 0.254728 299.09 447.91 1.001
pi(A){all} 0.319319 0.000441 0.279689 0.361674 0.318818 1205.52 1282.45 1.001
pi(C){all} 0.311586 0.000411 0.268930 0.348686 0.311460 1185.69 1236.05 1.000
pi(G){all} 0.198203 0.000311 0.164557 0.233611 0.197957 1267.51 1295.72 1.000
pi(T){all} 0.170891 0.000255 0.140903 0.202530 0.170256 1220.31 1273.88 1.000
alpha{1,2} 0.052587 0.001249 0.000105 0.116000 0.049012 1092.54 1116.91 1.000
alpha{3} 1.514823 0.435671 0.516429 2.875891 1.394310 1435.42 1468.21 1.000
pinvar{all} 0.698038 0.002125 0.604684 0.782088 0.700952 1264.02 1341.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1006.974363
Model 2: PositiveSelection -1006.347317
Model 0: one-ratio -1020.178634
Model 3: discrete -1006.974196
Model 7: beta -1007.112396
Model 8: beta&w>1 -1005.997423
Model 0 vs 1 26.408541999999898
Model 2 vs 1 1.2540920000001279
Model 8 vs 7 2.229945999999927
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
QQRQHQLQILYQQNK
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKDQLAEQQR
QQRQQQLQILYQQNK
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKEQLAEQQR
QQRQQQLQILYQQNK
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
QQRQHQLQILYQQNK
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
QQRQHQLQILYQQNK
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
LQRQQQLQLLYQQNK
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQILYQQNK
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLERKRVILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=165
C1 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C2 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C3 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C4 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C5 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C6 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C7 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
C8 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C9 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C10 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
C11 MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
************************************************:*
C1 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C2 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C3 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C4 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C5 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C6 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C7 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C8 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C9 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
C10 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
C11 YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
**************************************:***********
C1 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
C2 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKDQLAEQQR
C3 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKEQLAEQQR
C4 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
C5 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
C6 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
C7 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
C8 NSPIGLYSNSNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
C9 NSPIGLYSNHNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
C10 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLERKRVILEQQKQKDQLAEQQR
C11 NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
********* ********************:** ********:*******
C1 QQRQHQLQILYQQNK
C2 QQRQQQLQILYQQNK
C3 QQRQQQLQILYQQNK
C4 QQRQHQLQILYQQNK
C5 QQRQHQLQILYQQNK
C6 LQRQQQLQLLYQQNK
C7 QQRQQQLQLLYQQNK
C8 QQRQQQLQLLYQQNK
C9 QQRQQQLQILYQQNK
C10 QQRQQQLQLLYQQNK
C11 QQRQQQLQLLYQQNK
***:***:******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnlugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
lugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 165 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 165 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [18150]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [18150]--->[18150]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/442/Zasp66-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.580 Mb, Max= 31.059 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
QQRQHQLQILYQQNK
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKDQLAEQQR
QQRQQQLQILYQQNK
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKEQLAEQQR
QQRQQQLQILYQQNK
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
QQRQHQLQILYQQNK
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
QQRQHQLQILYQQNK
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
LQRQQQLQLLYQQNK
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQILYQQNK
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLERKRVILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
FORMAT of file /tmp/tmp9093059050902197153aln Not Supported[FATAL:T-COFFEE]
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
QQRQHQLQILYQQNK
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKDQLAEQQR
QQRQQQLQILYQQNK
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKEQLAEQQR
QQRQQQLQILYQQNK
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
QQRQHQLQILYQQNK
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
QQRQHQLQILYQQNK
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
LQRQQQLQLLYQQNK
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQILYQQNK
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLERKRVILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:165 S:100 BS:165
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 98.79 C1 C2 98.79
TOP 1 0 98.79 C2 C1 98.79
BOT 0 2 98.18 C1 C3 98.18
TOP 2 0 98.18 C3 C1 98.18
BOT 0 3 99.39 C1 C4 99.39
TOP 3 0 99.39 C4 C1 99.39
BOT 0 4 99.39 C1 C5 99.39
TOP 4 0 99.39 C5 C1 99.39
BOT 0 5 97.58 C1 C6 97.58
TOP 5 0 97.58 C6 C1 97.58
BOT 0 6 97.58 C1 C7 97.58
TOP 6 0 97.58 C7 C1 97.58
BOT 0 7 97.58 C1 C8 97.58
TOP 7 0 97.58 C8 C1 97.58
BOT 0 8 97.58 C1 C9 97.58
TOP 8 0 97.58 C9 C1 97.58
BOT 0 9 97.58 C1 C10 97.58
TOP 9 0 97.58 C10 C1 97.58
BOT 0 10 98.79 C1 C11 98.79
TOP 10 0 98.79 C11 C1 98.79
BOT 1 2 99.39 C2 C3 99.39
TOP 2 1 99.39 C3 C2 99.39
BOT 1 3 98.18 C2 C4 98.18
TOP 3 1 98.18 C4 C2 98.18
BOT 1 4 98.18 C2 C5 98.18
TOP 4 1 98.18 C5 C2 98.18
BOT 1 5 98.18 C2 C6 98.18
TOP 5 1 98.18 C6 C2 98.18
BOT 1 6 98.18 C2 C7 98.18
TOP 6 1 98.18 C7 C2 98.18
BOT 1 7 98.18 C2 C8 98.18
TOP 7 1 98.18 C8 C2 98.18
BOT 1 8 98.18 C2 C9 98.18
TOP 8 1 98.18 C9 C2 98.18
BOT 1 9 98.79 C2 C10 98.79
TOP 9 1 98.79 C10 C2 98.79
BOT 1 10 98.79 C2 C11 98.79
TOP 10 1 98.79 C11 C2 98.79
BOT 2 3 98.79 C3 C4 98.79
TOP 3 2 98.79 C4 C3 98.79
BOT 2 4 98.79 C3 C5 98.79
TOP 4 2 98.79 C5 C3 98.79
BOT 2 5 97.58 C3 C6 97.58
TOP 5 2 97.58 C6 C3 97.58
BOT 2 6 97.58 C3 C7 97.58
TOP 6 2 97.58 C7 C3 97.58
BOT 2 7 97.58 C3 C8 97.58
TOP 7 2 97.58 C8 C3 97.58
BOT 2 8 97.58 C3 C9 97.58
TOP 8 2 97.58 C9 C3 97.58
BOT 2 9 98.18 C3 C10 98.18
TOP 9 2 98.18 C10 C3 98.18
BOT 2 10 98.18 C3 C11 98.18
TOP 10 2 98.18 C11 C3 98.18
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 96.97 C4 C6 96.97
TOP 5 3 96.97 C6 C4 96.97
BOT 3 6 96.97 C4 C7 96.97
TOP 6 3 96.97 C7 C4 96.97
BOT 3 7 96.97 C4 C8 96.97
TOP 7 3 96.97 C8 C4 96.97
BOT 3 8 96.97 C4 C9 96.97
TOP 8 3 96.97 C9 C4 96.97
BOT 3 9 96.97 C4 C10 96.97
TOP 9 3 96.97 C10 C4 96.97
BOT 3 10 98.18 C4 C11 98.18
TOP 10 3 98.18 C11 C4 98.18
BOT 4 5 96.97 C5 C6 96.97
TOP 5 4 96.97 C6 C5 96.97
BOT 4 6 96.97 C5 C7 96.97
TOP 6 4 96.97 C7 C5 96.97
BOT 4 7 96.97 C5 C8 96.97
TOP 7 4 96.97 C8 C5 96.97
BOT 4 8 96.97 C5 C9 96.97
TOP 8 4 96.97 C9 C5 96.97
BOT 4 9 96.97 C5 C10 96.97
TOP 9 4 96.97 C10 C5 96.97
BOT 4 10 98.18 C5 C11 98.18
TOP 10 4 98.18 C11 C5 98.18
BOT 5 6 98.79 C6 C7 98.79
TOP 6 5 98.79 C7 C6 98.79
BOT 5 7 98.79 C6 C8 98.79
TOP 7 5 98.79 C8 C6 98.79
BOT 5 8 97.58 C6 C9 97.58
TOP 8 5 97.58 C9 C6 97.58
BOT 5 9 98.18 C6 C10 98.18
TOP 9 5 98.18 C10 C6 98.18
BOT 5 10 98.79 C6 C11 98.79
TOP 10 5 98.79 C11 C6 98.79
BOT 6 7 98.79 C7 C8 98.79
TOP 7 6 98.79 C8 C7 98.79
BOT 6 8 97.58 C7 C9 97.58
TOP 8 6 97.58 C9 C7 97.58
BOT 6 9 98.18 C7 C10 98.18
TOP 9 6 98.18 C10 C7 98.18
BOT 6 10 98.79 C7 C11 98.79
TOP 10 6 98.79 C11 C7 98.79
BOT 7 8 98.18 C8 C9 98.18
TOP 8 7 98.18 C9 C8 98.18
BOT 7 9 98.18 C8 C10 98.18
TOP 9 7 98.18 C10 C8 98.18
BOT 7 10 98.79 C8 C11 98.79
TOP 10 7 98.79 C11 C8 98.79
BOT 8 9 96.97 C9 C10 96.97
TOP 9 8 96.97 C10 C9 96.97
BOT 8 10 97.58 C9 C11 97.58
TOP 10 8 97.58 C11 C9 97.58
BOT 9 10 98.79 C10 C11 98.79
TOP 10 9 98.79 C11 C10 98.79
AVG 0 C1 * 98.24
AVG 1 C2 * 98.48
AVG 2 C3 * 98.18
AVG 3 C4 * 97.94
AVG 4 C5 * 97.94
AVG 5 C6 * 97.94
AVG 6 C7 * 97.94
AVG 7 C8 * 98.00
AVG 8 C9 * 97.52
AVG 9 C10 * 97.88
AVG 10 C11 * 98.48
TOT TOT * 98.05
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C2 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C3 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C4 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C5 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C6 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C7 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C8 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
C9 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA
C10 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA
C11 ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
********************************:**************.**
C1 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C2 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C3 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C4 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C5 GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
C6 GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC
C7 GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC
C8 GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC
C9 GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC
C10 GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC
C11 GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC
********* *****.***** ***** ***** ***** ******** *
C1 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C2 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C3 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C4 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C5 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C6 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C7 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC
C8 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C9 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC
C10 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
C11 TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
******************************* ************** ***
C1 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C2 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C3 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C4 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C5 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C6 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C7 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C8 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA
C9 TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C10 TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
C11 TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA
************** ********.************** ***********
C1 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C2 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C3 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C4 CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
C5 CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
C6 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
C7 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
C8 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C9 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C10 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
C11 CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
*************************** ******** *************
C1 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C2 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C3 AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C4 AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C5 AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C6 AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C7 AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C8 AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C9 AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC
C10 AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
C11 AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
**** ******** ** ************** ******************
C1 AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C2 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C3 AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C4 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C5 AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
C6 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C7 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
C8 AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG
C9 AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG
C10 AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
C11 AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
******** ** *****.*********..*********************
C1 ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
C2 ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTG
C3 ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTG
C4 ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
C5 ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
C6 ATCTACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
C7 ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
C8 ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
C9 ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
C10 ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACGAAAACGTG
C11 ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
*** *************************************.*******.
C1 TTATTCTGGAGCAACAAAAGCAAAAAGACCAACTGGCAGAGCAACAACGT
C2 TTATTCTGGAGCAACAAAAGCAAAAAGACCAACTGGCAGAGCAACAACGT
C3 TTATTCTGGAGCAACAAAAGCAAAAAGAGCAACTGGCAGAGCAACAACGT
C4 TTATTCTGGAGCAACAAAAGCAAAAAGAACAACTTGCAGAGCAACAACGT
C5 TTATTCTGGAGCAACAAAAGCAAAAAGAACAACTTGCAGAGCAACAACGT
C6 AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT
C7 AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT
C8 AAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGC
C9 AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGA
C10 TAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT
C11 TAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT
::** *********************** ***** **************
C1 CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA
C2 CAACAACGCCAGCAACAACTGCAAATACTCTATCAACAAAACAAA
C3 CAACAACGCCAGCAACAACTGCAAATACTCTATCAACAAAACAAA
C4 CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA
C5 CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA
C6 CTACAGCGCCAGCAGCAACTGCAACTACTCTATCAACAAAACAAA
C7 CAGCAACGCCAACAGCAACTGCAACTACTTTATCAACAAAACAAA
C8 CAACAACGCCAACAGCAACTGCAACTACTCTATCAACAAAACAAA
C9 CAGCAACGCCAGCAGCAACTGCAAATACTCTATCAACAAAACAAA
C10 CAACAGCGCCAGCAGCAACTGCAACTACTGTATCAACAAAACAAA
C11 CAACAACGCCAGCAGCAACTGCAACTACTCTATCAACAAAACAAA
*:.**.*****.** *********.**** ***************
>C1
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
TTATTCTGGAGCAACAAAAGCAAAAAGACCAACTGGCAGAGCAACAACGT
CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA
>C2
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTG
TTATTCTGGAGCAACAAAAGCAAAAAGACCAACTGGCAGAGCAACAACGT
CAACAACGCCAGCAACAACTGCAAATACTCTATCAACAAAACAAA
>C3
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTG
TTATTCTGGAGCAACAAAAGCAAAAAGAGCAACTGGCAGAGCAACAACGT
CAACAACGCCAGCAACAACTGCAAATACTCTATCAACAAAACAAA
>C4
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
TTATTCTGGAGCAACAAAAGCAAAAAGAACAACTTGCAGAGCAACAACGT
CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA
>C5
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
TTATTCTGGAGCAACAAAAGCAAAAAGAACAACTTGCAGAGCAACAACGT
CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA
>C6
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCTACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT
CTACAGCGCCAGCAGCAACTGCAACTACTCTATCAACAAAACAAA
>C7
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA
AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT
CAGCAACGCCAACAGCAACTGCAACTACTTTATCAACAAAACAAA
>C8
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG
ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
AAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGC
CAACAACGCCAACAGCAACTGCAACTACTCTATCAACAAAACAAA
>C9
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA
GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG
ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGA
CAGCAACGCCAGCAGCAACTGCAAATACTCTATCAACAAAACAAA
>C10
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA
GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG
ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACGAAAACGTG
TAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT
CAACAGCGCCAGCAGCAACTGCAACTACTGTATCAACAAAACAAA
>C11
ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA
GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC
TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC
TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA
CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA
AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC
AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG
ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA
TAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT
CAACAACGCCAGCAGCAACTGCAACTACTCTATCAACAAAACAAA
>C1
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
QQRQHQLQILYQQNK
>C2
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKDQLAEQQR
QQRQQQLQILYQQNK
>C3
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKEQLAEQQR
QQRQQQLQILYQQNK
>C4
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
QQRQHQLQILYQQNK
>C5
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
QQRQHQLQILYQQNK
>C6
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
LQRQQQLQLLYQQNK
>C7
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C8
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNSNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C9
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
NSPIGLYSNHNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
QQRQQQLQILYQQNK
>C10
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLERKRVILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
>C11
MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
QQRQQQLQLLYQQNK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 495 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481315899
Setting output file names to "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 103516080
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 3814299304
Seed = 1823355944
Swapseed = 1481315899
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 7 unique site patterns
Division 2 has 8 unique site patterns
Division 3 has 36 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1837.176406 -- -24.640631
Chain 2 -- -1849.531153 -- -24.640631
Chain 3 -- -1828.509848 -- -24.640631
Chain 4 -- -1829.512633 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1833.554100 -- -24.640631
Chain 2 -- -1849.743216 -- -24.640631
Chain 3 -- -1845.775700 -- -24.640631
Chain 4 -- -1853.482844 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1837.176] (-1849.531) (-1828.510) (-1829.513) * [-1833.554] (-1849.743) (-1845.776) (-1853.483)
500 -- (-1096.066) [-1082.967] (-1097.268) (-1097.149) * [-1088.413] (-1099.606) (-1098.253) (-1096.630) -- 0:00:00
1000 -- (-1068.063) [-1076.869] (-1080.875) (-1080.448) * (-1080.682) (-1088.785) [-1080.716] (-1091.676) -- 0:00:00
1500 -- [-1051.638] (-1069.486) (-1081.298) (-1065.961) * [-1061.898] (-1061.233) (-1080.462) (-1075.758) -- 0:00:00
2000 -- (-1053.682) [-1059.724] (-1057.111) (-1070.603) * (-1064.103) [-1070.351] (-1075.449) (-1072.598) -- 0:00:00
2500 -- [-1052.380] (-1066.909) (-1069.855) (-1060.848) * [-1056.290] (-1070.880) (-1066.422) (-1063.170) -- 0:00:00
3000 -- (-1066.759) [-1044.904] (-1067.291) (-1068.729) * (-1054.286) [-1058.413] (-1082.074) (-1070.744) -- 0:00:00
3500 -- (-1048.147) [-1053.382] (-1051.162) (-1053.163) * (-1052.302) (-1049.364) [-1061.596] (-1055.066) -- 0:00:00
4000 -- (-1057.772) (-1055.341) [-1049.569] (-1062.009) * [-1044.016] (-1043.826) (-1068.523) (-1056.441) -- 0:04:09
4500 -- (-1048.239) (-1046.719) (-1063.142) [-1050.634] * (-1065.239) [-1046.523] (-1060.220) (-1055.607) -- 0:03:41
5000 -- (-1056.831) (-1044.444) (-1056.300) [-1050.113] * [-1037.742] (-1055.322) (-1064.855) (-1060.734) -- 0:03:19
Average standard deviation of split frequencies: 0.073657
5500 -- [-1045.985] (-1041.846) (-1059.265) (-1053.190) * (-1047.671) (-1058.896) (-1063.653) [-1052.006] -- 0:03:00
6000 -- [-1045.471] (-1047.001) (-1051.475) (-1040.465) * [-1051.057] (-1071.984) (-1055.696) (-1045.829) -- 0:02:45
6500 -- (-1042.524) [-1043.378] (-1054.559) (-1055.044) * (-1041.774) (-1048.021) [-1050.479] (-1052.990) -- 0:02:32
7000 -- (-1044.367) [-1042.095] (-1056.098) (-1053.116) * [-1047.173] (-1047.717) (-1059.147) (-1040.157) -- 0:02:21
7500 -- (-1042.680) [-1037.475] (-1049.496) (-1046.937) * (-1051.411) (-1041.367) [-1039.056] (-1051.526) -- 0:02:12
8000 -- (-1048.630) [-1034.863] (-1067.512) (-1053.949) * [-1043.349] (-1043.464) (-1042.885) (-1050.418) -- 0:04:08
8500 -- (-1053.373) (-1041.177) (-1059.223) [-1045.128] * (-1050.577) [-1040.248] (-1050.629) (-1040.171) -- 0:03:53
9000 -- [-1043.984] (-1042.797) (-1066.691) (-1047.259) * [-1043.209] (-1048.917) (-1051.302) (-1043.643) -- 0:03:40
9500 -- [-1042.591] (-1064.377) (-1056.237) (-1059.398) * (-1046.003) (-1050.449) (-1049.146) [-1041.647] -- 0:03:28
10000 -- [-1041.610] (-1049.636) (-1040.868) (-1035.966) * (-1047.332) [-1039.303] (-1045.046) (-1048.034) -- 0:03:18
Average standard deviation of split frequencies: 0.077340
10500 -- [-1042.635] (-1053.012) (-1049.999) (-1044.075) * (-1053.256) [-1037.196] (-1056.200) (-1053.191) -- 0:03:08
11000 -- (-1046.166) (-1043.357) (-1037.559) [-1043.692] * [-1040.284] (-1050.729) (-1045.400) (-1057.420) -- 0:02:59
11500 -- (-1062.474) (-1043.397) [-1046.553] (-1042.775) * (-1053.286) (-1051.062) (-1037.506) [-1055.004] -- 0:02:51
12000 -- (-1054.228) [-1043.946] (-1053.799) (-1043.836) * (-1045.138) [-1037.878] (-1038.802) (-1044.781) -- 0:04:07
12500 -- (-1047.656) (-1062.362) [-1044.996] (-1049.414) * [-1046.541] (-1041.873) (-1043.978) (-1063.607) -- 0:03:57
13000 -- (-1051.784) (-1061.246) [-1047.007] (-1049.205) * (-1048.820) [-1043.237] (-1050.316) (-1041.809) -- 0:03:47
13500 -- [-1039.933] (-1058.681) (-1045.577) (-1045.154) * (-1051.439) (-1049.430) (-1044.442) [-1043.724] -- 0:03:39
14000 -- (-1044.715) (-1066.782) (-1053.349) [-1051.429] * [-1047.588] (-1059.626) (-1048.466) (-1050.071) -- 0:03:31
14500 -- (-1059.754) [-1053.752] (-1046.381) (-1048.817) * [-1051.067] (-1043.147) (-1056.484) (-1058.364) -- 0:03:23
15000 -- (-1049.553) (-1052.478) (-1056.665) [-1049.631] * (-1042.885) (-1059.616) (-1047.367) [-1038.494] -- 0:03:17
Average standard deviation of split frequencies: 0.048071
15500 -- (-1049.856) (-1054.814) (-1045.374) [-1041.001] * (-1057.038) (-1039.446) (-1048.291) [-1047.176] -- 0:03:10
16000 -- (-1065.328) (-1050.857) [-1035.478] (-1046.607) * (-1045.470) (-1039.452) [-1040.017] (-1046.026) -- 0:03:04
16500 -- (-1046.214) (-1057.562) [-1038.579] (-1046.058) * (-1045.081) (-1060.604) (-1047.613) [-1041.380] -- 0:03:58
17000 -- (-1054.303) (-1052.510) [-1037.131] (-1044.432) * (-1062.907) [-1045.425] (-1047.622) (-1052.208) -- 0:03:51
17500 -- (-1043.553) (-1051.360) [-1036.552] (-1052.634) * (-1064.203) [-1042.752] (-1046.654) (-1043.609) -- 0:03:44
18000 -- (-1048.862) (-1049.613) [-1041.507] (-1045.570) * (-1047.703) (-1061.989) (-1056.001) [-1041.788] -- 0:03:38
18500 -- (-1049.751) [-1047.371] (-1044.240) (-1048.514) * (-1048.806) [-1041.604] (-1054.997) (-1055.366) -- 0:03:32
19000 -- (-1052.031) (-1050.210) (-1053.812) [-1050.874] * [-1045.284] (-1041.450) (-1058.341) (-1053.215) -- 0:03:26
19500 -- (-1049.914) (-1046.636) (-1046.973) [-1043.197] * [-1046.719] (-1049.819) (-1042.704) (-1056.575) -- 0:03:21
20000 -- (-1063.971) (-1053.762) (-1053.027) [-1038.580] * (-1048.837) (-1046.241) [-1036.107] (-1047.638) -- 0:03:16
Average standard deviation of split frequencies: 0.059037
20500 -- (-1061.914) (-1042.187) [-1041.098] (-1040.275) * (-1059.155) (-1049.212) (-1056.095) [-1045.399] -- 0:03:58
21000 -- (-1060.449) (-1049.565) [-1035.318] (-1041.373) * (-1044.728) (-1042.768) [-1046.519] (-1054.917) -- 0:03:53
21500 -- (-1058.823) [-1049.271] (-1040.668) (-1049.009) * (-1046.445) (-1056.432) (-1046.427) [-1045.431] -- 0:03:47
22000 -- [-1050.267] (-1057.500) (-1053.411) (-1048.439) * [-1041.108] (-1049.554) (-1061.696) (-1047.832) -- 0:03:42
22500 -- (-1045.005) (-1045.036) (-1061.832) [-1034.708] * (-1062.121) (-1040.405) (-1051.635) [-1044.520] -- 0:03:37
23000 -- [-1043.737] (-1041.165) (-1043.708) (-1058.549) * (-1059.533) (-1054.705) (-1060.542) [-1044.573] -- 0:03:32
23500 -- (-1047.057) [-1044.486] (-1050.787) (-1044.479) * (-1040.783) [-1038.844] (-1047.019) (-1040.377) -- 0:03:27
24000 -- (-1054.762) [-1053.246] (-1044.817) (-1039.070) * (-1048.456) [-1034.907] (-1048.476) (-1048.973) -- 0:03:23
24500 -- (-1044.808) [-1042.600] (-1047.132) (-1051.463) * (-1051.563) (-1048.306) [-1050.581] (-1056.244) -- 0:03:19
25000 -- [-1045.931] (-1048.174) (-1064.819) (-1048.842) * [-1046.001] (-1051.195) (-1055.057) (-1046.820) -- 0:03:54
Average standard deviation of split frequencies: 0.044032
25500 -- (-1042.660) (-1052.809) (-1054.469) [-1039.720] * (-1046.191) [-1044.203] (-1062.205) (-1037.388) -- 0:03:49
26000 -- (-1043.893) (-1052.776) (-1034.724) [-1039.885] * (-1052.583) (-1046.433) (-1059.287) [-1044.837] -- 0:03:44
26500 -- (-1036.251) (-1063.071) (-1036.751) [-1038.781] * (-1051.982) (-1050.218) (-1053.908) [-1043.458] -- 0:03:40
27000 -- (-1047.398) (-1060.365) [-1039.189] (-1039.170) * [-1050.071] (-1048.203) (-1040.180) (-1037.039) -- 0:03:36
27500 -- (-1066.040) (-1051.395) (-1043.989) [-1040.431] * (-1039.173) [-1038.987] (-1058.606) (-1050.723) -- 0:03:32
28000 -- (-1045.204) (-1046.146) [-1048.341] (-1042.047) * [-1051.296] (-1051.254) (-1069.574) (-1038.489) -- 0:03:28
28500 -- (-1047.093) [-1055.116] (-1058.501) (-1040.562) * (-1047.769) [-1050.081] (-1046.750) (-1038.402) -- 0:03:24
29000 -- (-1048.194) (-1048.062) (-1041.469) [-1040.339] * [-1037.882] (-1045.346) (-1055.131) (-1048.171) -- 0:03:54
29500 -- (-1054.153) (-1050.427) [-1044.855] (-1044.974) * (-1048.948) (-1046.115) (-1043.756) [-1039.530] -- 0:03:50
30000 -- (-1059.624) [-1050.971] (-1043.090) (-1038.162) * [-1037.726] (-1050.753) (-1054.410) (-1040.059) -- 0:03:46
Average standard deviation of split frequencies: 0.040735
30500 -- (-1059.962) (-1057.756) (-1044.692) [-1046.230] * (-1063.920) (-1055.858) [-1046.916] (-1040.073) -- 0:03:42
31000 -- (-1055.437) (-1041.884) [-1046.069] (-1040.735) * (-1057.699) [-1057.716] (-1045.566) (-1047.864) -- 0:03:38
31500 -- [-1041.475] (-1053.587) (-1036.210) (-1059.769) * (-1059.012) (-1047.844) (-1051.107) [-1046.480] -- 0:03:35
32000 -- [-1049.477] (-1042.909) (-1052.380) (-1046.430) * [-1049.229] (-1046.371) (-1048.669) (-1053.172) -- 0:03:31
32500 -- (-1063.002) [-1053.285] (-1062.194) (-1044.051) * (-1050.141) (-1042.752) (-1052.307) [-1036.846] -- 0:03:28
33000 -- (-1055.679) (-1049.426) [-1042.770] (-1045.738) * (-1066.568) (-1044.702) (-1038.126) [-1037.880] -- 0:03:25
33500 -- (-1060.834) (-1038.578) (-1047.886) [-1045.080] * [-1049.143] (-1056.282) (-1046.792) (-1049.818) -- 0:03:50
34000 -- (-1050.450) (-1059.745) (-1036.778) [-1042.246] * (-1049.069) (-1072.702) (-1041.231) [-1041.812] -- 0:03:47
34500 -- (-1050.374) (-1046.877) (-1046.759) [-1038.922] * (-1060.470) (-1063.415) [-1035.349] (-1041.983) -- 0:03:43
35000 -- (-1053.249) (-1050.175) [-1042.819] (-1040.518) * (-1047.968) (-1057.940) [-1041.695] (-1045.790) -- 0:03:40
Average standard deviation of split frequencies: 0.042730
35500 -- (-1043.206) (-1061.468) (-1054.750) [-1045.575] * (-1050.565) [-1041.958] (-1042.524) (-1045.162) -- 0:03:37
36000 -- (-1054.232) (-1049.719) (-1045.299) [-1035.948] * (-1045.678) [-1045.593] (-1044.349) (-1050.363) -- 0:03:34
36500 -- (-1055.493) (-1064.388) (-1045.421) [-1042.412] * (-1041.656) (-1055.478) [-1042.674] (-1042.279) -- 0:03:31
37000 -- (-1048.412) [-1043.399] (-1054.975) (-1041.287) * (-1052.414) (-1043.869) (-1045.526) [-1038.040] -- 0:03:28
37500 -- (-1053.758) (-1045.258) (-1043.029) [-1037.832] * (-1049.153) [-1042.955] (-1053.947) (-1042.675) -- 0:03:51
38000 -- (-1048.643) (-1044.283) [-1043.304] (-1040.748) * (-1063.012) [-1042.086] (-1034.713) (-1038.828) -- 0:03:47
38500 -- [-1052.986] (-1050.964) (-1039.004) (-1040.017) * (-1056.901) (-1041.979) [-1040.202] (-1053.782) -- 0:03:44
39000 -- (-1054.494) (-1053.913) (-1051.368) [-1041.747] * (-1052.325) [-1043.526] (-1058.413) (-1048.660) -- 0:03:41
39500 -- (-1054.503) (-1054.785) (-1042.182) [-1037.568] * (-1050.297) (-1046.559) (-1057.536) [-1035.427] -- 0:03:38
40000 -- (-1062.092) (-1049.472) (-1040.965) [-1038.203] * (-1043.262) (-1045.301) (-1049.394) [-1044.182] -- 0:03:36
Average standard deviation of split frequencies: 0.032945
40500 -- (-1060.177) (-1054.231) [-1033.124] (-1049.799) * (-1046.197) [-1050.266] (-1045.073) (-1051.192) -- 0:03:33
41000 -- (-1063.817) [-1038.952] (-1045.341) (-1043.050) * (-1044.968) [-1045.698] (-1043.104) (-1054.451) -- 0:03:30
41500 -- (-1066.129) (-1040.580) [-1043.989] (-1038.830) * (-1041.983) (-1051.030) [-1048.951] (-1053.107) -- 0:03:27
42000 -- (-1053.103) (-1055.078) (-1045.493) [-1040.862] * [-1052.739] (-1046.670) (-1045.322) (-1045.262) -- 0:03:48
42500 -- (-1065.690) (-1045.725) (-1051.153) [-1039.609] * (-1045.741) (-1042.656) (-1058.344) [-1049.700] -- 0:03:45
43000 -- (-1055.930) (-1053.102) [-1036.042] (-1038.440) * (-1036.889) [-1040.918] (-1045.298) (-1055.235) -- 0:03:42
43500 -- (-1047.422) (-1043.518) (-1054.836) [-1036.247] * (-1044.757) [-1035.122] (-1040.240) (-1044.766) -- 0:03:39
44000 -- (-1055.306) (-1042.208) (-1045.117) [-1038.280] * (-1040.220) (-1069.291) [-1044.966] (-1043.739) -- 0:03:37
44500 -- (-1045.423) (-1065.280) [-1046.159] (-1039.376) * (-1039.711) (-1053.165) [-1042.039] (-1051.030) -- 0:03:34
45000 -- (-1051.517) (-1055.076) [-1038.867] (-1041.093) * (-1044.009) [-1040.930] (-1045.254) (-1050.606) -- 0:03:32
Average standard deviation of split frequencies: 0.036677
45500 -- [-1038.487] (-1042.652) (-1041.875) (-1051.285) * [-1035.441] (-1052.231) (-1043.856) (-1047.265) -- 0:03:29
46000 -- (-1047.011) [-1047.504] (-1044.993) (-1043.525) * [-1035.360] (-1054.596) (-1056.417) (-1046.112) -- 0:03:48
46500 -- (-1057.679) (-1058.239) [-1044.759] (-1040.324) * (-1038.962) [-1041.265] (-1043.603) (-1040.175) -- 0:03:45
47000 -- (-1046.735) (-1067.622) [-1037.571] (-1057.516) * [-1049.366] (-1054.492) (-1041.259) (-1055.431) -- 0:03:43
47500 -- [-1034.647] (-1050.836) (-1036.841) (-1044.983) * (-1044.236) (-1052.091) (-1047.844) [-1040.487] -- 0:03:40
48000 -- [-1035.695] (-1053.437) (-1048.421) (-1050.998) * (-1044.287) (-1050.074) (-1045.690) [-1034.265] -- 0:03:38
48500 -- [-1040.375] (-1054.041) (-1038.182) (-1052.762) * (-1048.726) (-1043.270) [-1036.147] (-1044.533) -- 0:03:35
49000 -- (-1037.243) [-1045.589] (-1045.351) (-1051.850) * (-1053.477) [-1038.953] (-1051.520) (-1039.831) -- 0:03:33
49500 -- (-1053.767) (-1052.977) [-1039.867] (-1050.269) * (-1047.063) (-1050.043) (-1044.389) [-1040.633] -- 0:03:31
50000 -- [-1037.200] (-1046.939) (-1044.728) (-1051.258) * (-1050.423) [-1033.653] (-1051.428) (-1044.765) -- 0:03:29
Average standard deviation of split frequencies: 0.038767
50500 -- (-1050.254) (-1046.343) (-1047.287) [-1038.119] * (-1045.231) [-1047.462] (-1052.716) (-1048.093) -- 0:03:45
51000 -- (-1055.318) (-1048.813) (-1043.283) [-1041.701] * (-1045.624) [-1044.940] (-1062.287) (-1048.816) -- 0:03:43
51500 -- [-1042.240] (-1050.795) (-1048.051) (-1041.577) * (-1047.149) (-1049.900) [-1042.281] (-1046.733) -- 0:03:41
52000 -- (-1063.365) (-1054.382) (-1042.938) [-1049.387] * [-1038.943] (-1044.786) (-1042.322) (-1039.159) -- 0:03:38
52500 -- (-1055.271) (-1042.790) [-1032.350] (-1035.963) * (-1051.433) [-1045.525] (-1049.924) (-1052.593) -- 0:03:36
53000 -- (-1066.750) [-1041.874] (-1038.026) (-1053.244) * [-1038.431] (-1042.614) (-1055.600) (-1049.204) -- 0:03:34
53500 -- (-1045.388) (-1043.476) [-1051.741] (-1052.443) * [-1036.204] (-1046.701) (-1061.147) (-1046.860) -- 0:03:32
54000 -- (-1045.785) [-1035.087] (-1049.919) (-1043.170) * (-1043.485) (-1044.847) (-1054.805) [-1048.792] -- 0:03:30
54500 -- (-1055.281) [-1046.800] (-1046.103) (-1049.502) * [-1040.661] (-1049.479) (-1049.681) (-1044.807) -- 0:03:45
55000 -- (-1047.171) (-1053.572) (-1050.741) [-1036.862] * (-1051.629) (-1051.531) [-1053.679] (-1048.904) -- 0:03:43
Average standard deviation of split frequencies: 0.035075
55500 -- (-1056.474) (-1058.228) [-1052.817] (-1039.748) * (-1045.034) [-1038.693] (-1040.396) (-1043.845) -- 0:03:41
56000 -- [-1048.266] (-1051.262) (-1056.139) (-1042.884) * (-1040.637) (-1049.031) [-1040.348] (-1049.498) -- 0:03:39
56500 -- (-1051.035) (-1040.209) (-1058.676) [-1044.587] * [-1046.999] (-1037.393) (-1056.818) (-1046.742) -- 0:03:37
57000 -- (-1043.588) (-1050.741) (-1056.776) [-1039.244] * (-1041.525) [-1048.437] (-1049.888) (-1041.986) -- 0:03:35
57500 -- (-1040.694) [-1047.881] (-1053.639) (-1046.465) * (-1050.271) [-1046.272] (-1044.415) (-1055.546) -- 0:03:33
58000 -- [-1032.716] (-1046.158) (-1047.016) (-1051.590) * [-1049.606] (-1043.759) (-1043.770) (-1053.331) -- 0:03:31
58500 -- (-1040.088) (-1059.602) (-1052.977) [-1046.168] * (-1048.521) [-1034.179] (-1053.328) (-1057.366) -- 0:03:29
59000 -- [-1042.259] (-1059.279) (-1055.846) (-1052.799) * [-1045.833] (-1056.215) (-1034.668) (-1048.857) -- 0:03:43
59500 -- (-1048.741) [-1052.536] (-1056.724) (-1044.208) * [-1040.369] (-1046.410) (-1051.061) (-1049.096) -- 0:03:41
60000 -- (-1046.455) (-1043.655) (-1050.637) [-1034.162] * (-1055.971) [-1037.294] (-1057.357) (-1048.703) -- 0:03:39
Average standard deviation of split frequencies: 0.033240
60500 -- (-1044.238) (-1046.624) (-1068.120) [-1040.168] * (-1038.897) [-1036.110] (-1058.446) (-1055.125) -- 0:03:37
61000 -- (-1043.188) [-1037.448] (-1061.571) (-1056.737) * (-1048.992) [-1050.219] (-1057.364) (-1052.534) -- 0:03:35
61500 -- (-1037.287) [-1042.588] (-1070.826) (-1050.045) * [-1057.771] (-1046.066) (-1043.560) (-1052.441) -- 0:03:33
62000 -- (-1048.466) [-1041.335] (-1056.485) (-1052.183) * (-1046.070) (-1043.397) (-1042.777) [-1049.798] -- 0:03:31
62500 -- (-1051.992) (-1070.243) (-1048.392) [-1049.536] * (-1041.630) (-1059.054) [-1046.735] (-1045.606) -- 0:03:30
63000 -- [-1033.746] (-1053.777) (-1054.247) (-1048.855) * (-1066.812) [-1047.292] (-1042.614) (-1049.855) -- 0:03:43
63500 -- (-1045.891) (-1050.598) (-1056.397) [-1057.746] * (-1053.803) (-1043.177) [-1035.633] (-1044.930) -- 0:03:41
64000 -- (-1050.064) [-1039.135] (-1046.075) (-1040.784) * (-1049.117) (-1043.342) [-1037.534] (-1049.051) -- 0:03:39
64500 -- (-1043.028) [-1052.264] (-1064.424) (-1040.093) * (-1064.186) (-1047.564) (-1036.883) [-1043.573] -- 0:03:37
65000 -- [-1045.114] (-1049.518) (-1060.899) (-1044.116) * (-1048.270) (-1047.665) [-1048.795] (-1048.073) -- 0:03:35
Average standard deviation of split frequencies: 0.032538
65500 -- (-1066.121) [-1044.328] (-1055.906) (-1039.753) * (-1051.931) (-1040.795) (-1042.965) [-1051.218] -- 0:03:34
66000 -- (-1050.890) (-1049.733) [-1038.229] (-1048.963) * [-1043.282] (-1054.164) (-1053.940) (-1047.832) -- 0:03:32
66500 -- (-1047.617) [-1046.437] (-1047.026) (-1042.223) * (-1055.261) [-1044.718] (-1056.752) (-1055.528) -- 0:03:30
67000 -- (-1052.629) (-1051.571) (-1056.126) [-1044.278] * (-1052.769) [-1051.260] (-1043.115) (-1047.108) -- 0:03:42
67500 -- (-1053.416) (-1058.552) (-1041.407) [-1039.620] * [-1035.625] (-1054.955) (-1051.041) (-1053.989) -- 0:03:41
68000 -- (-1049.336) [-1035.239] (-1049.268) (-1041.712) * (-1058.717) [-1045.304] (-1048.647) (-1057.328) -- 0:03:39
68500 -- (-1053.731) [-1034.306] (-1040.599) (-1048.088) * (-1051.538) (-1034.436) (-1045.505) [-1036.084] -- 0:03:37
69000 -- (-1056.125) [-1046.043] (-1056.562) (-1043.916) * (-1041.220) (-1047.592) (-1039.875) [-1038.165] -- 0:03:35
69500 -- (-1077.319) (-1036.277) [-1050.788] (-1039.594) * (-1050.029) [-1040.528] (-1043.747) (-1047.405) -- 0:03:34
70000 -- (-1058.246) [-1047.203] (-1053.484) (-1042.786) * (-1053.524) (-1035.841) (-1045.534) [-1041.348] -- 0:03:32
Average standard deviation of split frequencies: 0.029141
70500 -- (-1047.666) (-1050.143) (-1041.084) [-1040.964] * (-1051.625) (-1044.299) [-1037.612] (-1044.740) -- 0:03:30
71000 -- (-1050.835) (-1048.410) [-1047.824] (-1039.572) * (-1053.018) (-1042.963) [-1033.559] (-1044.420) -- 0:03:29
71500 -- (-1064.014) (-1054.264) [-1042.436] (-1043.662) * (-1059.871) (-1041.018) [-1036.651] (-1046.042) -- 0:03:40
72000 -- (-1058.545) (-1038.459) (-1049.956) [-1038.208] * (-1062.655) [-1041.677] (-1043.414) (-1046.074) -- 0:03:39
72500 -- (-1051.295) [-1036.692] (-1052.729) (-1033.100) * (-1059.223) [-1036.935] (-1037.518) (-1044.730) -- 0:03:37
73000 -- (-1052.036) (-1043.217) [-1044.355] (-1042.537) * [-1044.518] (-1045.712) (-1045.407) (-1044.214) -- 0:03:35
73500 -- (-1060.775) (-1048.340) [-1052.766] (-1075.988) * (-1051.986) (-1046.272) (-1044.646) [-1033.822] -- 0:03:34
74000 -- (-1055.954) [-1039.575] (-1045.937) (-1043.455) * (-1052.588) (-1057.160) [-1037.769] (-1047.881) -- 0:03:32
74500 -- (-1069.048) (-1044.183) (-1055.019) [-1040.373] * (-1056.000) (-1046.715) (-1037.506) [-1036.479] -- 0:03:31
75000 -- [-1043.723] (-1040.039) (-1049.292) (-1036.692) * (-1053.012) (-1040.891) [-1049.315] (-1039.826) -- 0:03:29
Average standard deviation of split frequencies: 0.025155
75500 -- (-1042.440) (-1047.134) (-1048.917) [-1047.273] * (-1052.419) [-1039.808] (-1046.060) (-1044.958) -- 0:03:40
76000 -- [-1042.360] (-1048.730) (-1050.706) (-1044.431) * (-1046.576) [-1056.992] (-1045.383) (-1059.946) -- 0:03:38
76500 -- (-1050.796) (-1047.153) [-1050.529] (-1048.710) * (-1064.230) (-1056.678) [-1032.896] (-1045.738) -- 0:03:37
77000 -- (-1038.001) (-1043.968) (-1042.296) [-1044.236] * [-1045.472] (-1051.968) (-1037.129) (-1046.403) -- 0:03:35
77500 -- (-1047.054) (-1058.407) (-1041.234) [-1049.201] * (-1050.636) (-1054.328) [-1043.883] (-1036.064) -- 0:03:34
78000 -- (-1045.444) [-1043.035] (-1047.787) (-1052.958) * (-1050.983) [-1047.398] (-1040.030) (-1045.734) -- 0:03:32
78500 -- (-1055.966) (-1049.171) (-1052.235) [-1040.699] * (-1055.831) (-1054.007) [-1037.920] (-1046.820) -- 0:03:31
79000 -- [-1045.150] (-1048.690) (-1052.739) (-1043.216) * [-1048.342] (-1040.350) (-1042.965) (-1038.649) -- 0:03:29
79500 -- (-1052.360) [-1041.801] (-1046.401) (-1047.254) * (-1047.996) [-1040.375] (-1041.854) (-1052.847) -- 0:03:28
80000 -- (-1046.253) (-1045.540) (-1061.369) [-1046.653] * [-1045.144] (-1047.213) (-1043.436) (-1056.701) -- 0:03:38
Average standard deviation of split frequencies: 0.019938
80500 -- [-1047.484] (-1044.424) (-1046.273) (-1068.516) * (-1052.823) [-1050.444] (-1041.854) (-1054.360) -- 0:03:37
81000 -- (-1053.164) [-1043.445] (-1055.029) (-1044.781) * (-1047.697) [-1048.586] (-1051.030) (-1050.700) -- 0:03:35
81500 -- (-1051.814) [-1040.630] (-1042.019) (-1046.999) * (-1049.098) (-1051.202) [-1036.543] (-1049.687) -- 0:03:34
82000 -- (-1043.196) [-1041.163] (-1039.103) (-1061.032) * (-1041.678) [-1050.340] (-1040.996) (-1059.086) -- 0:03:32
82500 -- [-1046.753] (-1045.284) (-1047.110) (-1057.464) * [-1041.331] (-1045.473) (-1056.747) (-1053.469) -- 0:03:31
83000 -- (-1056.969) [-1047.314] (-1038.615) (-1047.478) * (-1047.692) (-1048.964) (-1053.065) [-1051.669] -- 0:03:29
83500 -- (-1054.330) [-1038.878] (-1037.338) (-1062.850) * (-1046.948) (-1038.211) (-1059.667) [-1043.179] -- 0:03:28
84000 -- (-1042.161) [-1049.469] (-1052.992) (-1051.860) * (-1038.722) [-1045.513] (-1065.222) (-1055.821) -- 0:03:27
84500 -- (-1043.258) (-1046.640) [-1048.165] (-1054.110) * [-1048.580] (-1048.526) (-1063.613) (-1058.607) -- 0:03:36
85000 -- (-1049.720) (-1054.002) [-1044.198] (-1056.902) * [-1042.867] (-1043.116) (-1040.928) (-1059.856) -- 0:03:35
Average standard deviation of split frequencies: 0.019991
85500 -- (-1038.415) (-1047.888) [-1044.677] (-1071.909) * (-1056.814) (-1056.330) (-1052.691) [-1038.365] -- 0:03:33
86000 -- (-1042.856) [-1044.042] (-1044.547) (-1058.297) * [-1043.721] (-1040.854) (-1070.406) (-1051.054) -- 0:03:32
86500 -- [-1037.790] (-1045.079) (-1057.272) (-1050.799) * (-1054.290) (-1047.125) (-1039.581) [-1047.280] -- 0:03:31
87000 -- (-1039.176) (-1042.365) [-1047.814] (-1049.520) * (-1049.037) (-1039.058) (-1043.932) [-1050.267] -- 0:03:29
87500 -- (-1052.239) (-1042.384) [-1039.953] (-1043.138) * (-1049.904) (-1055.628) (-1041.615) [-1042.927] -- 0:03:28
88000 -- (-1048.104) (-1046.595) [-1046.371] (-1046.610) * (-1051.181) [-1036.577] (-1044.060) (-1044.294) -- 0:03:27
88500 -- (-1056.863) (-1053.299) [-1049.980] (-1063.397) * (-1053.986) (-1054.089) (-1049.710) [-1050.123] -- 0:03:36
89000 -- (-1049.665) (-1050.797) [-1040.174] (-1048.812) * (-1046.997) [-1047.340] (-1045.265) (-1049.257) -- 0:03:34
89500 -- [-1043.418] (-1043.365) (-1055.606) (-1070.025) * (-1050.257) (-1060.702) (-1052.657) [-1053.558] -- 0:03:33
90000 -- (-1044.388) (-1045.750) [-1044.321] (-1058.294) * (-1054.474) [-1043.617] (-1056.538) (-1049.117) -- 0:03:32
Average standard deviation of split frequencies: 0.018523
90500 -- (-1045.209) (-1053.167) [-1042.065] (-1048.054) * (-1052.359) (-1049.335) [-1046.780] (-1054.770) -- 0:03:31
91000 -- (-1051.081) [-1041.919] (-1049.113) (-1050.562) * (-1053.672) (-1042.290) [-1042.092] (-1057.008) -- 0:03:29
91500 -- (-1058.623) [-1035.408] (-1052.854) (-1054.036) * (-1054.567) (-1048.050) [-1043.690] (-1051.132) -- 0:03:28
92000 -- (-1047.215) (-1042.471) (-1056.142) [-1044.640] * (-1049.761) (-1045.406) (-1042.908) [-1043.934] -- 0:03:27
92500 -- (-1042.452) [-1042.776] (-1045.695) (-1047.058) * (-1048.809) [-1044.482] (-1040.156) (-1073.784) -- 0:03:26
93000 -- (-1045.738) [-1042.995] (-1059.257) (-1060.314) * [-1046.718] (-1045.426) (-1053.736) (-1069.203) -- 0:03:34
93500 -- (-1054.895) (-1054.391) [-1049.334] (-1061.578) * (-1056.112) [-1043.546] (-1038.875) (-1049.333) -- 0:03:33
94000 -- (-1041.269) (-1046.928) [-1049.362] (-1054.089) * (-1053.996) (-1043.152) [-1037.291] (-1038.955) -- 0:03:32
94500 -- (-1046.025) (-1039.857) (-1062.878) [-1051.254] * (-1048.859) (-1058.375) (-1041.402) [-1036.695] -- 0:03:30
95000 -- (-1041.108) (-1052.507) [-1051.461] (-1052.541) * (-1059.853) [-1045.275] (-1060.474) (-1040.774) -- 0:03:29
Average standard deviation of split frequencies: 0.016266
95500 -- (-1052.981) (-1068.337) [-1046.481] (-1053.565) * (-1050.897) (-1053.217) (-1055.235) [-1034.512] -- 0:03:28
96000 -- [-1041.893] (-1055.994) (-1057.020) (-1050.150) * (-1061.728) [-1044.913] (-1044.740) (-1042.571) -- 0:03:27
96500 -- (-1059.864) (-1061.678) (-1051.556) [-1038.371] * (-1042.285) (-1043.399) [-1033.923] (-1047.597) -- 0:03:25
97000 -- (-1047.453) [-1038.311] (-1045.814) (-1047.283) * (-1047.394) (-1045.035) (-1036.911) [-1038.610] -- 0:03:34
97500 -- [-1037.707] (-1054.669) (-1062.243) (-1050.867) * (-1046.369) [-1037.476] (-1054.186) (-1044.297) -- 0:03:32
98000 -- (-1040.837) (-1054.454) [-1042.007] (-1043.755) * (-1046.432) [-1041.840] (-1051.478) (-1039.956) -- 0:03:31
98500 -- [-1040.640] (-1048.313) (-1045.161) (-1043.018) * (-1050.193) [-1039.556] (-1064.904) (-1046.042) -- 0:03:30
99000 -- (-1044.904) (-1069.792) (-1048.535) [-1041.733] * (-1048.742) (-1046.496) (-1047.214) [-1038.234] -- 0:03:29
99500 -- (-1045.860) [-1042.000] (-1045.974) (-1040.791) * (-1053.450) (-1065.515) (-1046.423) [-1045.894] -- 0:03:28
100000 -- (-1059.893) (-1055.085) [-1048.834] (-1055.398) * (-1036.753) (-1071.364) [-1035.277] (-1042.356) -- 0:03:27
Average standard deviation of split frequencies: 0.013714
100500 -- (-1063.199) [-1044.157] (-1064.341) (-1042.604) * (-1046.764) (-1065.579) [-1040.850] (-1042.892) -- 0:03:25
101000 -- (-1041.061) (-1042.142) [-1052.128] (-1049.047) * (-1046.619) (-1045.903) (-1040.911) [-1039.915] -- 0:03:24
101500 -- (-1052.758) [-1056.298] (-1044.382) (-1055.107) * (-1042.056) (-1046.836) (-1051.734) [-1042.243] -- 0:03:32
102000 -- [-1047.743] (-1048.823) (-1043.315) (-1048.552) * [-1046.875] (-1054.276) (-1055.753) (-1048.281) -- 0:03:31
102500 -- [-1040.717] (-1051.611) (-1043.637) (-1053.133) * (-1052.313) (-1046.667) [-1043.571] (-1044.261) -- 0:03:30
103000 -- (-1053.606) (-1068.505) [-1053.263] (-1045.439) * (-1041.440) (-1040.426) (-1040.613) [-1042.053] -- 0:03:29
103500 -- (-1056.275) (-1053.725) (-1051.563) [-1039.543] * (-1052.267) (-1035.825) (-1043.653) [-1054.337] -- 0:03:27
104000 -- (-1048.233) (-1065.952) (-1045.936) [-1050.442] * (-1039.641) (-1046.538) (-1047.704) [-1049.963] -- 0:03:26
104500 -- [-1040.264] (-1049.466) (-1046.230) (-1051.973) * (-1043.926) [-1043.520] (-1048.037) (-1047.529) -- 0:03:25
105000 -- (-1052.570) (-1049.032) [-1050.883] (-1045.155) * (-1052.889) (-1046.610) [-1048.069] (-1042.365) -- 0:03:24
Average standard deviation of split frequencies: 0.016306
105500 -- (-1058.280) [-1047.198] (-1046.951) (-1056.874) * (-1044.784) (-1041.235) (-1050.012) [-1055.669] -- 0:03:31
106000 -- [-1052.951] (-1044.572) (-1046.253) (-1051.982) * (-1037.190) (-1044.892) [-1050.017] (-1049.088) -- 0:03:30
106500 -- (-1060.503) (-1048.889) [-1051.619] (-1051.236) * (-1038.379) (-1042.658) [-1043.395] (-1061.511) -- 0:03:29
107000 -- (-1059.163) [-1046.369] (-1053.841) (-1052.802) * (-1038.606) (-1047.449) [-1041.973] (-1076.481) -- 0:03:28
107500 -- (-1062.680) (-1043.470) (-1054.370) [-1042.796] * (-1037.225) (-1050.058) [-1035.670] (-1067.295) -- 0:03:27
108000 -- (-1044.934) [-1041.265] (-1072.053) (-1055.505) * (-1039.434) (-1051.925) [-1043.204] (-1051.115) -- 0:03:26
108500 -- (-1043.216) (-1050.865) (-1071.819) [-1045.540] * [-1038.658] (-1038.475) (-1052.468) (-1050.350) -- 0:03:25
109000 -- (-1054.712) [-1038.059] (-1059.124) (-1038.556) * [-1041.019] (-1044.611) (-1056.873) (-1068.147) -- 0:03:24
109500 -- (-1052.214) (-1046.246) (-1043.360) [-1044.379] * (-1044.353) (-1037.381) (-1050.618) [-1041.186] -- 0:03:31
110000 -- (-1049.931) [-1045.085] (-1052.877) (-1045.664) * (-1044.099) (-1050.354) (-1049.101) [-1043.457] -- 0:03:30
Average standard deviation of split frequencies: 0.016471
110500 -- (-1054.746) (-1047.663) [-1043.788] (-1045.890) * (-1044.103) [-1053.188] (-1056.467) (-1048.185) -- 0:03:29
111000 -- (-1047.837) (-1043.770) (-1055.656) [-1047.744] * (-1054.730) (-1049.794) [-1037.656] (-1039.808) -- 0:03:28
111500 -- [-1047.699] (-1044.339) (-1059.906) (-1055.538) * (-1044.624) (-1050.142) [-1035.754] (-1044.406) -- 0:03:27
112000 -- (-1042.946) [-1045.554] (-1053.382) (-1044.637) * (-1043.205) (-1051.185) (-1047.726) [-1040.004] -- 0:03:26
112500 -- (-1047.370) (-1045.236) [-1043.553] (-1043.380) * (-1051.912) (-1049.382) (-1051.521) [-1049.602] -- 0:03:25
113000 -- (-1049.038) (-1036.777) [-1040.733] (-1056.080) * (-1044.871) (-1048.180) [-1043.986] (-1057.025) -- 0:03:24
113500 -- (-1051.235) (-1053.399) (-1050.663) [-1052.737] * (-1046.253) (-1050.153) [-1041.301] (-1045.299) -- 0:03:23
114000 -- [-1047.931] (-1047.420) (-1050.899) (-1052.257) * (-1040.669) (-1049.620) [-1036.028] (-1049.437) -- 0:03:29
114500 -- (-1052.169) (-1046.416) [-1048.550] (-1042.683) * (-1038.360) (-1048.934) (-1048.162) [-1037.026] -- 0:03:28
115000 -- (-1059.770) [-1036.427] (-1056.604) (-1057.697) * (-1057.543) (-1056.853) [-1032.779] (-1039.692) -- 0:03:27
Average standard deviation of split frequencies: 0.016526
115500 -- (-1056.573) [-1053.560] (-1067.411) (-1044.996) * [-1033.440] (-1049.914) (-1045.803) (-1047.141) -- 0:03:26
116000 -- (-1059.704) [-1050.632] (-1055.586) (-1055.857) * [-1034.397] (-1047.281) (-1049.645) (-1051.095) -- 0:03:25
116500 -- (-1079.531) [-1039.888] (-1050.011) (-1040.290) * [-1035.789] (-1053.176) (-1049.668) (-1045.763) -- 0:03:24
117000 -- (-1054.261) (-1054.030) [-1045.616] (-1060.792) * (-1041.487) (-1043.438) (-1049.089) [-1038.306] -- 0:03:23
117500 -- (-1064.895) [-1044.502] (-1046.638) (-1056.653) * (-1044.196) (-1041.396) (-1050.679) [-1042.302] -- 0:03:22
118000 -- (-1050.488) [-1042.225] (-1058.553) (-1054.845) * (-1046.858) (-1059.082) (-1049.431) [-1043.206] -- 0:03:21
118500 -- (-1057.611) (-1048.147) [-1044.219] (-1060.146) * (-1055.689) (-1038.358) (-1042.402) [-1038.222] -- 0:03:28
119000 -- [-1043.640] (-1049.685) (-1060.045) (-1054.621) * (-1051.250) [-1046.484] (-1041.798) (-1038.169) -- 0:03:27
119500 -- (-1068.098) [-1044.192] (-1054.853) (-1059.568) * [-1048.728] (-1053.360) (-1040.506) (-1041.864) -- 0:03:26
120000 -- (-1045.118) (-1041.282) [-1056.584] (-1045.784) * (-1067.319) (-1055.719) (-1043.575) [-1046.519] -- 0:03:25
Average standard deviation of split frequencies: 0.017189
120500 -- [-1043.940] (-1043.089) (-1053.084) (-1037.680) * (-1051.669) (-1051.453) [-1041.644] (-1052.819) -- 0:03:24
121000 -- (-1063.519) (-1047.456) [-1045.093] (-1044.864) * (-1049.380) (-1048.645) (-1045.254) [-1040.858] -- 0:03:23
121500 -- (-1047.477) [-1042.223] (-1043.027) (-1046.562) * (-1061.928) (-1054.818) (-1053.860) [-1050.428] -- 0:03:22
122000 -- (-1061.933) [-1038.120] (-1043.299) (-1042.223) * (-1070.981) (-1042.788) (-1052.140) [-1033.515] -- 0:03:21
122500 -- [-1040.632] (-1041.415) (-1045.427) (-1034.122) * (-1057.694) (-1039.915) [-1047.398] (-1041.092) -- 0:03:27
123000 -- [-1040.080] (-1045.128) (-1041.888) (-1044.509) * [-1044.998] (-1063.242) (-1041.997) (-1054.306) -- 0:03:26
123500 -- (-1055.449) [-1039.751] (-1046.104) (-1048.804) * (-1053.296) (-1048.714) (-1048.681) [-1041.709] -- 0:03:25
124000 -- (-1048.558) [-1038.798] (-1046.823) (-1039.077) * (-1071.010) (-1041.959) [-1041.244] (-1047.915) -- 0:03:24
124500 -- [-1044.589] (-1038.608) (-1045.431) (-1052.930) * (-1063.438) (-1048.160) [-1045.548] (-1036.515) -- 0:03:23
125000 -- (-1044.203) [-1043.272] (-1048.735) (-1060.033) * (-1050.098) (-1043.265) [-1039.653] (-1054.163) -- 0:03:23
Average standard deviation of split frequencies: 0.012970
125500 -- (-1044.455) [-1048.957] (-1050.122) (-1041.218) * (-1053.969) (-1052.563) (-1044.079) [-1046.333] -- 0:03:22
126000 -- (-1053.171) (-1042.008) (-1062.653) [-1038.273] * (-1053.246) [-1043.599] (-1054.269) (-1060.315) -- 0:03:21
126500 -- (-1063.861) (-1042.860) [-1039.040] (-1045.373) * (-1040.362) (-1054.926) (-1058.034) [-1049.562] -- 0:03:20
127000 -- (-1044.910) [-1037.349] (-1043.504) (-1055.997) * [-1045.875] (-1053.327) (-1049.505) (-1054.593) -- 0:03:26
127500 -- (-1047.100) [-1049.743] (-1064.978) (-1053.634) * (-1047.841) [-1051.019] (-1056.175) (-1053.889) -- 0:03:25
128000 -- (-1053.707) [-1042.913] (-1061.911) (-1045.428) * (-1046.605) (-1052.549) (-1060.631) [-1042.317] -- 0:03:24
128500 -- (-1048.155) (-1052.413) (-1046.818) [-1046.961] * (-1045.853) (-1056.859) (-1064.435) [-1048.010] -- 0:03:23
129000 -- [-1041.303] (-1048.818) (-1046.688) (-1037.282) * (-1041.040) (-1049.901) [-1047.162] (-1052.868) -- 0:03:22
129500 -- [-1041.245] (-1061.348) (-1053.919) (-1045.385) * (-1072.752) (-1040.819) (-1055.875) [-1039.177] -- 0:03:21
130000 -- (-1040.935) (-1046.232) (-1043.775) [-1044.114] * (-1045.426) (-1043.205) (-1059.859) [-1040.487] -- 0:03:20
Average standard deviation of split frequencies: 0.010342
130500 -- (-1048.935) [-1044.426] (-1044.460) (-1051.856) * (-1046.188) (-1037.690) [-1052.748] (-1043.685) -- 0:03:19
131000 -- [-1046.195] (-1040.905) (-1050.635) (-1045.413) * (-1040.573) [-1056.483] (-1067.912) (-1049.879) -- 0:03:25
131500 -- [-1041.101] (-1046.986) (-1047.930) (-1042.013) * (-1061.232) [-1038.476] (-1048.241) (-1058.440) -- 0:03:24
132000 -- (-1044.275) [-1043.400] (-1050.765) (-1049.044) * (-1048.278) (-1037.212) (-1071.519) [-1049.075] -- 0:03:23
132500 -- (-1057.107) (-1047.260) [-1048.077] (-1036.505) * (-1045.401) [-1040.783] (-1044.650) (-1068.599) -- 0:03:22
133000 -- (-1041.998) (-1046.688) (-1051.835) [-1050.655] * (-1051.747) [-1051.752] (-1052.180) (-1062.126) -- 0:03:22
133500 -- [-1050.424] (-1047.457) (-1044.515) (-1055.657) * (-1049.974) (-1042.059) (-1050.131) [-1047.872] -- 0:03:21
134000 -- [-1052.271] (-1051.758) (-1045.033) (-1047.620) * (-1047.237) (-1043.186) [-1039.554] (-1050.131) -- 0:03:20
134500 -- (-1038.406) (-1056.355) (-1051.411) [-1041.448] * (-1040.738) [-1046.953] (-1040.436) (-1056.221) -- 0:03:19
135000 -- (-1046.622) [-1048.857] (-1047.423) (-1052.661) * (-1050.186) (-1041.440) (-1051.229) [-1042.038] -- 0:03:25
Average standard deviation of split frequencies: 0.010399
135500 -- (-1043.388) (-1046.630) (-1041.128) [-1047.331] * (-1038.977) (-1051.125) [-1045.080] (-1044.975) -- 0:03:24
136000 -- (-1040.332) [-1048.356] (-1043.444) (-1054.047) * [-1036.472] (-1044.590) (-1051.921) (-1058.383) -- 0:03:23
136500 -- [-1047.086] (-1044.253) (-1060.954) (-1049.631) * (-1042.380) (-1043.565) [-1050.970] (-1060.577) -- 0:03:22
137000 -- (-1045.240) (-1055.297) [-1039.449] (-1051.403) * (-1054.976) [-1039.496] (-1049.492) (-1050.242) -- 0:03:21
137500 -- (-1047.200) (-1048.536) [-1054.406] (-1051.591) * [-1044.918] (-1048.198) (-1055.839) (-1038.194) -- 0:03:20
138000 -- [-1044.958] (-1051.252) (-1051.100) (-1042.466) * (-1042.609) [-1051.758] (-1058.480) (-1050.187) -- 0:03:19
138500 -- (-1039.179) (-1054.470) [-1045.449] (-1046.126) * (-1049.477) [-1046.631] (-1044.588) (-1052.797) -- 0:03:19
139000 -- [-1042.305] (-1051.473) (-1041.423) (-1045.831) * (-1047.727) [-1039.794] (-1055.852) (-1052.488) -- 0:03:18
139500 -- [-1038.700] (-1043.663) (-1044.360) (-1042.405) * (-1047.971) [-1035.526] (-1051.275) (-1040.378) -- 0:03:23
140000 -- [-1041.779] (-1048.665) (-1040.405) (-1054.513) * (-1048.123) (-1055.013) (-1050.294) [-1036.965] -- 0:03:22
Average standard deviation of split frequencies: 0.010724
140500 -- (-1053.401) (-1036.463) (-1044.995) [-1048.214] * [-1034.836] (-1046.412) (-1047.223) (-1043.481) -- 0:03:21
141000 -- [-1043.993] (-1046.289) (-1044.741) (-1064.841) * (-1043.174) (-1051.315) (-1047.343) [-1033.141] -- 0:03:21
141500 -- (-1042.544) (-1047.312) [-1052.152] (-1043.276) * (-1043.187) (-1047.695) [-1043.117] (-1068.674) -- 0:03:20
142000 -- (-1041.347) (-1057.442) [-1042.279] (-1052.873) * (-1051.513) (-1049.413) [-1041.151] (-1057.954) -- 0:03:19
142500 -- (-1049.277) (-1057.341) [-1041.276] (-1053.166) * [-1050.771] (-1054.831) (-1051.294) (-1039.309) -- 0:03:18
143000 -- [-1045.199] (-1050.806) (-1051.901) (-1048.801) * (-1044.911) (-1051.218) [-1045.515] (-1046.375) -- 0:03:17
143500 -- [-1049.593] (-1058.103) (-1061.250) (-1059.353) * (-1047.133) (-1059.695) [-1043.469] (-1052.315) -- 0:03:16
144000 -- (-1049.163) (-1058.689) [-1044.858] (-1053.788) * (-1049.071) (-1056.317) [-1039.626] (-1054.293) -- 0:03:22
144500 -- (-1054.056) (-1054.168) (-1037.061) [-1047.379] * [-1047.016] (-1041.608) (-1039.678) (-1052.636) -- 0:03:21
145000 -- (-1057.100) (-1042.267) [-1039.218] (-1056.571) * (-1053.441) (-1050.578) [-1042.545] (-1057.094) -- 0:03:20
Average standard deviation of split frequencies: 0.010763
145500 -- (-1055.789) [-1042.090] (-1053.199) (-1055.487) * [-1040.949] (-1054.577) (-1034.992) (-1049.892) -- 0:03:19
146000 -- (-1048.189) [-1038.864] (-1053.978) (-1050.278) * [-1046.945] (-1047.500) (-1051.946) (-1042.759) -- 0:03:18
146500 -- (-1052.440) (-1053.250) (-1043.186) [-1050.035] * (-1045.235) (-1037.043) (-1055.812) [-1036.875] -- 0:03:18
147000 -- (-1050.027) [-1044.735] (-1047.669) (-1053.193) * (-1057.109) [-1042.581] (-1045.295) (-1051.719) -- 0:03:17
147500 -- (-1045.733) (-1046.380) (-1037.979) [-1050.605] * (-1050.029) [-1046.946] (-1038.055) (-1048.827) -- 0:03:16
148000 -- (-1048.122) [-1041.249] (-1046.613) (-1042.568) * (-1062.085) (-1060.566) (-1044.817) [-1050.258] -- 0:03:21
148500 -- [-1039.181] (-1040.843) (-1070.087) (-1048.921) * (-1064.992) (-1052.148) [-1044.723] (-1046.370) -- 0:03:20
149000 -- (-1047.253) [-1045.415] (-1063.588) (-1044.670) * (-1063.805) [-1046.695] (-1063.188) (-1043.975) -- 0:03:19
149500 -- (-1052.601) [-1051.677] (-1047.848) (-1043.390) * (-1061.663) [-1046.577] (-1057.988) (-1042.583) -- 0:03:19
150000 -- (-1052.694) (-1052.430) [-1047.552] (-1041.667) * (-1049.502) (-1041.090) [-1038.987] (-1047.723) -- 0:03:18
Average standard deviation of split frequencies: 0.009595
150500 -- [-1039.237] (-1046.836) (-1053.775) (-1050.032) * (-1062.916) (-1043.861) [-1052.801] (-1045.959) -- 0:03:17
151000 -- [-1042.072] (-1037.960) (-1046.314) (-1035.181) * (-1055.091) (-1043.519) [-1046.100] (-1041.262) -- 0:03:16
151500 -- (-1048.922) (-1040.392) [-1037.318] (-1048.285) * (-1066.499) (-1035.039) [-1043.794] (-1053.596) -- 0:03:16
152000 -- (-1068.311) (-1047.211) (-1045.131) [-1036.151] * (-1056.082) [-1049.337] (-1041.164) (-1047.892) -- 0:03:15
152500 -- [-1043.858] (-1035.908) (-1048.618) (-1041.735) * (-1052.231) (-1037.835) (-1035.977) [-1042.167] -- 0:03:20
153000 -- (-1058.382) (-1038.974) [-1040.448] (-1050.525) * (-1057.201) [-1036.779] (-1056.040) (-1048.513) -- 0:03:19
153500 -- (-1038.858) (-1046.643) (-1047.451) [-1050.488] * (-1048.272) (-1051.234) [-1050.048] (-1039.356) -- 0:03:18
154000 -- (-1059.059) (-1045.074) [-1043.801] (-1060.524) * (-1053.916) [-1047.435] (-1041.677) (-1044.489) -- 0:03:17
154500 -- (-1046.848) (-1043.665) [-1040.230] (-1049.939) * (-1058.206) [-1056.530] (-1058.034) (-1036.001) -- 0:03:17
155000 -- (-1050.798) [-1049.939] (-1055.500) (-1035.703) * (-1048.216) (-1056.980) (-1052.485) [-1042.105] -- 0:03:16
Average standard deviation of split frequencies: 0.012951
155500 -- (-1046.420) [-1038.023] (-1049.897) (-1049.105) * (-1061.019) (-1065.524) (-1042.538) [-1049.144] -- 0:03:15
156000 -- (-1038.911) [-1041.426] (-1053.821) (-1047.706) * [-1044.609] (-1062.997) (-1052.891) (-1037.873) -- 0:03:14
156500 -- [-1041.308] (-1045.576) (-1049.038) (-1047.023) * (-1056.654) (-1058.947) [-1045.871] (-1045.976) -- 0:03:19
157000 -- (-1037.492) (-1049.969) (-1043.913) [-1040.985] * (-1066.980) (-1051.411) [-1045.385] (-1037.150) -- 0:03:18
157500 -- (-1045.723) [-1044.918] (-1046.213) (-1051.165) * (-1051.502) [-1044.232] (-1047.072) (-1041.858) -- 0:03:17
158000 -- (-1047.377) (-1057.927) [-1049.484] (-1047.782) * (-1048.953) [-1040.288] (-1049.314) (-1054.488) -- 0:03:17
158500 -- (-1054.128) (-1045.913) (-1058.444) [-1051.638] * (-1052.767) (-1052.775) [-1033.288] (-1051.994) -- 0:03:16
159000 -- (-1053.769) (-1043.982) (-1061.218) [-1050.174] * (-1054.725) (-1056.963) [-1048.092] (-1043.828) -- 0:03:15
159500 -- (-1064.135) [-1044.978] (-1051.615) (-1045.632) * (-1045.645) (-1063.406) (-1056.375) [-1043.414] -- 0:03:14
160000 -- (-1044.301) (-1050.603) (-1044.317) [-1035.918] * (-1057.533) (-1061.719) (-1055.025) [-1038.576] -- 0:03:14
Average standard deviation of split frequencies: 0.012575
160500 -- (-1047.440) (-1044.841) (-1053.152) [-1038.863] * (-1058.693) (-1059.492) [-1037.390] (-1053.250) -- 0:03:13
161000 -- (-1055.042) (-1041.297) (-1055.140) [-1038.226] * [-1040.580] (-1067.377) (-1046.610) (-1053.017) -- 0:03:18
161500 -- (-1050.799) (-1045.499) (-1052.727) [-1035.274] * (-1047.725) [-1040.834] (-1035.779) (-1054.563) -- 0:03:17
162000 -- (-1049.161) [-1046.406] (-1052.765) (-1046.675) * (-1057.698) (-1061.066) (-1037.124) [-1036.512] -- 0:03:16
162500 -- (-1063.838) (-1047.279) (-1045.004) [-1045.851] * [-1045.389] (-1060.442) (-1050.974) (-1041.802) -- 0:03:15
163000 -- (-1041.399) (-1046.470) [-1054.915] (-1048.604) * (-1056.933) (-1057.634) (-1053.047) [-1040.540] -- 0:03:15
163500 -- [-1049.028] (-1063.517) (-1051.968) (-1045.086) * (-1053.824) (-1065.317) (-1045.933) [-1059.032] -- 0:03:14
164000 -- (-1042.874) (-1051.225) (-1058.012) [-1039.064] * [-1052.267] (-1054.966) (-1050.379) (-1039.462) -- 0:03:13
164500 -- (-1053.132) (-1052.016) (-1053.096) [-1041.929] * (-1057.186) [-1040.877] (-1050.070) (-1046.866) -- 0:03:13
165000 -- (-1044.421) (-1056.608) (-1050.161) [-1038.743] * (-1045.747) (-1060.640) [-1035.889] (-1046.124) -- 0:03:17
Average standard deviation of split frequencies: 0.011156
165500 -- (-1048.088) (-1064.397) [-1043.967] (-1048.270) * (-1051.335) (-1053.466) (-1039.674) [-1046.059] -- 0:03:16
166000 -- (-1051.655) (-1054.461) (-1067.503) [-1046.258] * [-1051.155] (-1055.173) (-1052.671) (-1044.082) -- 0:03:15
166500 -- (-1052.858) (-1054.626) (-1041.516) [-1039.582] * (-1047.135) (-1042.719) (-1060.558) [-1036.871] -- 0:03:15
167000 -- (-1048.178) (-1059.557) [-1038.863] (-1053.685) * (-1042.587) (-1056.015) (-1067.827) [-1042.834] -- 0:03:14
167500 -- (-1040.906) [-1036.865] (-1048.521) (-1052.799) * (-1059.454) [-1057.774] (-1057.117) (-1036.311) -- 0:03:13
168000 -- (-1047.307) (-1054.216) (-1045.420) [-1047.356] * (-1056.248) [-1047.512] (-1064.103) (-1044.661) -- 0:03:13
168500 -- [-1037.726] (-1054.777) (-1037.633) (-1050.328) * (-1049.728) [-1045.310] (-1056.819) (-1046.836) -- 0:03:12
169000 -- (-1054.588) (-1051.160) (-1039.820) [-1042.619] * [-1046.241] (-1045.824) (-1045.786) (-1046.729) -- 0:03:11
169500 -- (-1049.252) (-1052.978) (-1058.843) [-1040.591] * [-1035.108] (-1056.490) (-1058.383) (-1047.663) -- 0:03:15
170000 -- (-1051.057) (-1057.517) [-1039.845] (-1039.624) * (-1049.717) [-1050.275] (-1057.431) (-1037.178) -- 0:03:15
Average standard deviation of split frequencies: 0.011246
170500 -- (-1049.605) (-1050.331) (-1039.802) [-1038.545] * (-1045.753) [-1051.212] (-1048.717) (-1057.972) -- 0:03:14
171000 -- [-1040.420] (-1058.848) (-1044.685) (-1037.734) * (-1044.225) [-1039.210] (-1054.627) (-1074.402) -- 0:03:13
171500 -- (-1053.448) (-1082.283) [-1037.952] (-1049.264) * (-1044.275) (-1047.522) (-1048.829) [-1038.720] -- 0:03:13
172000 -- (-1052.819) (-1047.109) (-1043.949) [-1035.419] * (-1038.050) (-1050.615) (-1048.122) [-1042.353] -- 0:03:12
172500 -- (-1067.678) [-1053.170] (-1047.426) (-1038.784) * [-1041.291] (-1045.648) (-1045.852) (-1045.008) -- 0:03:11
173000 -- (-1061.612) (-1056.680) (-1053.972) [-1045.593] * [-1034.616] (-1046.153) (-1042.379) (-1057.433) -- 0:03:11
173500 -- (-1049.953) (-1049.591) (-1066.034) [-1046.408] * [-1044.403] (-1057.284) (-1063.899) (-1048.399) -- 0:03:15
174000 -- (-1053.128) (-1057.631) (-1044.800) [-1053.003] * (-1038.053) (-1061.396) (-1054.429) [-1044.846] -- 0:03:14
174500 -- (-1064.136) (-1052.676) (-1045.092) [-1045.693] * (-1047.077) (-1049.018) (-1050.126) [-1042.055] -- 0:03:13
175000 -- (-1051.711) (-1041.460) (-1052.905) [-1035.347] * [-1038.623] (-1062.895) (-1039.803) (-1061.139) -- 0:03:13
Average standard deviation of split frequencies: 0.013010
175500 -- (-1044.430) [-1046.352] (-1047.634) (-1036.378) * [-1041.113] (-1047.582) (-1058.601) (-1044.895) -- 0:03:12
176000 -- (-1058.935) (-1049.489) [-1040.661] (-1043.353) * [-1041.866] (-1050.035) (-1064.211) (-1048.940) -- 0:03:11
176500 -- (-1050.574) (-1061.747) (-1050.987) [-1046.735] * (-1038.133) [-1046.205] (-1052.359) (-1055.598) -- 0:03:11
177000 -- (-1041.458) [-1039.849] (-1052.136) (-1050.721) * (-1039.587) (-1048.210) (-1057.768) [-1039.826] -- 0:03:10
177500 -- (-1061.768) (-1038.494) (-1069.139) [-1043.743] * (-1052.893) (-1061.683) (-1049.193) [-1041.868] -- 0:03:14
178000 -- (-1047.349) (-1062.350) (-1054.855) [-1033.102] * (-1042.467) (-1050.417) (-1051.763) [-1042.194] -- 0:03:13
178500 -- [-1052.430] (-1049.336) (-1049.383) (-1052.238) * [-1031.249] (-1063.488) (-1050.257) (-1047.510) -- 0:03:13
179000 -- [-1042.994] (-1048.292) (-1061.134) (-1045.569) * [-1038.564] (-1058.240) (-1049.984) (-1061.187) -- 0:03:12
179500 -- (-1052.116) [-1045.011] (-1051.550) (-1044.917) * [-1043.859] (-1051.725) (-1043.008) (-1046.552) -- 0:03:11
180000 -- [-1037.448] (-1055.255) (-1050.802) (-1055.968) * (-1043.877) (-1049.439) [-1034.828] (-1050.738) -- 0:03:11
Average standard deviation of split frequencies: 0.011369
180500 -- (-1051.137) [-1036.642] (-1059.509) (-1054.295) * (-1048.537) (-1052.470) [-1041.987] (-1059.015) -- 0:03:10
181000 -- (-1064.471) (-1030.738) (-1051.352) [-1047.949] * (-1045.099) [-1032.913] (-1045.610) (-1061.861) -- 0:03:10
181500 -- (-1068.625) (-1039.838) (-1047.521) [-1052.811] * (-1048.171) [-1046.572] (-1044.045) (-1051.017) -- 0:03:09
182000 -- (-1054.849) (-1048.628) [-1050.244] (-1068.229) * (-1041.349) [-1040.667] (-1047.459) (-1051.872) -- 0:03:13
182500 -- (-1053.084) (-1057.408) (-1055.576) [-1039.581] * (-1042.146) (-1059.527) [-1037.327] (-1051.403) -- 0:03:12
183000 -- (-1058.605) (-1057.748) (-1065.610) [-1047.874] * (-1051.481) (-1048.531) [-1042.078] (-1052.222) -- 0:03:11
183500 -- (-1056.670) (-1063.199) (-1044.161) [-1046.400] * (-1046.432) (-1053.409) [-1044.837] (-1064.333) -- 0:03:11
184000 -- (-1052.529) (-1069.794) (-1056.008) [-1052.937] * (-1051.511) (-1058.177) (-1051.001) [-1045.738] -- 0:03:10
184500 -- (-1057.624) (-1066.573) (-1055.669) [-1036.818] * (-1056.643) [-1040.572] (-1049.158) (-1049.600) -- 0:03:10
185000 -- (-1061.317) (-1051.017) (-1064.313) [-1036.766] * (-1062.872) (-1051.060) [-1043.417] (-1054.031) -- 0:03:09
Average standard deviation of split frequencies: 0.011767
185500 -- (-1064.352) (-1058.614) (-1045.617) [-1040.666] * (-1057.012) (-1061.459) (-1037.997) [-1041.182] -- 0:03:08
186000 -- (-1063.599) [-1043.388] (-1053.281) (-1061.935) * (-1050.308) (-1058.659) [-1033.672] (-1045.042) -- 0:03:12
186500 -- (-1050.027) (-1042.030) [-1042.493] (-1047.285) * (-1054.486) (-1039.603) (-1036.833) [-1039.828] -- 0:03:11
187000 -- (-1063.540) [-1050.502] (-1058.190) (-1050.361) * (-1055.079) (-1040.424) [-1041.976] (-1047.111) -- 0:03:11
187500 -- (-1046.197) [-1047.005] (-1053.945) (-1042.208) * (-1068.513) (-1044.033) (-1054.837) [-1044.757] -- 0:03:10
188000 -- (-1064.974) (-1043.895) [-1046.827] (-1039.617) * (-1047.200) [-1038.652] (-1044.642) (-1049.623) -- 0:03:10
188500 -- (-1046.000) [-1050.686] (-1054.508) (-1045.267) * (-1060.250) [-1052.532] (-1048.936) (-1037.440) -- 0:03:09
189000 -- (-1042.248) (-1047.482) (-1046.674) [-1034.853] * [-1045.826] (-1055.332) (-1050.009) (-1034.871) -- 0:03:08
189500 -- [-1042.306] (-1045.717) (-1053.180) (-1048.192) * [-1038.904] (-1046.860) (-1048.873) (-1043.366) -- 0:03:08
190000 -- (-1059.392) [-1049.101] (-1044.031) (-1051.399) * (-1045.981) [-1034.761] (-1054.278) (-1052.115) -- 0:03:11
Average standard deviation of split frequencies: 0.010066
190500 -- [-1038.818] (-1057.052) (-1046.885) (-1041.789) * (-1044.267) (-1053.654) [-1037.993] (-1044.589) -- 0:03:11
191000 -- (-1046.634) (-1037.339) (-1044.262) [-1032.677] * (-1047.420) (-1044.882) [-1046.120] (-1052.826) -- 0:03:10
191500 -- (-1036.512) [-1045.118] (-1050.171) (-1043.846) * (-1055.925) [-1040.877] (-1039.182) (-1046.608) -- 0:03:09
192000 -- (-1048.425) [-1042.008] (-1052.715) (-1037.288) * (-1051.191) (-1045.469) (-1038.346) [-1032.372] -- 0:03:09
192500 -- [-1042.378] (-1055.469) (-1047.109) (-1048.473) * (-1042.774) (-1055.511) [-1045.463] (-1047.564) -- 0:03:08
193000 -- (-1056.391) (-1046.876) [-1049.775] (-1038.488) * [-1050.107] (-1047.965) (-1043.586) (-1051.955) -- 0:03:08
193500 -- (-1051.585) (-1041.176) [-1035.117] (-1039.040) * [-1056.177] (-1042.000) (-1050.606) (-1061.707) -- 0:03:07
194000 -- [-1055.931] (-1045.754) (-1058.314) (-1041.400) * (-1049.108) (-1037.362) (-1052.386) [-1049.594] -- 0:03:06
194500 -- (-1043.993) (-1057.007) [-1051.766] (-1049.201) * (-1054.226) [-1059.406] (-1050.224) (-1047.426) -- 0:03:10
195000 -- (-1066.120) [-1038.141] (-1038.159) (-1041.003) * (-1045.320) (-1053.994) (-1042.615) [-1041.017] -- 0:03:09
Average standard deviation of split frequencies: 0.012541
195500 -- (-1056.847) (-1043.494) (-1034.147) [-1051.348] * (-1044.823) (-1058.893) [-1052.336] (-1040.287) -- 0:03:09
196000 -- [-1045.669] (-1053.089) (-1045.725) (-1040.527) * [-1043.061] (-1037.588) (-1048.101) (-1045.509) -- 0:03:08
196500 -- (-1047.608) (-1055.937) [-1049.644] (-1049.361) * [-1035.010] (-1057.769) (-1053.389) (-1038.165) -- 0:03:08
197000 -- [-1043.525] (-1039.005) (-1049.155) (-1047.734) * (-1047.395) (-1051.287) (-1055.384) [-1038.028] -- 0:03:07
197500 -- [-1043.246] (-1048.727) (-1044.272) (-1041.451) * (-1038.389) [-1037.697] (-1067.725) (-1046.609) -- 0:03:06
198000 -- (-1043.676) (-1042.992) (-1049.699) [-1039.665] * (-1043.580) (-1047.695) [-1042.255] (-1046.650) -- 0:03:06
198500 -- (-1045.299) (-1052.638) (-1049.925) [-1041.405] * (-1038.512) (-1069.154) [-1049.580] (-1048.724) -- 0:03:09
199000 -- (-1041.944) (-1067.089) [-1034.594] (-1049.427) * (-1051.383) (-1050.505) [-1043.456] (-1043.535) -- 0:03:09
199500 -- (-1055.030) [-1039.010] (-1048.402) (-1049.925) * [-1037.965] (-1053.554) (-1048.979) (-1041.763) -- 0:03:08
200000 -- (-1045.766) (-1045.057) [-1039.215] (-1059.178) * (-1041.038) (-1050.700) [-1041.066] (-1038.552) -- 0:03:08
Average standard deviation of split frequencies: 0.014263
200500 -- (-1051.132) (-1043.918) (-1050.414) [-1041.888] * (-1055.362) (-1059.222) (-1044.775) [-1037.875] -- 0:03:07
201000 -- (-1050.535) (-1062.673) (-1042.852) [-1041.679] * (-1048.956) (-1039.098) (-1048.674) [-1041.568] -- 0:03:06
201500 -- (-1052.216) (-1045.486) (-1042.001) [-1040.290] * (-1044.976) [-1042.882] (-1054.648) (-1055.702) -- 0:03:06
202000 -- (-1061.342) (-1047.792) [-1037.352] (-1039.591) * [-1046.365] (-1051.682) (-1055.449) (-1050.535) -- 0:03:05
202500 -- (-1057.655) [-1049.313] (-1042.682) (-1053.199) * (-1038.684) [-1041.279] (-1046.424) (-1050.062) -- 0:03:05
203000 -- (-1068.166) (-1038.729) [-1043.693] (-1057.159) * [-1042.940] (-1047.488) (-1049.757) (-1042.907) -- 0:03:08
203500 -- (-1061.218) [-1042.774] (-1040.245) (-1058.090) * (-1044.323) (-1048.832) [-1046.851] (-1053.586) -- 0:03:07
204000 -- (-1065.523) (-1049.306) (-1040.259) [-1041.411] * [-1047.463] (-1038.640) (-1044.595) (-1049.378) -- 0:03:07
204500 -- (-1061.360) (-1044.990) [-1046.457] (-1044.283) * (-1062.364) (-1044.792) [-1044.163] (-1042.054) -- 0:03:06
205000 -- (-1064.908) [-1044.972] (-1045.964) (-1056.488) * (-1063.630) (-1040.329) (-1042.955) [-1035.228] -- 0:03:06
Average standard deviation of split frequencies: 0.016476
205500 -- (-1059.321) (-1045.576) (-1046.497) [-1053.470] * (-1052.113) (-1068.384) (-1050.673) [-1038.310] -- 0:03:05
206000 -- (-1061.724) [-1036.173] (-1046.151) (-1036.104) * (-1053.599) (-1050.063) (-1053.885) [-1044.379] -- 0:03:05
206500 -- (-1060.644) (-1049.135) (-1048.368) [-1042.144] * (-1052.575) [-1043.725] (-1042.933) (-1043.938) -- 0:03:04
207000 -- (-1054.854) (-1045.728) [-1047.479] (-1043.936) * (-1059.572) (-1057.115) [-1037.957] (-1047.784) -- 0:03:07
207500 -- (-1056.558) (-1050.552) (-1045.105) [-1037.572] * (-1061.260) (-1048.347) (-1040.534) [-1035.388] -- 0:03:07
208000 -- (-1060.729) [-1047.306] (-1048.543) (-1043.441) * (-1049.103) (-1046.904) [-1035.952] (-1044.396) -- 0:03:06
208500 -- (-1057.229) (-1060.114) (-1044.291) [-1044.791] * (-1049.609) (-1043.152) [-1038.053] (-1045.661) -- 0:03:06
209000 -- (-1056.069) (-1039.814) (-1044.630) [-1034.722] * (-1038.741) (-1040.075) (-1049.455) [-1043.888] -- 0:03:05
209500 -- (-1065.703) [-1042.155] (-1045.521) (-1038.450) * (-1058.771) (-1044.066) [-1041.974] (-1050.319) -- 0:03:04
210000 -- (-1052.996) [-1045.954] (-1070.186) (-1048.982) * (-1053.242) [-1040.216] (-1061.189) (-1047.201) -- 0:03:04
Average standard deviation of split frequencies: 0.016857
210500 -- (-1057.180) (-1043.112) (-1048.651) [-1042.447] * (-1055.183) (-1039.655) [-1043.988] (-1057.315) -- 0:03:03
211000 -- (-1068.800) [-1042.364] (-1051.881) (-1058.919) * (-1044.155) [-1048.771] (-1050.079) (-1043.872) -- 0:03:03
211500 -- (-1057.185) (-1055.441) (-1049.208) [-1042.307] * (-1060.419) (-1051.708) (-1060.169) [-1036.858] -- 0:03:06
212000 -- (-1052.660) (-1050.213) [-1049.857] (-1042.710) * (-1059.278) (-1048.125) (-1060.285) [-1045.359] -- 0:03:05
212500 -- (-1055.946) (-1053.312) [-1030.447] (-1048.186) * (-1054.263) (-1051.111) (-1063.708) [-1041.457] -- 0:03:05
213000 -- (-1059.048) (-1044.392) (-1043.172) [-1033.443] * (-1049.361) (-1051.384) (-1054.062) [-1039.330] -- 0:03:04
213500 -- (-1058.394) [-1050.806] (-1046.776) (-1039.555) * (-1052.150) [-1041.442] (-1062.396) (-1051.690) -- 0:03:04
214000 -- (-1053.704) (-1046.330) (-1041.465) [-1039.318] * (-1065.665) [-1042.926] (-1047.462) (-1039.384) -- 0:03:03
214500 -- [-1042.906] (-1056.050) (-1045.677) (-1040.947) * (-1059.207) [-1044.290] (-1042.270) (-1038.641) -- 0:03:03
215000 -- (-1060.940) [-1042.083] (-1046.739) (-1046.849) * [-1044.185] (-1054.123) (-1061.907) (-1043.250) -- 0:03:02
Average standard deviation of split frequencies: 0.019205
215500 -- (-1064.873) (-1042.979) [-1037.480] (-1043.196) * (-1045.682) (-1043.362) (-1062.540) [-1052.012] -- 0:03:05
216000 -- (-1070.467) (-1048.596) [-1046.193] (-1048.449) * (-1062.391) (-1041.577) (-1047.966) [-1042.856] -- 0:03:05
216500 -- [-1046.329] (-1038.723) (-1049.011) (-1051.120) * (-1040.839) (-1052.999) [-1054.847] (-1050.047) -- 0:03:04
217000 -- (-1059.300) (-1047.330) [-1040.533] (-1045.914) * (-1051.052) (-1072.453) (-1065.339) [-1053.500] -- 0:03:04
217500 -- (-1057.500) (-1050.386) (-1048.730) [-1042.821] * (-1054.490) (-1045.468) (-1059.711) [-1042.603] -- 0:03:03
218000 -- (-1055.849) (-1043.530) (-1049.563) [-1043.696] * (-1046.644) (-1047.192) (-1051.602) [-1037.245] -- 0:03:02
218500 -- (-1066.857) (-1047.362) (-1043.636) [-1054.762] * (-1053.284) (-1066.231) (-1056.390) [-1053.355] -- 0:03:02
219000 -- (-1064.276) [-1044.145] (-1053.774) (-1048.500) * [-1042.261] (-1053.624) (-1047.427) (-1045.035) -- 0:03:01
219500 -- (-1058.652) [-1042.943] (-1041.650) (-1046.726) * (-1044.140) (-1058.006) (-1054.166) [-1036.729] -- 0:03:01
220000 -- (-1057.289) (-1044.960) [-1052.879] (-1049.679) * (-1052.543) (-1045.249) (-1052.181) [-1048.569] -- 0:03:04
Average standard deviation of split frequencies: 0.018372
220500 -- (-1051.842) (-1048.437) [-1042.587] (-1037.601) * [-1037.605] (-1044.073) (-1066.294) (-1044.841) -- 0:03:03
221000 -- (-1053.707) [-1042.831] (-1070.754) (-1050.976) * (-1043.300) (-1054.581) (-1049.517) [-1048.156] -- 0:03:03
221500 -- (-1046.863) [-1040.308] (-1058.707) (-1051.068) * (-1045.277) (-1047.054) (-1050.593) [-1050.038] -- 0:03:02
222000 -- (-1058.169) [-1042.036] (-1043.162) (-1055.554) * (-1045.692) [-1053.564] (-1052.367) (-1060.382) -- 0:03:02
222500 -- (-1042.972) [-1047.903] (-1057.387) (-1037.705) * (-1050.176) (-1056.779) [-1038.989] (-1058.260) -- 0:03:01
223000 -- (-1049.883) [-1037.479] (-1046.723) (-1045.137) * (-1057.203) (-1047.181) (-1049.836) [-1054.689] -- 0:03:01
223500 -- (-1036.117) (-1041.550) [-1040.021] (-1050.252) * (-1056.973) [-1037.893] (-1040.327) (-1060.536) -- 0:03:00
224000 -- (-1050.618) (-1052.662) (-1047.102) [-1041.816] * (-1061.352) [-1045.207] (-1043.391) (-1056.372) -- 0:03:03
224500 -- (-1045.100) [-1038.081] (-1056.269) (-1045.309) * (-1039.602) (-1048.646) [-1046.094] (-1062.654) -- 0:03:03
225000 -- (-1055.917) (-1048.560) [-1037.779] (-1039.203) * (-1048.511) (-1041.466) [-1039.963] (-1053.287) -- 0:03:02
Average standard deviation of split frequencies: 0.018356
225500 -- (-1046.092) (-1049.954) (-1046.675) [-1043.316] * (-1045.608) (-1058.410) (-1036.203) [-1048.456] -- 0:03:02
226000 -- [-1043.589] (-1055.458) (-1050.068) (-1044.958) * [-1035.077] (-1043.339) (-1054.079) (-1049.932) -- 0:03:01
226500 -- (-1059.459) (-1040.556) [-1040.437] (-1042.855) * (-1050.305) (-1050.670) (-1050.944) [-1046.700] -- 0:03:00
227000 -- (-1057.361) (-1059.038) (-1056.633) [-1036.781] * (-1052.358) (-1039.576) [-1045.087] (-1048.854) -- 0:03:00
227500 -- (-1044.355) (-1067.252) (-1048.504) [-1036.106] * (-1051.006) (-1044.786) [-1047.269] (-1044.218) -- 0:02:59
228000 -- (-1045.368) (-1054.037) [-1052.728] (-1048.832) * (-1052.987) [-1037.143] (-1060.404) (-1043.519) -- 0:02:59
228500 -- [-1041.689] (-1065.818) (-1053.995) (-1052.319) * (-1048.671) [-1049.935] (-1041.840) (-1044.887) -- 0:03:02
229000 -- (-1046.198) (-1054.754) [-1043.120] (-1055.185) * (-1058.421) (-1042.969) [-1039.431] (-1041.432) -- 0:03:01
229500 -- [-1046.417] (-1066.602) (-1046.238) (-1055.880) * (-1060.917) [-1042.171] (-1053.823) (-1040.904) -- 0:03:01
230000 -- (-1051.583) (-1057.140) [-1045.611] (-1041.151) * (-1063.272) (-1055.735) (-1061.374) [-1035.985] -- 0:03:00
Average standard deviation of split frequencies: 0.019483
230500 -- (-1042.172) (-1061.289) [-1039.741] (-1049.959) * (-1042.451) (-1069.625) (-1048.833) [-1042.567] -- 0:03:00
231000 -- (-1051.057) (-1055.493) [-1042.590] (-1054.708) * (-1041.015) (-1058.864) [-1037.353] (-1036.778) -- 0:02:59
231500 -- [-1044.996] (-1059.913) (-1065.197) (-1052.173) * (-1043.753) (-1061.641) [-1047.674] (-1060.899) -- 0:02:59
232000 -- (-1047.255) (-1054.648) [-1040.985] (-1055.262) * (-1047.525) [-1045.308] (-1049.249) (-1047.201) -- 0:02:58
232500 -- (-1061.187) (-1052.654) [-1047.607] (-1037.650) * [-1038.027] (-1061.035) (-1046.288) (-1059.643) -- 0:03:01
233000 -- [-1034.574] (-1051.664) (-1057.210) (-1036.965) * [-1053.030] (-1039.983) (-1042.828) (-1061.472) -- 0:03:01
233500 -- [-1041.491] (-1044.817) (-1041.786) (-1043.495) * (-1049.291) (-1043.029) [-1032.273] (-1049.940) -- 0:03:00
234000 -- (-1045.096) (-1039.170) (-1050.161) [-1039.836] * (-1062.726) (-1044.859) [-1039.590] (-1036.055) -- 0:03:00
234500 -- (-1043.178) (-1047.558) (-1044.814) [-1046.569] * [-1048.204] (-1042.618) (-1055.975) (-1046.472) -- 0:02:59
235000 -- (-1047.104) (-1042.985) [-1041.748] (-1054.714) * (-1051.738) (-1054.559) [-1037.386] (-1043.911) -- 0:02:59
Average standard deviation of split frequencies: 0.020507
235500 -- (-1045.453) [-1053.551] (-1053.003) (-1049.988) * [-1038.456] (-1042.973) (-1041.891) (-1058.544) -- 0:02:58
236000 -- (-1054.913) (-1049.848) (-1052.734) [-1039.042] * (-1042.391) (-1051.774) (-1036.184) [-1050.143] -- 0:02:58
236500 -- (-1046.466) (-1048.427) [-1043.938] (-1041.403) * (-1053.455) [-1042.010] (-1044.173) (-1058.650) -- 0:02:57
237000 -- (-1060.304) (-1051.078) [-1043.667] (-1045.408) * (-1043.000) (-1052.642) [-1035.726] (-1057.993) -- 0:03:00
237500 -- (-1046.156) [-1039.693] (-1044.952) (-1050.782) * (-1052.878) [-1042.010] (-1047.278) (-1054.760) -- 0:02:59
238000 -- [-1048.472] (-1046.303) (-1057.384) (-1053.630) * (-1041.903) [-1051.828] (-1048.352) (-1040.868) -- 0:02:59
238500 -- (-1052.081) (-1050.501) (-1046.662) [-1049.385] * (-1059.543) (-1055.852) [-1039.013] (-1048.769) -- 0:02:58
239000 -- (-1046.022) [-1046.858] (-1065.658) (-1049.777) * [-1046.433] (-1053.362) (-1052.932) (-1053.159) -- 0:02:58
239500 -- (-1057.227) (-1054.605) [-1049.854] (-1047.256) * (-1045.901) [-1043.254] (-1049.758) (-1044.799) -- 0:02:57
240000 -- [-1049.407] (-1060.526) (-1049.793) (-1053.755) * (-1043.137) (-1054.684) (-1051.075) [-1033.282] -- 0:02:57
Average standard deviation of split frequencies: 0.019849
240500 -- (-1043.537) [-1039.053] (-1051.966) (-1071.107) * (-1059.969) (-1046.704) [-1050.708] (-1049.550) -- 0:02:56
241000 -- (-1050.507) (-1052.620) [-1044.452] (-1052.862) * (-1048.173) (-1053.347) [-1041.157] (-1044.936) -- 0:02:59
241500 -- [-1038.771] (-1036.353) (-1055.541) (-1046.203) * (-1045.950) (-1046.390) [-1057.354] (-1053.300) -- 0:02:59
242000 -- (-1050.286) (-1041.411) (-1036.700) [-1038.684] * (-1046.714) (-1046.893) [-1036.534] (-1051.126) -- 0:02:58
242500 -- [-1063.668] (-1048.874) (-1040.778) (-1043.494) * (-1055.001) [-1042.451] (-1043.368) (-1052.171) -- 0:02:58
243000 -- (-1057.930) (-1062.949) (-1049.571) [-1042.208] * (-1041.658) [-1039.763] (-1048.467) (-1034.502) -- 0:02:57
243500 -- [-1037.905] (-1057.738) (-1049.509) (-1044.305) * (-1048.879) (-1052.437) [-1035.473] (-1044.112) -- 0:02:57
244000 -- (-1039.437) [-1038.008] (-1054.526) (-1054.192) * (-1041.492) (-1046.569) (-1037.931) [-1038.880] -- 0:02:56
244500 -- (-1039.595) (-1035.459) [-1052.848] (-1035.573) * (-1046.005) (-1048.215) [-1038.386] (-1042.976) -- 0:02:56
245000 -- (-1045.743) (-1043.880) [-1046.734] (-1051.025) * (-1043.947) [-1051.904] (-1047.372) (-1041.239) -- 0:02:55
Average standard deviation of split frequencies: 0.018780
245500 -- [-1043.069] (-1037.841) (-1045.122) (-1051.073) * [-1037.688] (-1040.762) (-1057.215) (-1041.303) -- 0:02:58
246000 -- [-1042.428] (-1044.892) (-1042.606) (-1049.892) * (-1050.979) (-1045.209) (-1058.823) [-1039.689] -- 0:02:57
246500 -- (-1045.348) (-1040.983) (-1042.563) [-1045.808] * (-1048.957) (-1043.026) (-1048.863) [-1049.816] -- 0:02:57
247000 -- (-1042.707) (-1043.374) (-1065.019) [-1048.304] * [-1047.761] (-1048.541) (-1056.821) (-1049.044) -- 0:02:56
247500 -- [-1044.669] (-1044.914) (-1056.061) (-1034.932) * (-1042.526) [-1041.749] (-1053.948) (-1042.187) -- 0:02:56
248000 -- (-1048.749) [-1045.009] (-1049.770) (-1057.420) * (-1054.265) (-1058.819) (-1042.926) [-1041.382] -- 0:02:55
248500 -- (-1045.506) (-1039.559) (-1053.403) [-1044.295] * (-1038.429) [-1040.025] (-1043.970) (-1055.194) -- 0:02:55
249000 -- [-1042.559] (-1060.338) (-1039.380) (-1045.869) * [-1039.648] (-1063.594) (-1047.602) (-1042.995) -- 0:02:54
249500 -- (-1045.991) (-1050.592) (-1051.546) [-1041.681] * (-1047.423) (-1047.470) [-1043.344] (-1040.791) -- 0:02:57
250000 -- [-1048.975] (-1052.702) (-1042.742) (-1044.170) * (-1042.387) (-1045.115) (-1043.286) [-1035.859] -- 0:02:57
Average standard deviation of split frequencies: 0.019182
250500 -- (-1055.785) [-1037.514] (-1047.694) (-1059.615) * (-1070.250) (-1048.214) (-1052.631) [-1045.332] -- 0:02:56
251000 -- (-1049.309) (-1051.122) (-1046.913) [-1044.178] * (-1045.514) (-1039.065) (-1045.119) [-1035.774] -- 0:02:56
251500 -- [-1032.656] (-1047.034) (-1060.424) (-1037.738) * [-1051.495] (-1035.087) (-1056.176) (-1046.157) -- 0:02:55
252000 -- (-1063.183) [-1035.951] (-1045.272) (-1043.722) * (-1056.417) (-1056.458) (-1052.903) [-1042.637] -- 0:02:55
252500 -- [-1043.393] (-1044.891) (-1038.524) (-1046.280) * (-1052.247) (-1059.390) (-1056.160) [-1037.057] -- 0:02:54
253000 -- [-1040.095] (-1051.723) (-1057.403) (-1042.468) * (-1038.814) (-1061.158) (-1055.896) [-1048.565] -- 0:02:54
253500 -- (-1045.235) [-1040.240] (-1047.367) (-1034.004) * (-1055.085) (-1047.137) (-1050.313) [-1037.302] -- 0:02:56
254000 -- (-1056.995) (-1040.576) (-1048.723) [-1049.677] * (-1053.848) [-1050.308] (-1051.386) (-1045.692) -- 0:02:56
254500 -- (-1066.660) (-1045.781) [-1039.784] (-1050.529) * [-1053.099] (-1055.984) (-1047.142) (-1043.783) -- 0:02:55
255000 -- (-1054.066) (-1042.694) (-1051.859) [-1043.284] * [-1043.101] (-1044.224) (-1052.525) (-1043.704) -- 0:02:55
Average standard deviation of split frequencies: 0.019274
255500 -- [-1046.123] (-1063.035) (-1054.682) (-1043.618) * (-1041.228) (-1062.262) [-1038.306] (-1051.387) -- 0:02:54
256000 -- (-1060.903) (-1046.897) (-1050.678) [-1044.054] * (-1045.537) (-1055.755) [-1044.104] (-1045.362) -- 0:02:54
256500 -- (-1043.348) (-1049.613) (-1053.813) [-1052.739] * (-1049.334) (-1048.002) (-1046.626) [-1038.486] -- 0:02:53
257000 -- (-1043.474) (-1060.887) (-1046.804) [-1044.801] * (-1038.780) [-1050.238] (-1049.788) (-1056.231) -- 0:02:53
257500 -- [-1042.661] (-1062.869) (-1046.291) (-1059.241) * [-1049.269] (-1054.160) (-1047.058) (-1058.546) -- 0:02:53
258000 -- (-1047.052) (-1060.323) [-1032.728] (-1044.378) * [-1042.993] (-1062.639) (-1044.007) (-1058.855) -- 0:02:55
258500 -- (-1054.248) (-1051.921) [-1037.202] (-1053.208) * [-1045.700] (-1064.431) (-1062.134) (-1053.369) -- 0:02:54
259000 -- [-1057.945] (-1055.726) (-1042.042) (-1041.599) * (-1055.597) (-1061.342) (-1050.616) [-1041.020] -- 0:02:54
259500 -- (-1059.512) [-1038.401] (-1053.895) (-1048.530) * (-1047.965) (-1058.327) (-1054.760) [-1037.678] -- 0:02:54
260000 -- (-1043.204) (-1044.518) (-1060.822) [-1046.205] * (-1051.621) (-1064.828) [-1044.436] (-1061.669) -- 0:02:53
Average standard deviation of split frequencies: 0.019170
260500 -- (-1066.090) (-1049.110) [-1042.481] (-1043.181) * (-1042.066) [-1049.399] (-1049.079) (-1061.814) -- 0:02:53
261000 -- (-1054.725) (-1055.602) [-1039.130] (-1056.182) * (-1049.205) [-1047.451] (-1047.560) (-1045.967) -- 0:02:52
261500 -- (-1049.683) (-1048.998) (-1039.392) [-1041.128] * (-1045.857) (-1047.379) [-1034.494] (-1041.054) -- 0:02:52
262000 -- (-1049.065) (-1045.436) [-1050.989] (-1043.618) * (-1040.794) (-1053.317) (-1057.427) [-1042.670] -- 0:02:54
262500 -- (-1051.090) (-1049.836) [-1043.566] (-1036.459) * [-1042.008] (-1049.574) (-1046.460) (-1048.976) -- 0:02:54
263000 -- [-1047.205] (-1048.554) (-1063.837) (-1039.362) * (-1039.972) (-1060.562) [-1056.034] (-1054.583) -- 0:02:53
263500 -- (-1063.743) (-1059.553) [-1055.106] (-1040.910) * (-1047.168) (-1063.577) (-1042.990) [-1043.362] -- 0:02:53
264000 -- [-1043.505] (-1060.487) (-1050.044) (-1055.910) * [-1057.515] (-1042.002) (-1048.668) (-1043.057) -- 0:02:52
264500 -- (-1048.596) (-1063.380) (-1043.299) [-1051.758] * (-1045.694) (-1057.190) (-1047.974) [-1051.889] -- 0:02:52
265000 -- (-1043.254) (-1041.380) (-1048.320) [-1048.022] * (-1043.521) [-1055.361] (-1048.226) (-1052.351) -- 0:02:51
Average standard deviation of split frequencies: 0.019258
265500 -- (-1050.013) (-1055.096) (-1063.999) [-1034.952] * [-1043.922] (-1060.090) (-1047.762) (-1054.424) -- 0:02:51
266000 -- [-1042.733] (-1070.619) (-1050.847) (-1044.524) * [-1050.066] (-1084.603) (-1048.733) (-1067.110) -- 0:02:53
266500 -- [-1038.313] (-1064.784) (-1045.259) (-1042.824) * (-1057.388) (-1059.746) [-1040.828] (-1047.755) -- 0:02:53
267000 -- [-1046.847] (-1060.705) (-1063.794) (-1060.849) * (-1054.664) (-1048.722) [-1040.857] (-1052.092) -- 0:02:52
267500 -- (-1050.302) [-1050.808] (-1043.934) (-1052.706) * [-1044.818] (-1053.818) (-1046.487) (-1047.338) -- 0:02:52
268000 -- (-1036.488) [-1039.895] (-1059.434) (-1050.766) * (-1048.493) (-1051.228) [-1035.494] (-1046.835) -- 0:02:52
268500 -- (-1055.852) (-1054.548) (-1063.495) [-1043.566] * (-1054.461) (-1053.614) [-1044.137] (-1040.802) -- 0:02:51
269000 -- (-1037.681) (-1059.471) (-1050.737) [-1050.478] * (-1051.359) (-1058.425) [-1036.706] (-1035.175) -- 0:02:51
269500 -- (-1034.106) (-1047.603) (-1055.004) [-1042.347] * (-1049.243) (-1046.921) (-1049.745) [-1046.942] -- 0:02:50
270000 -- (-1041.955) [-1042.308] (-1048.962) (-1042.828) * (-1047.367) (-1071.039) (-1047.817) [-1039.040] -- 0:02:50
Average standard deviation of split frequencies: 0.016720
270500 -- (-1043.374) [-1041.222] (-1059.483) (-1038.254) * [-1043.966] (-1053.835) (-1048.106) (-1043.533) -- 0:02:52
271000 -- (-1039.015) (-1047.795) (-1052.028) [-1047.865] * (-1042.175) (-1054.769) (-1057.176) [-1040.631] -- 0:02:52
271500 -- (-1051.972) [-1040.441] (-1055.794) (-1044.605) * (-1034.214) (-1060.731) [-1052.063] (-1049.977) -- 0:02:51
272000 -- (-1047.257) [-1046.481] (-1047.627) (-1040.823) * [-1042.154] (-1063.703) (-1056.003) (-1035.879) -- 0:02:51
272500 -- (-1042.436) (-1062.270) (-1045.053) [-1046.862] * (-1042.662) (-1067.550) [-1046.823] (-1046.450) -- 0:02:50
273000 -- (-1050.355) (-1053.254) (-1044.890) [-1038.251] * [-1035.598] (-1049.456) (-1042.441) (-1045.173) -- 0:02:50
273500 -- (-1046.966) (-1053.225) [-1046.800] (-1049.613) * (-1037.474) (-1055.979) [-1037.915] (-1041.070) -- 0:02:50
274000 -- (-1038.231) (-1044.041) (-1039.769) [-1034.670] * (-1041.938) (-1054.292) (-1051.411) [-1044.863] -- 0:02:49
274500 -- (-1044.238) (-1052.500) (-1053.599) [-1044.514] * (-1047.606) [-1052.987] (-1047.774) (-1053.016) -- 0:02:49
275000 -- [-1039.939] (-1047.477) (-1050.143) (-1033.129) * (-1047.508) (-1052.158) [-1036.999] (-1048.232) -- 0:02:51
Average standard deviation of split frequencies: 0.017308
275500 -- (-1054.577) [-1043.776] (-1038.749) (-1041.196) * [-1038.098] (-1043.699) (-1045.695) (-1048.661) -- 0:02:50
276000 -- [-1038.552] (-1052.420) (-1051.098) (-1048.927) * (-1043.421) (-1053.244) (-1052.715) [-1034.445] -- 0:02:50
276500 -- (-1043.550) (-1056.218) (-1060.028) [-1040.038] * (-1045.443) (-1046.173) (-1035.381) [-1039.747] -- 0:02:50
277000 -- (-1045.290) (-1051.715) [-1038.016] (-1045.231) * (-1045.687) (-1051.441) (-1039.429) [-1044.069] -- 0:02:49
277500 -- (-1047.456) (-1059.530) (-1044.522) [-1038.418] * (-1041.773) [-1047.932] (-1036.872) (-1055.208) -- 0:02:49
278000 -- [-1054.565] (-1064.724) (-1039.876) (-1041.850) * (-1053.105) [-1046.266] (-1037.824) (-1048.957) -- 0:02:48
278500 -- (-1059.941) (-1059.504) (-1045.339) [-1039.934] * [-1035.473] (-1048.246) (-1046.885) (-1046.749) -- 0:02:48
279000 -- (-1049.707) (-1045.990) [-1043.434] (-1043.822) * [-1050.008] (-1046.941) (-1041.405) (-1061.543) -- 0:02:50
279500 -- (-1047.791) (-1056.176) (-1043.651) [-1043.013] * (-1039.999) (-1057.403) [-1037.797] (-1055.358) -- 0:02:50
280000 -- (-1041.077) (-1064.130) (-1040.262) [-1054.273] * [-1035.746] (-1053.361) (-1056.021) (-1051.488) -- 0:02:49
Average standard deviation of split frequencies: 0.016908
280500 -- (-1049.297) (-1064.743) [-1038.220] (-1050.549) * [-1040.728] (-1066.613) (-1053.623) (-1057.471) -- 0:02:49
281000 -- [-1039.735] (-1062.083) (-1058.655) (-1034.247) * (-1045.498) (-1048.872) [-1058.791] (-1047.153) -- 0:02:48
281500 -- (-1058.777) (-1057.532) [-1045.889] (-1046.926) * (-1057.612) (-1054.322) [-1049.686] (-1045.127) -- 0:02:48
282000 -- (-1042.716) (-1064.339) [-1038.726] (-1044.762) * (-1041.581) (-1052.298) [-1047.983] (-1059.582) -- 0:02:48
282500 -- (-1057.754) (-1050.334) [-1038.107] (-1040.380) * (-1047.321) [-1045.553] (-1043.992) (-1065.951) -- 0:02:47
283000 -- (-1031.565) (-1054.701) (-1042.027) [-1045.180] * (-1056.840) (-1044.718) [-1037.252] (-1066.139) -- 0:02:47
283500 -- (-1049.122) (-1044.176) [-1038.140] (-1061.370) * [-1044.280] (-1046.267) (-1044.895) (-1049.720) -- 0:02:49
284000 -- (-1043.664) [-1038.837] (-1047.841) (-1039.763) * [-1048.002] (-1045.880) (-1051.508) (-1045.496) -- 0:02:48
284500 -- [-1040.178] (-1050.007) (-1044.035) (-1036.478) * [-1042.814] (-1053.017) (-1047.066) (-1047.845) -- 0:02:48
285000 -- (-1048.900) (-1041.859) [-1050.699] (-1053.256) * (-1048.854) (-1045.528) (-1047.636) [-1047.479] -- 0:02:48
Average standard deviation of split frequencies: 0.015274
285500 -- (-1053.503) (-1041.467) [-1049.575] (-1045.204) * (-1054.167) (-1073.258) (-1047.101) [-1047.242] -- 0:02:47
286000 -- (-1048.541) (-1042.946) (-1054.420) [-1041.987] * [-1047.077] (-1051.043) (-1051.650) (-1046.984) -- 0:02:47
286500 -- (-1043.088) (-1043.261) [-1039.446] (-1056.821) * (-1042.384) (-1047.606) (-1042.038) [-1038.277] -- 0:02:46
287000 -- (-1043.884) [-1039.674] (-1045.282) (-1055.780) * (-1046.870) (-1053.425) [-1054.071] (-1040.491) -- 0:02:46
287500 -- (-1054.246) (-1043.697) (-1038.388) [-1046.883] * (-1041.718) (-1044.061) [-1048.441] (-1048.843) -- 0:02:48
288000 -- (-1051.262) (-1058.103) [-1039.894] (-1064.512) * (-1046.612) [-1045.861] (-1052.291) (-1041.067) -- 0:02:48
288500 -- (-1044.946) (-1039.413) (-1041.837) [-1041.950] * (-1049.937) (-1050.787) [-1046.670] (-1046.029) -- 0:02:47
289000 -- [-1042.303] (-1059.067) (-1053.687) (-1053.926) * (-1038.121) (-1042.402) [-1038.558] (-1058.559) -- 0:02:47
289500 -- (-1051.939) [-1038.936] (-1059.533) (-1044.950) * (-1046.546) (-1049.848) [-1038.497] (-1049.000) -- 0:02:46
290000 -- (-1046.427) [-1032.782] (-1055.628) (-1037.935) * (-1058.704) (-1044.348) [-1037.017] (-1050.129) -- 0:02:46
Average standard deviation of split frequencies: 0.015029
290500 -- (-1047.368) [-1042.741] (-1043.046) (-1039.063) * (-1047.708) (-1046.171) [-1041.677] (-1042.450) -- 0:02:46
291000 -- (-1054.208) (-1046.585) [-1053.212] (-1055.748) * (-1049.555) [-1034.374] (-1050.742) (-1054.947) -- 0:02:45
291500 -- (-1045.555) (-1038.792) [-1037.817] (-1047.483) * (-1046.800) [-1044.549] (-1054.792) (-1055.697) -- 0:02:45
292000 -- (-1058.843) (-1042.321) (-1052.645) [-1047.257] * (-1038.333) (-1056.865) [-1045.856] (-1054.529) -- 0:02:47
292500 -- (-1056.471) (-1043.663) (-1037.888) [-1038.595] * (-1043.670) [-1042.660] (-1052.918) (-1068.337) -- 0:02:46
293000 -- (-1057.772) (-1040.680) (-1053.863) [-1052.217] * (-1036.299) [-1045.401] (-1044.119) (-1048.324) -- 0:02:46
293500 -- (-1051.143) (-1036.272) [-1048.524] (-1046.531) * (-1043.618) (-1044.028) (-1055.041) [-1046.600] -- 0:02:46
294000 -- [-1039.166] (-1046.500) (-1043.174) (-1043.187) * (-1038.929) [-1049.002] (-1046.048) (-1050.911) -- 0:02:45
294500 -- (-1056.947) (-1043.828) (-1060.119) [-1042.130] * (-1045.967) (-1052.108) (-1064.221) [-1037.535] -- 0:02:45
295000 -- [-1046.539] (-1050.560) (-1055.307) (-1051.288) * [-1048.567] (-1043.256) (-1045.791) (-1048.670) -- 0:02:44
Average standard deviation of split frequencies: 0.014439
295500 -- [-1035.788] (-1043.322) (-1053.424) (-1046.965) * (-1047.235) (-1060.444) (-1043.743) [-1043.915] -- 0:02:44
296000 -- (-1041.916) [-1041.182] (-1055.703) (-1048.610) * [-1039.734] (-1036.288) (-1049.320) (-1046.410) -- 0:02:46
296500 -- (-1048.924) [-1045.299] (-1042.582) (-1045.146) * [-1039.084] (-1039.729) (-1038.735) (-1060.646) -- 0:02:46
297000 -- (-1052.343) (-1053.632) [-1041.030] (-1050.340) * (-1046.525) [-1045.280] (-1044.287) (-1051.896) -- 0:02:45
297500 -- (-1047.629) (-1051.771) (-1045.237) [-1055.655] * (-1051.978) (-1039.587) [-1042.118] (-1057.180) -- 0:02:45
298000 -- (-1052.058) (-1054.829) [-1042.138] (-1042.223) * [-1041.893] (-1036.556) (-1056.128) (-1045.693) -- 0:02:44
298500 -- (-1048.951) (-1046.828) [-1039.124] (-1040.087) * (-1038.446) [-1044.993] (-1053.419) (-1046.867) -- 0:02:44
299000 -- (-1052.522) (-1045.912) (-1054.303) [-1036.251] * (-1047.825) (-1052.213) [-1058.463] (-1040.181) -- 0:02:44
299500 -- (-1054.835) (-1055.672) (-1052.395) [-1042.515] * (-1049.141) [-1036.399] (-1045.340) (-1040.950) -- 0:02:43
300000 -- (-1049.687) (-1052.648) [-1036.899] (-1042.195) * (-1065.564) (-1043.419) (-1065.096) [-1048.882] -- 0:02:45
Average standard deviation of split frequencies: 0.015470
300500 -- (-1058.476) [-1039.542] (-1042.410) (-1053.517) * [-1044.549] (-1040.254) (-1069.721) (-1044.234) -- 0:02:45
301000 -- (-1049.074) (-1046.092) (-1051.553) [-1038.179] * [-1045.622] (-1046.485) (-1054.680) (-1049.313) -- 0:02:44
301500 -- (-1039.549) (-1040.920) (-1052.771) [-1046.201] * (-1061.875) (-1040.614) (-1051.543) [-1041.573] -- 0:02:44
302000 -- [-1039.144] (-1044.103) (-1044.958) (-1037.689) * [-1047.910] (-1051.664) (-1053.106) (-1044.587) -- 0:02:44
302500 -- (-1045.809) (-1049.405) [-1045.159] (-1059.700) * (-1050.704) [-1050.184] (-1047.124) (-1069.941) -- 0:02:43
303000 -- (-1047.606) (-1035.533) (-1051.987) [-1041.014] * [-1038.447] (-1054.503) (-1044.134) (-1060.091) -- 0:02:43
303500 -- (-1045.981) (-1054.291) (-1055.743) [-1045.428] * (-1044.555) (-1040.882) [-1039.707] (-1049.334) -- 0:02:42
304000 -- (-1059.863) [-1038.568] (-1047.828) (-1044.061) * [-1052.556] (-1049.372) (-1054.445) (-1053.216) -- 0:02:42
304500 -- (-1056.032) [-1036.795] (-1051.443) (-1045.301) * (-1048.757) (-1042.599) (-1049.436) [-1040.361] -- 0:02:44
305000 -- [-1034.250] (-1048.109) (-1049.116) (-1052.309) * [-1037.919] (-1042.692) (-1053.094) (-1041.450) -- 0:02:44
Average standard deviation of split frequencies: 0.015200
305500 -- (-1056.025) (-1047.409) [-1052.855] (-1047.001) * (-1048.313) [-1046.508] (-1047.677) (-1042.568) -- 0:02:43
306000 -- [-1042.979] (-1054.094) (-1046.393) (-1055.871) * [-1052.397] (-1045.132) (-1058.941) (-1048.894) -- 0:02:43
306500 -- (-1049.318) (-1047.332) (-1047.109) [-1045.396] * (-1050.529) (-1049.152) [-1043.048] (-1046.954) -- 0:02:42
307000 -- (-1051.174) (-1055.393) (-1043.703) [-1036.963] * (-1064.101) (-1048.971) (-1038.810) [-1042.393] -- 0:02:42
307500 -- [-1038.061] (-1044.776) (-1047.368) (-1054.166) * (-1049.822) (-1063.542) [-1045.213] (-1043.302) -- 0:02:42
308000 -- (-1055.883) (-1059.619) [-1047.076] (-1047.887) * [-1040.515] (-1047.613) (-1056.622) (-1038.804) -- 0:02:41
308500 -- [-1042.049] (-1058.008) (-1045.413) (-1051.484) * (-1045.913) (-1066.094) [-1048.546] (-1047.074) -- 0:02:43
309000 -- (-1069.971) (-1058.482) [-1044.232] (-1058.664) * (-1043.819) (-1072.666) (-1054.524) [-1044.360] -- 0:02:43
309500 -- (-1045.517) [-1057.289] (-1048.874) (-1047.513) * (-1054.432) (-1044.248) [-1044.117] (-1047.025) -- 0:02:42
310000 -- (-1042.720) (-1052.303) [-1044.244] (-1049.541) * (-1059.349) (-1052.211) [-1046.754] (-1047.535) -- 0:02:42
Average standard deviation of split frequencies: 0.014264
310500 -- (-1041.777) (-1053.227) [-1045.960] (-1038.471) * (-1036.830) [-1038.251] (-1040.662) (-1053.492) -- 0:02:42
311000 -- (-1060.032) [-1041.792] (-1045.173) (-1045.844) * [-1041.992] (-1047.088) (-1040.009) (-1067.150) -- 0:02:41
311500 -- (-1052.580) (-1052.298) [-1052.131] (-1044.612) * (-1034.440) (-1050.398) [-1046.544] (-1052.807) -- 0:02:41
312000 -- (-1047.097) (-1046.358) (-1053.367) [-1044.130] * (-1044.701) (-1050.084) [-1038.091] (-1067.077) -- 0:02:40
312500 -- [-1041.762] (-1058.617) (-1044.356) (-1053.577) * (-1041.052) [-1047.957] (-1054.627) (-1045.494) -- 0:02:42
313000 -- (-1039.017) (-1050.006) [-1045.200] (-1040.999) * (-1043.325) (-1046.244) (-1056.036) [-1043.789] -- 0:02:42
313500 -- (-1036.157) (-1053.516) (-1060.833) [-1041.171] * (-1037.501) (-1040.971) (-1040.725) [-1044.100] -- 0:02:42
314000 -- (-1053.415) (-1062.896) [-1050.508] (-1044.888) * (-1052.814) [-1039.099] (-1064.588) (-1052.519) -- 0:02:41
314500 -- (-1042.353) (-1061.567) (-1047.873) [-1042.565] * (-1048.838) [-1045.792] (-1061.173) (-1050.588) -- 0:02:41
315000 -- (-1054.581) (-1044.584) [-1036.701] (-1043.351) * (-1054.173) (-1036.469) (-1060.293) [-1048.669] -- 0:02:40
Average standard deviation of split frequencies: 0.014918
315500 -- [-1042.502] (-1044.022) (-1040.633) (-1057.184) * (-1050.838) [-1037.772] (-1054.742) (-1059.927) -- 0:02:40
316000 -- (-1050.849) [-1042.969] (-1048.680) (-1050.452) * (-1046.959) [-1031.439] (-1067.623) (-1048.177) -- 0:02:40
316500 -- (-1044.203) (-1048.763) (-1034.419) [-1039.979] * (-1052.150) [-1045.341] (-1061.679) (-1060.915) -- 0:02:39
317000 -- (-1062.600) (-1041.809) [-1047.324] (-1057.136) * (-1051.207) (-1036.838) [-1035.554] (-1056.849) -- 0:02:41
317500 -- (-1059.129) (-1036.434) (-1041.642) [-1050.775] * (-1049.477) (-1041.112) [-1043.072] (-1058.720) -- 0:02:41
318000 -- (-1040.911) [-1043.568] (-1038.096) (-1055.758) * (-1047.649) [-1040.650] (-1047.156) (-1044.374) -- 0:02:40
318500 -- [-1052.204] (-1053.347) (-1049.898) (-1059.635) * (-1048.683) (-1043.901) (-1057.420) [-1049.939] -- 0:02:40
319000 -- (-1053.692) [-1044.157] (-1044.037) (-1041.266) * (-1048.392) (-1057.334) [-1046.480] (-1048.179) -- 0:02:40
319500 -- (-1041.701) (-1051.717) (-1054.857) [-1042.983] * (-1041.009) [-1047.767] (-1050.221) (-1052.227) -- 0:02:39
320000 -- [-1041.550] (-1033.133) (-1049.371) (-1049.517) * (-1057.895) (-1038.799) [-1041.010] (-1056.170) -- 0:02:39
Average standard deviation of split frequencies: 0.015387
320500 -- [-1040.131] (-1052.386) (-1050.117) (-1045.909) * (-1061.501) [-1034.720] (-1036.220) (-1052.865) -- 0:02:39
321000 -- [-1042.579] (-1047.305) (-1060.324) (-1035.785) * (-1041.807) (-1042.797) (-1041.554) [-1055.367] -- 0:02:40
321500 -- (-1043.631) [-1043.156] (-1034.699) (-1052.146) * (-1043.379) [-1039.428] (-1043.644) (-1051.562) -- 0:02:40
322000 -- [-1047.256] (-1046.838) (-1062.107) (-1057.532) * [-1045.853] (-1039.256) (-1040.000) (-1062.435) -- 0:02:40
322500 -- [-1040.316] (-1040.750) (-1047.105) (-1046.820) * [-1042.536] (-1048.406) (-1054.744) (-1071.730) -- 0:02:39
323000 -- (-1052.318) (-1047.990) [-1056.155] (-1047.374) * (-1047.362) [-1037.384] (-1049.619) (-1066.727) -- 0:02:39
323500 -- (-1045.347) [-1045.466] (-1043.443) (-1053.816) * (-1043.576) [-1037.168] (-1039.510) (-1057.030) -- 0:02:38
324000 -- [-1042.965] (-1042.889) (-1042.471) (-1042.023) * [-1044.009] (-1045.281) (-1045.429) (-1063.942) -- 0:02:38
324500 -- (-1058.982) [-1041.663] (-1047.197) (-1049.185) * (-1049.399) [-1061.996] (-1057.131) (-1057.017) -- 0:02:38
325000 -- [-1053.378] (-1048.679) (-1057.609) (-1045.027) * (-1041.755) [-1047.357] (-1048.601) (-1058.685) -- 0:02:37
Average standard deviation of split frequencies: 0.016388
325500 -- (-1044.416) (-1046.393) (-1050.907) [-1047.852] * (-1044.688) [-1045.273] (-1052.967) (-1057.565) -- 0:02:39
326000 -- (-1035.841) (-1045.833) (-1053.155) [-1044.150] * [-1044.199] (-1055.003) (-1062.724) (-1057.138) -- 0:02:39
326500 -- [-1035.749] (-1040.720) (-1050.250) (-1044.387) * [-1039.840] (-1048.588) (-1051.372) (-1056.050) -- 0:02:38
327000 -- (-1048.593) [-1044.240] (-1046.794) (-1039.483) * (-1041.713) [-1047.574] (-1055.924) (-1033.564) -- 0:02:38
327500 -- (-1047.928) (-1039.841) (-1052.680) [-1044.332] * [-1036.472] (-1052.612) (-1071.432) (-1043.582) -- 0:02:38
328000 -- (-1040.099) [-1045.648] (-1054.747) (-1053.505) * [-1040.946] (-1050.296) (-1048.746) (-1052.638) -- 0:02:37
328500 -- [-1045.574] (-1049.601) (-1052.021) (-1039.072) * (-1046.378) (-1048.181) [-1037.273] (-1043.329) -- 0:02:37
329000 -- (-1042.196) (-1053.657) [-1043.445] (-1043.627) * (-1051.855) (-1046.264) [-1050.795] (-1055.966) -- 0:02:37
329500 -- (-1039.742) (-1042.593) (-1058.284) [-1042.458] * (-1043.257) (-1051.106) (-1050.543) [-1047.962] -- 0:02:38
330000 -- [-1035.567] (-1046.175) (-1056.015) (-1040.267) * (-1048.405) (-1048.442) (-1055.406) [-1041.514] -- 0:02:38
Average standard deviation of split frequencies: 0.016062
330500 -- (-1048.672) [-1039.940] (-1069.915) (-1048.979) * [-1041.921] (-1053.350) (-1049.071) (-1045.196) -- 0:02:38
331000 -- (-1047.153) [-1040.579] (-1054.787) (-1049.442) * [-1049.803] (-1049.477) (-1037.980) (-1048.275) -- 0:02:37
331500 -- [-1040.178] (-1049.401) (-1058.249) (-1051.432) * [-1042.453] (-1057.551) (-1049.202) (-1036.905) -- 0:02:37
332000 -- (-1059.703) (-1064.550) (-1065.141) [-1050.081] * (-1055.106) [-1035.568] (-1047.148) (-1053.779) -- 0:02:36
332500 -- (-1051.233) [-1057.437] (-1068.071) (-1059.598) * (-1054.240) (-1048.285) (-1043.672) [-1050.162] -- 0:02:36
333000 -- (-1041.463) [-1044.416] (-1055.238) (-1049.523) * (-1057.976) [-1042.655] (-1056.128) (-1049.844) -- 0:02:36
333500 -- (-1060.903) (-1062.403) [-1043.944] (-1058.226) * (-1048.858) [-1042.117] (-1046.757) (-1036.191) -- 0:02:35
334000 -- [-1049.564] (-1051.527) (-1050.294) (-1056.675) * (-1045.660) (-1056.318) [-1035.687] (-1059.971) -- 0:02:37
334500 -- [-1038.132] (-1040.839) (-1060.081) (-1050.250) * [-1047.326] (-1050.836) (-1051.871) (-1064.560) -- 0:02:37
335000 -- (-1045.221) (-1038.213) (-1064.525) [-1041.696] * (-1059.315) (-1046.200) [-1045.266] (-1053.573) -- 0:02:36
Average standard deviation of split frequencies: 0.015152
335500 -- (-1042.572) [-1043.430] (-1044.053) (-1053.795) * (-1053.909) [-1039.423] (-1045.513) (-1043.278) -- 0:02:36
336000 -- (-1044.427) [-1036.780] (-1047.486) (-1054.049) * (-1068.631) (-1041.486) [-1052.314] (-1048.173) -- 0:02:36
336500 -- (-1044.319) [-1046.588] (-1039.274) (-1046.703) * (-1043.893) [-1042.366] (-1055.628) (-1047.652) -- 0:02:35
337000 -- (-1050.117) (-1047.043) [-1049.712] (-1053.231) * (-1056.576) (-1056.079) (-1045.868) [-1050.100] -- 0:02:35
337500 -- [-1041.944] (-1052.212) (-1049.986) (-1042.080) * (-1047.025) (-1041.853) [-1039.452] (-1066.942) -- 0:02:35
338000 -- [-1043.533] (-1050.955) (-1051.595) (-1049.366) * (-1056.938) [-1041.966] (-1036.135) (-1048.746) -- 0:02:36
338500 -- [-1040.631] (-1052.349) (-1049.973) (-1050.875) * [-1046.172] (-1049.767) (-1052.559) (-1064.043) -- 0:02:36
339000 -- (-1048.232) [-1046.207] (-1046.048) (-1056.408) * (-1042.853) (-1047.854) [-1051.201] (-1059.863) -- 0:02:35
339500 -- [-1043.991] (-1052.203) (-1042.347) (-1053.200) * (-1049.099) (-1049.787) [-1039.080] (-1044.237) -- 0:02:35
340000 -- (-1042.072) (-1050.562) [-1039.259] (-1064.970) * (-1042.884) (-1043.866) [-1035.692] (-1067.161) -- 0:02:35
Average standard deviation of split frequencies: 0.015037
340500 -- (-1050.390) (-1067.709) [-1052.088] (-1065.077) * [-1037.598] (-1051.270) (-1040.939) (-1057.533) -- 0:02:34
341000 -- [-1035.814] (-1059.655) (-1036.779) (-1048.898) * (-1053.058) (-1048.456) (-1035.484) [-1044.170] -- 0:02:34
341500 -- (-1041.985) (-1058.241) [-1040.677] (-1050.992) * (-1051.701) (-1043.777) [-1045.361] (-1050.838) -- 0:02:34
342000 -- (-1046.224) (-1046.511) [-1037.275] (-1050.127) * (-1069.753) (-1055.829) (-1066.817) [-1047.638] -- 0:02:35
342500 -- (-1047.526) (-1043.432) (-1054.459) [-1040.408] * (-1053.374) [-1043.497] (-1058.613) (-1047.764) -- 0:02:35
343000 -- (-1061.214) (-1045.459) (-1049.500) [-1040.648] * (-1049.942) (-1046.639) [-1040.238] (-1034.026) -- 0:02:35
343500 -- (-1055.602) (-1043.264) (-1048.935) [-1050.483] * (-1055.386) [-1052.735] (-1055.252) (-1041.759) -- 0:02:34
344000 -- [-1039.131] (-1074.701) (-1053.346) (-1044.061) * [-1048.181] (-1049.517) (-1059.117) (-1039.630) -- 0:02:34
344500 -- [-1043.549] (-1051.393) (-1051.114) (-1048.679) * [-1046.058] (-1065.895) (-1062.350) (-1044.737) -- 0:02:34
345000 -- (-1041.870) (-1057.107) [-1036.385] (-1060.935) * (-1035.706) (-1051.628) (-1064.059) [-1037.367] -- 0:02:33
Average standard deviation of split frequencies: 0.016258
345500 -- (-1042.858) [-1044.395] (-1041.532) (-1041.043) * [-1043.118] (-1053.785) (-1044.742) (-1040.127) -- 0:02:33
346000 -- (-1042.280) (-1041.875) (-1048.794) [-1038.603] * (-1043.844) [-1034.608] (-1043.467) (-1053.749) -- 0:02:33
346500 -- (-1051.568) [-1040.908] (-1056.047) (-1054.048) * (-1039.881) (-1046.386) [-1046.492] (-1045.371) -- 0:02:34
347000 -- (-1048.664) [-1041.682] (-1051.604) (-1065.586) * (-1052.041) (-1039.994) (-1060.333) [-1056.940] -- 0:02:34
347500 -- (-1050.494) [-1041.648] (-1043.094) (-1052.099) * (-1039.314) [-1045.592] (-1065.866) (-1046.797) -- 0:02:33
348000 -- (-1041.171) [-1035.770] (-1038.271) (-1048.734) * (-1043.196) [-1044.048] (-1049.051) (-1055.682) -- 0:02:33
348500 -- [-1040.606] (-1044.922) (-1045.099) (-1046.610) * (-1050.630) (-1060.446) (-1055.677) [-1035.517] -- 0:02:33
349000 -- [-1045.207] (-1051.646) (-1049.684) (-1050.246) * (-1045.799) (-1045.910) (-1056.845) [-1039.208] -- 0:02:32
349500 -- (-1050.080) [-1046.377] (-1059.141) (-1044.434) * (-1045.132) (-1048.529) (-1046.365) [-1037.769] -- 0:02:32
350000 -- (-1039.235) [-1038.850] (-1038.882) (-1042.068) * (-1046.735) (-1046.779) (-1043.318) [-1030.025] -- 0:02:32
Average standard deviation of split frequencies: 0.016669
350500 -- (-1052.718) [-1048.762] (-1065.518) (-1043.088) * (-1049.494) (-1050.605) (-1042.520) [-1043.771] -- 0:02:33
351000 -- [-1037.732] (-1046.757) (-1054.148) (-1052.538) * [-1042.397] (-1042.051) (-1050.734) (-1051.140) -- 0:02:33
351500 -- (-1041.480) [-1050.173] (-1053.250) (-1052.070) * (-1045.395) (-1035.999) (-1055.311) [-1036.936] -- 0:02:33
352000 -- (-1060.498) (-1048.336) (-1038.746) [-1040.304] * [-1043.199] (-1042.497) (-1045.560) (-1060.701) -- 0:02:32
352500 -- (-1038.922) (-1053.679) [-1038.712] (-1047.752) * [-1037.869] (-1050.922) (-1039.852) (-1055.123) -- 0:02:32
353000 -- (-1053.496) [-1046.795] (-1040.354) (-1051.159) * [-1041.795] (-1050.758) (-1055.651) (-1050.654) -- 0:02:32
353500 -- (-1045.771) [-1034.898] (-1050.705) (-1049.007) * [-1045.138] (-1048.798) (-1051.270) (-1048.561) -- 0:02:31
354000 -- [-1048.939] (-1046.739) (-1035.046) (-1054.642) * (-1046.716) (-1042.061) [-1039.505] (-1047.819) -- 0:02:31
354500 -- (-1055.851) (-1061.509) (-1042.779) [-1042.055] * [-1045.304] (-1044.242) (-1049.399) (-1048.435) -- 0:02:31
355000 -- (-1055.341) (-1060.548) [-1042.996] (-1041.922) * (-1053.716) [-1038.920] (-1040.023) (-1048.485) -- 0:02:32
Average standard deviation of split frequencies: 0.017214
355500 -- (-1052.500) (-1056.762) (-1043.934) [-1050.342] * [-1041.137] (-1042.429) (-1057.577) (-1035.782) -- 0:02:32
356000 -- (-1049.880) (-1042.133) (-1053.800) [-1038.345] * (-1044.645) [-1041.985] (-1046.938) (-1037.977) -- 0:02:31
356500 -- (-1043.111) [-1060.165] (-1047.955) (-1047.058) * (-1043.541) (-1041.282) (-1056.177) [-1044.136] -- 0:02:31
357000 -- [-1038.835] (-1053.833) (-1046.987) (-1043.169) * [-1038.076] (-1048.369) (-1044.755) (-1042.659) -- 0:02:31
357500 -- (-1043.156) [-1034.935] (-1041.778) (-1054.385) * (-1042.854) (-1057.362) (-1035.794) [-1040.981] -- 0:02:30
358000 -- (-1040.162) (-1057.449) [-1041.684] (-1053.770) * (-1054.568) (-1040.485) [-1040.865] (-1061.475) -- 0:02:30
358500 -- (-1048.858) (-1047.595) [-1034.196] (-1055.979) * (-1055.863) (-1043.419) (-1057.415) [-1036.252] -- 0:02:30
359000 -- (-1047.952) [-1049.016] (-1040.719) (-1058.668) * (-1058.454) (-1050.504) [-1046.654] (-1045.268) -- 0:02:31
359500 -- (-1046.091) [-1048.673] (-1041.693) (-1053.368) * (-1048.186) (-1055.852) (-1049.948) [-1039.138] -- 0:02:31
360000 -- (-1053.525) (-1048.569) [-1039.824] (-1047.878) * (-1054.932) (-1062.229) (-1050.601) [-1042.433] -- 0:02:31
Average standard deviation of split frequencies: 0.016991
360500 -- [-1048.414] (-1058.015) (-1060.202) (-1043.353) * (-1047.080) (-1038.245) [-1049.738] (-1041.761) -- 0:02:30
361000 -- (-1048.305) (-1045.230) [-1046.904] (-1061.947) * [-1051.580] (-1056.624) (-1041.054) (-1048.601) -- 0:02:30
361500 -- (-1051.114) [-1038.972] (-1043.373) (-1050.738) * (-1049.215) (-1040.110) (-1051.435) [-1042.673] -- 0:02:30
362000 -- (-1060.364) (-1045.029) [-1042.785] (-1037.758) * (-1055.267) (-1052.268) (-1041.660) [-1039.068] -- 0:02:29
362500 -- (-1052.965) [-1046.962] (-1048.594) (-1045.608) * (-1044.736) [-1042.866] (-1046.224) (-1047.112) -- 0:02:29
363000 -- (-1059.285) [-1037.917] (-1045.155) (-1057.812) * (-1041.569) (-1041.890) [-1040.506] (-1045.255) -- 0:02:29
363500 -- (-1064.610) [-1044.645] (-1049.044) (-1046.367) * (-1040.677) (-1042.455) [-1046.564] (-1070.876) -- 0:02:30
364000 -- (-1041.010) (-1053.634) [-1053.997] (-1060.657) * [-1032.469] (-1059.576) (-1041.785) (-1055.176) -- 0:02:30
364500 -- (-1067.219) (-1051.748) [-1039.614] (-1046.149) * (-1044.870) (-1069.899) [-1040.390] (-1055.457) -- 0:02:29
365000 -- (-1040.276) [-1040.828] (-1059.864) (-1049.878) * [-1040.299] (-1046.282) (-1050.765) (-1047.225) -- 0:02:29
Average standard deviation of split frequencies: 0.017603
365500 -- [-1045.000] (-1055.228) (-1043.678) (-1047.379) * (-1052.160) (-1047.433) (-1044.440) [-1054.622] -- 0:02:29
366000 -- [-1042.995] (-1039.622) (-1046.578) (-1050.693) * (-1044.831) [-1039.891] (-1043.050) (-1059.735) -- 0:02:28
366500 -- (-1038.855) [-1042.075] (-1048.754) (-1049.573) * (-1044.465) [-1046.272] (-1045.564) (-1056.672) -- 0:02:28
367000 -- (-1047.197) [-1048.086] (-1051.897) (-1044.824) * [-1034.282] (-1048.525) (-1084.238) (-1044.397) -- 0:02:28
367500 -- (-1051.381) (-1058.737) [-1036.027] (-1047.426) * (-1060.541) [-1040.704] (-1048.207) (-1054.326) -- 0:02:29
368000 -- (-1049.516) [-1043.903] (-1046.408) (-1039.306) * (-1045.682) [-1037.328] (-1043.266) (-1056.206) -- 0:02:29
368500 -- (-1051.529) [-1045.190] (-1051.912) (-1038.311) * [-1035.167] (-1057.441) (-1063.284) (-1042.111) -- 0:02:29
369000 -- (-1044.585) [-1045.555] (-1052.284) (-1044.949) * (-1047.394) (-1045.030) (-1043.875) [-1043.894] -- 0:02:28
369500 -- (-1045.488) [-1047.145] (-1049.764) (-1054.589) * (-1038.752) (-1039.228) [-1042.239] (-1039.559) -- 0:02:28
370000 -- (-1044.813) [-1052.891] (-1056.254) (-1036.328) * (-1053.027) (-1047.533) [-1040.473] (-1044.558) -- 0:02:28
Average standard deviation of split frequencies: 0.016787
370500 -- (-1064.120) (-1042.628) [-1043.966] (-1036.845) * (-1051.974) (-1051.749) (-1039.478) [-1043.284] -- 0:02:27
371000 -- (-1052.556) (-1044.454) [-1037.766] (-1043.958) * [-1047.889] (-1049.794) (-1052.565) (-1058.394) -- 0:02:27
371500 -- (-1043.456) [-1037.321] (-1053.965) (-1051.667) * (-1042.505) (-1054.508) (-1053.006) [-1039.555] -- 0:02:27
372000 -- [-1045.947] (-1057.172) (-1050.528) (-1058.339) * (-1057.383) (-1053.817) (-1049.082) [-1044.856] -- 0:02:28
372500 -- (-1056.882) [-1037.067] (-1040.394) (-1047.297) * (-1063.525) [-1049.600] (-1051.293) (-1047.598) -- 0:02:28
373000 -- (-1057.266) (-1042.078) (-1044.673) [-1044.946] * (-1054.173) (-1056.281) (-1044.798) [-1040.136] -- 0:02:27
373500 -- (-1048.358) [-1043.580] (-1055.025) (-1053.355) * [-1050.224] (-1053.380) (-1045.170) (-1049.511) -- 0:02:27
374000 -- (-1061.891) (-1035.312) [-1043.881] (-1054.071) * [-1044.571] (-1053.258) (-1058.807) (-1066.831) -- 0:02:27
374500 -- [-1044.644] (-1052.282) (-1040.243) (-1057.247) * (-1051.677) (-1058.490) (-1071.188) [-1045.017] -- 0:02:26
375000 -- (-1047.835) (-1056.571) [-1035.749] (-1053.190) * (-1039.763) (-1059.264) (-1052.030) [-1041.696] -- 0:02:26
Average standard deviation of split frequencies: 0.017134
375500 -- (-1041.158) (-1050.818) (-1040.076) [-1042.715] * [-1045.927] (-1065.069) (-1048.062) (-1038.423) -- 0:02:26
376000 -- (-1043.295) (-1057.413) (-1052.679) [-1042.581] * (-1053.753) (-1047.407) (-1040.779) [-1047.327] -- 0:02:27
376500 -- (-1043.836) (-1057.439) (-1037.884) [-1050.215] * (-1062.985) (-1051.739) (-1040.068) [-1041.281] -- 0:02:27
377000 -- (-1047.884) (-1059.199) [-1043.696] (-1047.787) * (-1052.056) (-1060.717) (-1033.904) [-1052.608] -- 0:02:27
377500 -- (-1046.995) (-1045.520) (-1050.232) [-1044.860] * (-1045.812) [-1049.551] (-1043.716) (-1065.660) -- 0:02:26
378000 -- [-1038.837] (-1048.612) (-1063.431) (-1044.574) * (-1052.273) (-1063.503) (-1044.340) [-1043.430] -- 0:02:26
378500 -- (-1048.808) [-1033.264] (-1061.761) (-1056.102) * [-1048.643] (-1058.734) (-1052.781) (-1050.821) -- 0:02:26
379000 -- (-1042.060) (-1047.579) [-1037.492] (-1047.535) * (-1049.218) (-1056.505) (-1033.098) [-1044.489] -- 0:02:25
379500 -- [-1039.019] (-1045.250) (-1039.928) (-1050.510) * (-1036.533) (-1073.398) (-1045.427) [-1056.835] -- 0:02:25
380000 -- (-1044.982) (-1055.689) (-1048.386) [-1035.714] * (-1052.972) (-1055.894) [-1056.246] (-1038.271) -- 0:02:25
Average standard deviation of split frequencies: 0.016099
380500 -- (-1046.743) (-1052.009) [-1036.467] (-1044.894) * [-1039.503] (-1054.627) (-1062.043) (-1037.348) -- 0:02:26
381000 -- (-1055.338) [-1043.524] (-1045.383) (-1049.938) * [-1038.062] (-1061.268) (-1043.072) (-1047.070) -- 0:02:26
381500 -- (-1048.256) (-1059.211) (-1045.753) [-1050.724] * (-1053.632) (-1067.846) (-1041.554) [-1050.525] -- 0:02:25
382000 -- (-1051.845) [-1045.492] (-1060.391) (-1049.527) * [-1047.092] (-1056.246) (-1045.462) (-1049.960) -- 0:02:25
382500 -- (-1053.686) [-1044.921] (-1049.008) (-1054.449) * [-1040.565] (-1059.061) (-1045.904) (-1048.396) -- 0:02:25
383000 -- (-1049.834) [-1043.719] (-1045.767) (-1050.093) * (-1051.275) (-1056.212) [-1031.417] (-1048.136) -- 0:02:24
383500 -- (-1046.131) [-1048.322] (-1054.654) (-1045.745) * [-1038.940] (-1060.125) (-1042.267) (-1057.916) -- 0:02:24
384000 -- [-1041.229] (-1036.452) (-1065.075) (-1046.283) * (-1044.091) (-1054.653) [-1037.141] (-1047.179) -- 0:02:24
384500 -- (-1054.914) (-1044.942) [-1039.245] (-1052.566) * (-1051.504) (-1070.989) (-1041.262) [-1037.372] -- 0:02:25
385000 -- (-1045.050) (-1059.920) [-1039.296] (-1053.326) * [-1044.238] (-1051.358) (-1042.073) (-1038.674) -- 0:02:25
Average standard deviation of split frequencies: 0.015713
385500 -- [-1042.163] (-1050.120) (-1054.584) (-1043.789) * (-1039.131) (-1066.428) (-1043.037) [-1038.804] -- 0:02:25
386000 -- (-1053.663) (-1047.179) [-1055.017] (-1037.413) * [-1036.298] (-1064.185) (-1061.217) (-1054.716) -- 0:02:24
386500 -- (-1043.222) (-1061.049) [-1040.915] (-1047.041) * [-1051.979] (-1060.388) (-1051.510) (-1062.350) -- 0:02:24
387000 -- [-1035.713] (-1034.227) (-1042.977) (-1046.985) * [-1034.575] (-1063.473) (-1049.629) (-1039.821) -- 0:02:24
387500 -- (-1042.544) [-1037.903] (-1054.360) (-1050.772) * (-1041.364) [-1044.133] (-1058.438) (-1056.368) -- 0:02:23
388000 -- (-1046.129) (-1052.155) [-1037.710] (-1051.245) * (-1035.715) [-1041.201] (-1054.714) (-1043.105) -- 0:02:23
388500 -- (-1050.596) (-1047.176) [-1036.541] (-1067.373) * (-1049.118) (-1059.758) (-1051.031) [-1041.082] -- 0:02:23
389000 -- (-1042.763) (-1045.524) [-1039.751] (-1046.999) * (-1045.859) (-1048.886) (-1045.370) [-1037.136] -- 0:02:24
389500 -- [-1040.658] (-1048.914) (-1039.833) (-1050.775) * (-1046.266) (-1047.210) [-1040.916] (-1040.532) -- 0:02:24
390000 -- (-1044.761) [-1041.421] (-1063.007) (-1064.295) * (-1040.528) (-1048.418) (-1051.856) [-1041.890] -- 0:02:23
Average standard deviation of split frequencies: 0.015606
390500 -- [-1036.760] (-1040.395) (-1064.711) (-1050.788) * (-1052.547) (-1055.685) (-1058.797) [-1044.312] -- 0:02:23
391000 -- (-1054.090) [-1042.291] (-1042.668) (-1051.371) * (-1042.439) (-1040.409) (-1047.177) [-1047.637] -- 0:02:23
391500 -- (-1050.139) (-1046.249) [-1045.322] (-1047.470) * (-1055.034) (-1045.588) (-1050.647) [-1041.054] -- 0:02:22
392000 -- (-1047.387) (-1044.903) (-1051.830) [-1039.702] * [-1037.488] (-1049.540) (-1053.064) (-1045.925) -- 0:02:22
392500 -- (-1052.810) [-1047.076] (-1041.575) (-1047.389) * [-1034.259] (-1047.350) (-1049.000) (-1055.113) -- 0:02:22
393000 -- (-1051.589) (-1055.969) (-1048.339) [-1049.987] * [-1039.697] (-1039.311) (-1058.299) (-1059.570) -- 0:02:23
393500 -- (-1053.458) (-1070.604) (-1038.728) [-1044.917] * (-1050.298) (-1051.168) (-1044.759) [-1044.338] -- 0:02:23
394000 -- (-1061.866) (-1056.692) [-1044.390] (-1046.302) * (-1057.032) (-1043.325) [-1049.946] (-1048.005) -- 0:02:23
394500 -- (-1060.187) (-1046.790) (-1056.985) [-1050.234] * (-1053.599) (-1053.436) [-1040.277] (-1054.578) -- 0:02:22
395000 -- (-1045.802) [-1046.901] (-1061.676) (-1037.724) * [-1048.288] (-1055.484) (-1044.540) (-1062.343) -- 0:02:22
Average standard deviation of split frequencies: 0.015158
395500 -- (-1057.165) [-1038.027] (-1052.160) (-1045.848) * (-1049.647) (-1050.131) [-1041.545] (-1041.427) -- 0:02:22
396000 -- (-1050.222) (-1048.656) (-1049.180) [-1041.650] * (-1056.416) (-1048.831) [-1042.164] (-1054.793) -- 0:02:21
396500 -- (-1045.321) (-1051.994) [-1057.435] (-1042.677) * (-1037.897) (-1048.948) [-1044.725] (-1060.398) -- 0:02:21
397000 -- (-1044.242) [-1042.823] (-1060.685) (-1046.922) * [-1052.824] (-1055.989) (-1049.107) (-1055.543) -- 0:02:21
397500 -- (-1054.094) [-1039.214] (-1050.828) (-1050.775) * (-1043.667) (-1054.851) [-1040.392] (-1054.761) -- 0:02:22
398000 -- (-1063.412) [-1042.625] (-1060.071) (-1045.547) * (-1042.432) (-1048.223) [-1044.649] (-1053.868) -- 0:02:22
398500 -- (-1043.044) [-1048.479] (-1066.703) (-1051.446) * (-1049.925) (-1059.097) (-1036.544) [-1058.181] -- 0:02:21
399000 -- (-1041.694) [-1043.422] (-1059.968) (-1050.488) * (-1046.638) (-1066.702) (-1042.473) [-1040.001] -- 0:02:21
399500 -- [-1042.730] (-1044.713) (-1042.696) (-1055.141) * (-1049.089) (-1064.489) (-1051.702) [-1041.098] -- 0:02:21
400000 -- (-1036.344) (-1046.587) [-1049.415] (-1051.880) * [-1040.399] (-1075.455) (-1047.385) (-1040.228) -- 0:02:21
Average standard deviation of split frequencies: 0.014791
400500 -- (-1042.717) [-1045.478] (-1052.597) (-1052.524) * (-1047.521) (-1067.769) [-1041.485] (-1042.709) -- 0:02:20
401000 -- (-1051.276) [-1041.379] (-1050.238) (-1053.066) * (-1051.316) (-1079.835) [-1051.317] (-1048.366) -- 0:02:20
401500 -- (-1050.079) [-1044.941] (-1041.361) (-1061.907) * (-1056.160) (-1058.606) (-1045.373) [-1043.874] -- 0:02:21
402000 -- [-1045.192] (-1051.130) (-1056.466) (-1048.612) * (-1055.032) (-1069.057) (-1046.690) [-1039.850] -- 0:02:21
402500 -- (-1041.639) [-1046.853] (-1044.542) (-1060.790) * [-1048.832] (-1061.396) (-1043.503) (-1041.322) -- 0:02:21
403000 -- [-1044.017] (-1041.934) (-1051.284) (-1067.114) * (-1058.756) [-1051.113] (-1039.945) (-1038.001) -- 0:02:20
403500 -- (-1061.595) (-1051.319) [-1045.274] (-1048.120) * (-1063.281) (-1055.944) (-1044.675) [-1033.807] -- 0:02:20
404000 -- [-1035.564] (-1043.845) (-1036.916) (-1061.040) * (-1061.335) (-1059.181) (-1047.796) [-1044.720] -- 0:02:20
404500 -- [-1044.784] (-1051.223) (-1049.931) (-1064.087) * [-1059.636] (-1068.230) (-1043.486) (-1043.999) -- 0:02:19
405000 -- (-1052.526) [-1044.917] (-1045.507) (-1062.108) * (-1049.397) (-1053.070) [-1052.473] (-1043.763) -- 0:02:19
Average standard deviation of split frequencies: 0.014348
405500 -- (-1045.751) [-1045.038] (-1044.715) (-1060.955) * (-1059.981) (-1064.096) (-1046.744) [-1047.327] -- 0:02:19
406000 -- (-1046.043) (-1041.075) [-1049.659] (-1060.017) * (-1042.941) (-1061.796) [-1038.586] (-1047.818) -- 0:02:20
406500 -- (-1046.691) [-1043.151] (-1053.847) (-1050.917) * (-1059.695) (-1056.774) [-1050.780] (-1043.295) -- 0:02:20
407000 -- [-1044.237] (-1042.360) (-1056.397) (-1053.882) * (-1055.187) (-1062.921) (-1053.192) [-1039.484] -- 0:02:19
407500 -- (-1044.139) [-1048.080] (-1047.886) (-1051.642) * [-1050.018] (-1065.273) (-1053.371) (-1045.820) -- 0:02:19
408000 -- [-1050.330] (-1044.094) (-1054.266) (-1062.710) * (-1045.793) (-1061.057) (-1057.743) [-1042.052] -- 0:02:19
408500 -- (-1049.407) (-1039.926) [-1056.536] (-1057.873) * (-1051.455) (-1055.819) [-1045.694] (-1061.448) -- 0:02:19
409000 -- [-1037.370] (-1042.542) (-1059.984) (-1060.515) * (-1059.531) [-1043.868] (-1050.202) (-1053.586) -- 0:02:18
409500 -- [-1030.761] (-1048.786) (-1039.797) (-1073.413) * (-1033.861) (-1052.369) (-1050.856) [-1037.883] -- 0:02:18
410000 -- (-1039.626) [-1043.893] (-1048.320) (-1069.868) * (-1036.276) (-1048.110) [-1042.113] (-1033.265) -- 0:02:19
Average standard deviation of split frequencies: 0.013611
410500 -- (-1055.505) [-1034.498] (-1038.596) (-1062.360) * [-1037.088] (-1046.763) (-1063.505) (-1042.991) -- 0:02:19
411000 -- (-1043.512) (-1038.977) [-1048.894] (-1053.450) * (-1038.882) (-1047.010) [-1050.594] (-1038.549) -- 0:02:19
411500 -- (-1044.746) [-1043.978] (-1050.110) (-1068.011) * (-1050.052) [-1046.102] (-1055.257) (-1043.061) -- 0:02:18
412000 -- (-1044.589) [-1038.772] (-1044.141) (-1066.676) * (-1038.998) [-1047.431] (-1053.892) (-1038.345) -- 0:02:18
412500 -- [-1040.323] (-1039.284) (-1062.544) (-1057.653) * [-1036.613] (-1049.522) (-1053.517) (-1049.673) -- 0:02:18
413000 -- (-1049.717) [-1036.749] (-1068.495) (-1058.291) * (-1046.044) (-1049.784) (-1050.688) [-1035.155] -- 0:02:17
413500 -- [-1050.093] (-1052.443) (-1058.506) (-1057.770) * (-1043.831) [-1051.763] (-1055.924) (-1049.053) -- 0:02:17
414000 -- (-1050.289) (-1045.280) [-1040.142] (-1061.192) * [-1050.715] (-1052.213) (-1046.001) (-1042.976) -- 0:02:17
414500 -- (-1058.585) (-1051.005) [-1044.656] (-1060.114) * (-1049.781) (-1043.980) [-1046.236] (-1043.745) -- 0:02:18
415000 -- (-1057.947) (-1041.913) (-1043.589) [-1044.180] * (-1051.975) (-1045.723) [-1044.549] (-1055.665) -- 0:02:18
Average standard deviation of split frequencies: 0.014489
415500 -- (-1069.894) (-1046.170) (-1053.427) [-1034.925] * [-1047.796] (-1054.290) (-1047.228) (-1060.027) -- 0:02:17
416000 -- (-1053.921) (-1040.876) [-1043.150] (-1039.377) * (-1057.262) [-1045.195] (-1055.192) (-1059.702) -- 0:02:17
416500 -- [-1051.308] (-1046.760) (-1047.714) (-1052.227) * (-1040.863) (-1051.507) (-1061.506) [-1046.523] -- 0:02:17
417000 -- (-1050.751) [-1043.669] (-1042.859) (-1051.107) * (-1046.377) (-1049.086) (-1042.422) [-1033.241] -- 0:02:17
417500 -- (-1048.575) (-1050.105) [-1046.375] (-1047.599) * [-1046.116] (-1036.836) (-1049.186) (-1047.678) -- 0:02:16
418000 -- (-1053.038) (-1041.426) (-1055.428) [-1041.565] * (-1042.304) (-1059.937) (-1046.612) [-1043.854] -- 0:02:16
418500 -- (-1050.078) (-1037.032) [-1049.066] (-1043.842) * (-1044.471) [-1053.157] (-1045.777) (-1041.817) -- 0:02:17
419000 -- (-1060.256) (-1046.552) (-1053.686) [-1044.250] * [-1036.461] (-1065.423) (-1056.985) (-1044.534) -- 0:02:17
419500 -- (-1071.348) (-1047.851) [-1044.352] (-1042.671) * [-1042.920] (-1065.280) (-1068.074) (-1045.363) -- 0:02:16
420000 -- (-1063.111) (-1056.124) (-1056.969) [-1036.244] * (-1053.124) [-1040.843] (-1051.970) (-1039.541) -- 0:02:16
Average standard deviation of split frequencies: 0.013607
420500 -- (-1071.558) (-1055.858) [-1060.310] (-1051.358) * [-1044.155] (-1046.380) (-1057.803) (-1056.377) -- 0:02:16
421000 -- (-1040.514) [-1041.779] (-1050.193) (-1046.650) * (-1041.746) [-1047.267] (-1061.626) (-1054.232) -- 0:02:16
421500 -- (-1052.833) [-1044.126] (-1056.669) (-1057.364) * (-1048.438) [-1045.030] (-1048.079) (-1043.420) -- 0:02:15
422000 -- (-1052.520) (-1051.360) [-1036.480] (-1043.816) * (-1042.410) [-1039.529] (-1061.439) (-1045.803) -- 0:02:15
422500 -- (-1059.222) (-1044.936) (-1049.491) [-1040.054] * (-1047.620) [-1046.094] (-1056.029) (-1053.090) -- 0:02:15
423000 -- (-1057.085) (-1045.261) [-1039.797] (-1036.669) * (-1059.320) [-1043.340] (-1049.644) (-1050.616) -- 0:02:16
423500 -- (-1052.875) (-1045.551) [-1037.104] (-1040.244) * (-1048.100) (-1047.214) [-1044.257] (-1059.250) -- 0:02:16
424000 -- (-1060.131) [-1044.945] (-1038.341) (-1055.099) * (-1046.500) (-1055.092) [-1035.431] (-1050.281) -- 0:02:15
424500 -- (-1061.347) [-1043.591] (-1062.083) (-1043.449) * (-1049.265) (-1048.181) [-1037.359] (-1051.155) -- 0:02:15
425000 -- (-1055.729) [-1042.123] (-1057.550) (-1049.842) * (-1047.337) [-1040.968] (-1044.087) (-1044.495) -- 0:02:15
Average standard deviation of split frequencies: 0.013042
425500 -- [-1053.745] (-1041.955) (-1041.340) (-1055.230) * (-1056.453) (-1054.988) [-1047.881] (-1036.260) -- 0:02:15
426000 -- (-1059.578) (-1045.541) (-1054.619) [-1058.304] * (-1053.248) [-1039.707] (-1045.973) (-1045.068) -- 0:02:14
426500 -- (-1067.686) (-1042.141) (-1056.499) [-1050.997] * [-1043.232] (-1045.819) (-1051.602) (-1041.099) -- 0:02:14
427000 -- (-1047.796) (-1053.791) (-1051.679) [-1043.844] * [-1046.641] (-1047.968) (-1047.899) (-1036.663) -- 0:02:15
427500 -- (-1042.918) (-1057.545) [-1046.199] (-1045.913) * (-1047.252) [-1044.080] (-1039.734) (-1052.532) -- 0:02:15
428000 -- (-1050.579) (-1055.962) (-1059.237) [-1038.906] * (-1043.222) [-1047.802] (-1047.756) (-1057.754) -- 0:02:14
428500 -- (-1053.444) [-1046.106] (-1056.667) (-1038.703) * (-1044.857) (-1053.696) (-1043.230) [-1043.923] -- 0:02:14
429000 -- (-1055.921) [-1044.171] (-1042.553) (-1047.526) * (-1052.088) (-1041.765) [-1037.706] (-1045.497) -- 0:02:14
429500 -- [-1033.967] (-1045.713) (-1042.836) (-1051.016) * (-1054.773) (-1040.836) [-1039.569] (-1055.867) -- 0:02:14
430000 -- (-1045.853) [-1037.167] (-1050.460) (-1043.904) * (-1041.740) [-1045.236] (-1039.800) (-1045.972) -- 0:02:13
Average standard deviation of split frequencies: 0.013682
430500 -- (-1046.851) (-1050.139) [-1041.191] (-1049.779) * [-1040.801] (-1050.178) (-1047.442) (-1055.503) -- 0:02:13
431000 -- (-1055.113) (-1044.555) (-1049.737) [-1047.425] * (-1049.250) [-1042.213] (-1054.829) (-1051.235) -- 0:02:14
431500 -- (-1051.997) (-1054.757) [-1034.723] (-1055.143) * [-1043.564] (-1060.420) (-1041.688) (-1047.263) -- 0:02:14
432000 -- (-1058.528) (-1069.058) [-1033.671] (-1043.673) * (-1047.621) (-1053.596) [-1046.580] (-1043.738) -- 0:02:14
432500 -- (-1041.793) [-1039.789] (-1041.553) (-1066.944) * (-1046.824) [-1036.499] (-1039.277) (-1052.673) -- 0:02:13
433000 -- [-1052.118] (-1057.126) (-1043.232) (-1058.622) * [-1050.805] (-1047.079) (-1054.205) (-1044.694) -- 0:02:13
433500 -- (-1037.602) (-1059.465) [-1040.012] (-1048.780) * (-1067.788) (-1045.848) (-1043.426) [-1036.901] -- 0:02:13
434000 -- (-1036.063) (-1049.048) [-1047.076] (-1042.150) * (-1051.035) (-1047.694) (-1053.100) [-1037.259] -- 0:02:13
434500 -- (-1044.134) [-1043.569] (-1046.729) (-1046.068) * (-1065.998) (-1049.801) (-1052.772) [-1043.671] -- 0:02:12
435000 -- (-1048.823) (-1048.716) [-1042.867] (-1061.654) * [-1042.557] (-1050.651) (-1043.812) (-1056.290) -- 0:02:12
Average standard deviation of split frequencies: 0.013551
435500 -- (-1056.678) (-1053.438) (-1045.015) [-1048.994] * [-1047.059] (-1061.905) (-1051.428) (-1042.489) -- 0:02:13
436000 -- [-1048.054] (-1046.276) (-1047.388) (-1041.681) * (-1046.848) (-1056.567) (-1063.288) [-1036.119] -- 0:02:13
436500 -- (-1048.370) (-1050.938) [-1033.614] (-1054.258) * [-1041.775] (-1057.106) (-1043.723) (-1041.833) -- 0:02:12
437000 -- (-1047.491) [-1051.368] (-1052.659) (-1049.277) * (-1051.106) (-1060.083) [-1045.240] (-1041.494) -- 0:02:12
437500 -- [-1046.998] (-1059.679) (-1045.978) (-1045.564) * (-1060.295) (-1044.661) (-1060.768) [-1037.356] -- 0:02:12
438000 -- [-1045.386] (-1041.724) (-1041.215) (-1061.270) * (-1038.940) [-1045.918] (-1045.092) (-1042.026) -- 0:02:12
438500 -- (-1041.391) (-1032.892) [-1046.478] (-1057.838) * (-1051.352) [-1042.271] (-1051.812) (-1045.887) -- 0:02:11
439000 -- (-1048.657) (-1044.553) [-1048.427] (-1050.017) * (-1055.320) (-1049.974) [-1038.213] (-1055.309) -- 0:02:11
439500 -- (-1052.753) [-1047.435] (-1041.649) (-1045.027) * (-1050.872) (-1054.378) [-1043.950] (-1059.020) -- 0:02:12
440000 -- (-1055.220) [-1047.505] (-1038.550) (-1037.923) * [-1056.789] (-1043.845) (-1052.052) (-1056.356) -- 0:02:12
Average standard deviation of split frequencies: 0.013219
440500 -- (-1045.962) (-1035.899) (-1049.171) [-1047.364] * (-1045.212) [-1042.778] (-1042.543) (-1050.680) -- 0:02:12
441000 -- (-1048.950) (-1040.506) (-1049.697) [-1050.376] * (-1052.994) [-1036.058] (-1043.509) (-1039.995) -- 0:02:11
441500 -- (-1052.730) (-1043.975) (-1049.416) [-1047.461] * (-1036.300) (-1037.633) [-1031.514] (-1048.148) -- 0:02:11
442000 -- (-1063.164) [-1041.202] (-1040.893) (-1053.060) * [-1043.841] (-1061.268) (-1047.981) (-1055.416) -- 0:02:11
442500 -- (-1066.089) (-1037.543) [-1038.102] (-1058.128) * (-1045.729) (-1066.063) [-1044.328] (-1046.380) -- 0:02:11
443000 -- (-1049.789) [-1047.338] (-1049.261) (-1041.953) * (-1044.643) (-1039.853) [-1040.888] (-1058.356) -- 0:02:10
443500 -- [-1042.300] (-1056.843) (-1053.783) (-1039.425) * (-1061.188) (-1045.069) [-1037.158] (-1054.512) -- 0:02:10
444000 -- (-1044.184) (-1061.178) [-1039.711] (-1042.363) * [-1048.268] (-1055.212) (-1038.128) (-1050.092) -- 0:02:11
444500 -- (-1045.123) (-1053.640) [-1037.629] (-1042.283) * [-1043.643] (-1043.628) (-1060.249) (-1053.531) -- 0:02:11
445000 -- (-1044.913) (-1046.722) [-1040.298] (-1048.004) * (-1048.227) [-1041.566] (-1049.754) (-1052.413) -- 0:02:10
Average standard deviation of split frequencies: 0.013816
445500 -- (-1046.501) [-1044.620] (-1054.418) (-1041.725) * (-1048.844) [-1041.543] (-1043.543) (-1039.806) -- 0:02:10
446000 -- [-1047.700] (-1040.040) (-1051.150) (-1046.734) * (-1054.660) (-1055.902) [-1042.712] (-1049.040) -- 0:02:10
446500 -- (-1043.163) (-1051.328) (-1068.586) [-1040.000] * (-1051.512) (-1050.986) [-1046.346] (-1038.159) -- 0:02:10
447000 -- [-1035.774] (-1052.588) (-1057.047) (-1038.608) * (-1052.739) (-1056.002) (-1046.947) [-1038.477] -- 0:02:09
447500 -- [-1047.579] (-1044.989) (-1055.463) (-1045.709) * (-1051.777) (-1053.277) (-1057.049) [-1036.853] -- 0:02:09
448000 -- [-1042.547] (-1044.549) (-1046.988) (-1044.022) * (-1047.733) (-1051.328) (-1039.844) [-1038.744] -- 0:02:10
448500 -- (-1069.225) (-1047.140) [-1044.344] (-1056.714) * (-1042.315) (-1044.180) [-1042.737] (-1054.321) -- 0:02:10
449000 -- (-1042.255) [-1044.258] (-1053.013) (-1052.532) * [-1051.220] (-1053.599) (-1052.754) (-1047.672) -- 0:02:10
449500 -- (-1051.984) [-1030.941] (-1049.711) (-1047.584) * (-1048.335) (-1059.809) [-1044.946] (-1044.134) -- 0:02:09
450000 -- (-1050.329) [-1044.993] (-1047.027) (-1043.017) * [-1048.070] (-1041.998) (-1045.372) (-1054.871) -- 0:02:09
Average standard deviation of split frequencies: 0.014794
450500 -- (-1045.261) (-1042.689) (-1055.228) [-1042.937] * (-1039.635) (-1049.643) [-1034.205] (-1051.179) -- 0:02:09
451000 -- [-1044.051] (-1051.204) (-1065.336) (-1049.800) * (-1041.542) (-1052.632) (-1046.336) [-1044.353] -- 0:02:09
451500 -- (-1052.840) [-1045.309] (-1053.787) (-1045.803) * (-1051.317) (-1048.759) [-1046.038] (-1043.182) -- 0:02:08
452000 -- (-1059.535) (-1050.474) (-1051.552) [-1039.645] * (-1039.774) [-1040.793] (-1046.226) (-1049.872) -- 0:02:09
452500 -- (-1055.158) (-1048.294) [-1040.947] (-1045.464) * [-1046.153] (-1052.915) (-1051.377) (-1040.548) -- 0:02:09
453000 -- (-1051.429) (-1041.734) (-1045.268) [-1034.390] * (-1041.401) [-1039.881] (-1052.707) (-1049.038) -- 0:02:09
453500 -- (-1053.551) (-1049.267) [-1043.573] (-1051.865) * (-1045.829) (-1041.457) (-1039.928) [-1046.470] -- 0:02:08
454000 -- (-1067.785) (-1050.283) [-1045.304] (-1040.757) * (-1041.982) (-1054.290) [-1048.029] (-1045.609) -- 0:02:08
454500 -- (-1043.504) [-1040.058] (-1046.259) (-1046.807) * (-1039.787) [-1037.929] (-1050.388) (-1044.322) -- 0:02:08
455000 -- (-1054.348) [-1044.749] (-1049.323) (-1052.469) * (-1037.456) [-1037.967] (-1041.733) (-1056.730) -- 0:02:08
Average standard deviation of split frequencies: 0.015211
455500 -- (-1042.529) [-1039.275] (-1044.898) (-1053.414) * [-1041.088] (-1054.533) (-1054.564) (-1050.698) -- 0:02:07
456000 -- [-1041.608] (-1047.693) (-1045.024) (-1046.385) * (-1050.721) (-1041.124) [-1047.751] (-1062.020) -- 0:02:07
456500 -- (-1038.985) [-1039.361] (-1053.559) (-1053.414) * [-1046.491] (-1041.652) (-1047.995) (-1048.792) -- 0:02:08
457000 -- [-1046.971] (-1050.243) (-1053.106) (-1057.779) * (-1044.669) [-1038.786] (-1041.800) (-1057.051) -- 0:02:08
457500 -- [-1043.204] (-1042.461) (-1054.138) (-1053.162) * (-1042.863) (-1047.302) [-1040.602] (-1050.584) -- 0:02:08
458000 -- (-1051.483) (-1044.553) (-1052.255) [-1037.559] * (-1044.096) (-1049.346) (-1052.648) [-1041.758] -- 0:02:07
458500 -- (-1044.452) [-1041.139] (-1059.175) (-1050.445) * (-1048.025) (-1043.066) (-1049.098) [-1041.631] -- 0:02:07
459000 -- [-1038.860] (-1042.889) (-1048.425) (-1040.485) * (-1051.941) (-1040.686) [-1036.600] (-1037.037) -- 0:02:07
459500 -- [-1043.593] (-1047.019) (-1051.385) (-1061.708) * (-1056.467) [-1047.070] (-1047.431) (-1038.961) -- 0:02:07
460000 -- [-1043.834] (-1049.601) (-1044.528) (-1050.845) * (-1044.707) (-1053.019) (-1052.097) [-1036.358] -- 0:02:06
Average standard deviation of split frequencies: 0.014546
460500 -- (-1045.231) (-1042.582) [-1045.393] (-1060.245) * [-1034.753] (-1037.898) (-1051.024) (-1056.198) -- 0:02:07
461000 -- (-1049.549) (-1049.709) (-1070.207) [-1051.607] * (-1044.778) (-1056.403) [-1045.714] (-1038.470) -- 0:02:07
461500 -- [-1043.376] (-1050.287) (-1063.902) (-1048.474) * (-1035.481) (-1049.228) (-1049.023) [-1039.135] -- 0:02:07
462000 -- (-1047.955) [-1050.179] (-1049.828) (-1055.029) * (-1041.367) [-1047.563] (-1069.210) (-1053.199) -- 0:02:06
462500 -- (-1061.289) (-1053.171) (-1047.407) [-1041.763] * (-1050.237) (-1052.822) (-1053.071) [-1053.212] -- 0:02:06
463000 -- [-1045.027] (-1036.264) (-1056.250) (-1047.444) * [-1034.863] (-1039.542) (-1053.410) (-1054.474) -- 0:02:06
463500 -- [-1042.672] (-1045.130) (-1059.882) (-1042.680) * (-1045.350) (-1045.183) (-1050.566) [-1031.666] -- 0:02:06
464000 -- (-1051.813) [-1038.684] (-1048.590) (-1044.190) * (-1049.810) (-1049.853) [-1051.892] (-1039.052) -- 0:02:05
464500 -- (-1042.512) (-1048.877) [-1044.419] (-1058.044) * [-1035.433] (-1047.133) (-1049.477) (-1039.634) -- 0:02:05
465000 -- (-1055.247) [-1043.426] (-1043.075) (-1039.861) * [-1038.674] (-1039.115) (-1050.670) (-1044.408) -- 0:02:06
Average standard deviation of split frequencies: 0.015029
465500 -- [-1042.932] (-1044.800) (-1057.560) (-1065.208) * (-1051.490) (-1041.741) (-1047.061) [-1039.361] -- 0:02:06
466000 -- (-1052.891) [-1041.231] (-1055.169) (-1044.011) * [-1044.400] (-1044.446) (-1052.749) (-1047.127) -- 0:02:06
466500 -- [-1036.086] (-1046.606) (-1039.910) (-1045.845) * (-1051.079) (-1056.626) (-1051.331) [-1034.912] -- 0:02:05
467000 -- (-1044.769) (-1055.566) [-1051.412] (-1045.297) * (-1056.012) (-1058.856) [-1041.474] (-1052.874) -- 0:02:05
467500 -- (-1051.643) (-1057.245) (-1040.759) [-1046.961] * (-1043.629) (-1050.064) [-1042.152] (-1054.664) -- 0:02:05
468000 -- (-1053.972) (-1046.761) [-1037.702] (-1042.821) * [-1042.565] (-1045.079) (-1046.095) (-1072.281) -- 0:02:05
468500 -- (-1057.475) (-1047.101) (-1042.382) [-1044.185] * [-1043.683] (-1046.196) (-1056.782) (-1057.634) -- 0:02:04
469000 -- [-1046.619] (-1052.816) (-1056.259) (-1052.220) * [-1047.056] (-1051.741) (-1065.279) (-1047.823) -- 0:02:04
469500 -- (-1058.554) (-1043.468) [-1053.431] (-1043.039) * (-1044.230) (-1044.623) (-1049.157) [-1044.510] -- 0:02:05
470000 -- (-1037.307) (-1042.650) [-1037.706] (-1061.649) * (-1047.311) [-1043.841] (-1050.403) (-1052.432) -- 0:02:05
Average standard deviation of split frequencies: 0.015882
470500 -- (-1049.250) [-1038.216] (-1056.360) (-1048.874) * [-1043.650] (-1043.340) (-1058.827) (-1048.971) -- 0:02:04
471000 -- (-1046.984) (-1063.084) [-1043.308] (-1044.094) * (-1064.363) (-1044.489) [-1039.644] (-1042.588) -- 0:02:04
471500 -- (-1043.091) (-1054.478) [-1047.694] (-1049.525) * (-1051.071) [-1043.354] (-1052.904) (-1038.363) -- 0:02:04
472000 -- (-1054.397) [-1047.803] (-1042.856) (-1044.186) * (-1039.306) (-1043.292) [-1040.748] (-1045.948) -- 0:02:04
472500 -- [-1037.132] (-1054.672) (-1049.073) (-1047.336) * [-1045.311] (-1058.664) (-1042.777) (-1037.288) -- 0:02:03
473000 -- (-1060.530) (-1049.418) (-1042.648) [-1043.773] * [-1038.754] (-1038.843) (-1045.247) (-1039.205) -- 0:02:03
473500 -- (-1052.294) (-1050.672) (-1044.187) [-1045.852] * (-1041.997) (-1047.888) (-1046.225) [-1043.212] -- 0:02:04
474000 -- (-1051.104) (-1044.654) [-1036.422] (-1043.886) * (-1046.218) (-1053.384) [-1044.669] (-1040.861) -- 0:02:04
474500 -- (-1038.673) (-1055.456) [-1037.112] (-1044.950) * (-1046.346) [-1046.012] (-1035.625) (-1047.874) -- 0:02:04
475000 -- (-1048.498) [-1041.874] (-1054.843) (-1049.929) * (-1046.741) (-1044.337) [-1035.952] (-1042.782) -- 0:02:03
Average standard deviation of split frequencies: 0.015492
475500 -- (-1040.856) (-1061.169) (-1055.183) [-1044.045] * (-1045.660) (-1043.389) (-1046.346) [-1051.857] -- 0:02:03
476000 -- [-1047.692] (-1042.102) (-1049.007) (-1051.459) * (-1047.481) (-1048.768) (-1052.666) [-1045.603] -- 0:02:03
476500 -- (-1050.609) (-1051.114) (-1054.264) [-1045.885] * [-1036.378] (-1042.268) (-1057.351) (-1044.427) -- 0:02:03
477000 -- (-1050.243) (-1045.762) [-1038.927] (-1048.519) * (-1034.236) [-1043.966] (-1049.603) (-1061.737) -- 0:02:02
477500 -- (-1059.826) (-1041.647) [-1035.027] (-1063.315) * (-1051.021) [-1034.823] (-1037.705) (-1051.584) -- 0:02:03
478000 -- (-1045.428) (-1043.705) (-1039.949) [-1040.006] * [-1039.230] (-1048.932) (-1051.188) (-1043.908) -- 0:02:03
478500 -- (-1053.719) (-1046.231) (-1042.261) [-1042.412] * (-1051.580) (-1048.362) (-1038.542) [-1044.339] -- 0:02:03
479000 -- (-1047.162) [-1045.207] (-1050.227) (-1036.379) * (-1060.159) (-1043.244) [-1045.789] (-1045.364) -- 0:02:02
479500 -- (-1049.235) (-1049.366) (-1047.446) [-1044.761] * (-1069.649) [-1046.259] (-1045.094) (-1039.189) -- 0:02:02
480000 -- (-1036.268) [-1034.069] (-1057.867) (-1049.480) * (-1052.803) (-1041.380) [-1036.657] (-1055.957) -- 0:02:02
Average standard deviation of split frequencies: 0.016252
480500 -- (-1045.011) [-1044.594] (-1062.402) (-1041.973) * [-1046.428] (-1052.338) (-1037.270) (-1050.411) -- 0:02:02
481000 -- (-1044.774) (-1041.335) (-1065.325) [-1046.871] * (-1049.524) (-1053.369) [-1047.188] (-1053.408) -- 0:02:01
481500 -- (-1056.280) (-1047.177) [-1045.687] (-1044.698) * (-1052.602) (-1058.403) [-1044.592] (-1042.953) -- 0:02:01
482000 -- (-1048.314) (-1047.280) (-1050.708) [-1047.495] * (-1062.954) (-1050.366) (-1040.799) [-1045.752] -- 0:02:02
482500 -- [-1039.377] (-1044.783) (-1053.019) (-1042.023) * (-1051.954) [-1039.072] (-1045.624) (-1052.257) -- 0:02:02
483000 -- (-1045.264) (-1042.777) [-1048.824] (-1051.647) * [-1039.589] (-1037.996) (-1050.175) (-1053.929) -- 0:02:02
483500 -- (-1049.321) (-1039.946) [-1044.435] (-1041.830) * (-1051.421) [-1038.955] (-1044.638) (-1056.294) -- 0:02:01
484000 -- (-1042.302) (-1049.255) [-1043.028] (-1052.234) * [-1039.497] (-1041.530) (-1046.790) (-1064.570) -- 0:02:01
484500 -- (-1040.187) (-1042.692) [-1040.675] (-1062.621) * [-1036.058] (-1044.431) (-1036.938) (-1050.384) -- 0:02:01
485000 -- (-1050.336) (-1044.219) [-1033.781] (-1050.583) * [-1039.724] (-1047.980) (-1043.555) (-1047.868) -- 0:02:01
Average standard deviation of split frequencies: 0.015866
485500 -- (-1051.606) (-1054.118) [-1043.709] (-1057.454) * (-1042.414) [-1041.790] (-1039.934) (-1047.982) -- 0:02:00
486000 -- (-1051.513) (-1045.987) (-1044.960) [-1036.229] * (-1048.077) (-1044.810) (-1040.940) [-1039.575] -- 0:02:00
486500 -- [-1053.094] (-1040.379) (-1047.642) (-1044.393) * [-1042.687] (-1042.046) (-1052.016) (-1040.771) -- 0:02:01
487000 -- (-1056.853) (-1062.166) [-1047.197] (-1037.709) * [-1040.461] (-1053.752) (-1047.497) (-1049.456) -- 0:02:01
487500 -- (-1058.828) [-1041.611] (-1053.058) (-1047.421) * [-1044.734] (-1059.162) (-1050.075) (-1052.706) -- 0:02:00
488000 -- (-1046.084) (-1042.970) [-1045.483] (-1049.505) * (-1047.425) (-1058.475) [-1039.377] (-1045.568) -- 0:02:00
488500 -- (-1054.836) (-1047.109) [-1037.957] (-1047.940) * (-1045.239) [-1043.618] (-1054.539) (-1046.458) -- 0:02:00
489000 -- (-1039.253) (-1054.499) [-1052.026] (-1055.779) * (-1046.975) (-1055.618) (-1046.344) [-1044.429] -- 0:02:00
489500 -- (-1044.313) (-1051.567) [-1042.852] (-1044.820) * (-1051.148) (-1057.144) (-1042.890) [-1033.477] -- 0:01:59
490000 -- (-1056.485) (-1055.910) (-1046.677) [-1052.497] * (-1055.351) (-1055.578) [-1040.743] (-1052.534) -- 0:01:59
Average standard deviation of split frequencies: 0.014823
490500 -- [-1033.033] (-1038.947) (-1050.374) (-1044.088) * [-1047.769] (-1059.194) (-1039.457) (-1045.116) -- 0:02:00
491000 -- [-1038.787] (-1042.639) (-1051.045) (-1044.953) * (-1037.704) (-1055.545) [-1038.542] (-1063.709) -- 0:02:00
491500 -- [-1038.585] (-1043.986) (-1056.383) (-1041.955) * (-1051.589) (-1043.657) (-1054.910) [-1041.125] -- 0:02:00
492000 -- (-1035.009) (-1042.715) (-1063.838) [-1044.319] * (-1045.770) (-1046.813) (-1050.426) [-1052.116] -- 0:01:59
492500 -- (-1038.692) (-1046.864) [-1047.001] (-1038.070) * (-1043.984) (-1048.334) [-1040.140] (-1048.800) -- 0:01:59
493000 -- (-1038.299) (-1050.248) [-1042.951] (-1044.013) * (-1063.797) (-1060.706) (-1046.942) [-1040.477] -- 0:01:59
493500 -- (-1045.033) (-1054.127) [-1041.888] (-1072.248) * [-1051.157] (-1048.670) (-1047.670) (-1039.941) -- 0:01:59
494000 -- (-1036.390) [-1046.287] (-1059.030) (-1050.235) * (-1045.327) [-1052.049] (-1051.639) (-1047.733) -- 0:01:58
494500 -- [-1046.645] (-1058.911) (-1052.214) (-1046.941) * (-1050.063) [-1043.171] (-1052.777) (-1042.055) -- 0:01:59
495000 -- [-1041.001] (-1049.510) (-1044.685) (-1055.673) * (-1052.260) [-1036.179] (-1041.404) (-1045.601) -- 0:01:59
Average standard deviation of split frequencies: 0.015274
495500 -- (-1047.371) (-1045.706) (-1045.222) [-1036.810] * (-1061.129) (-1043.263) (-1048.944) [-1036.248] -- 0:01:59
496000 -- (-1038.861) (-1059.804) (-1039.546) [-1050.038] * (-1063.588) (-1058.932) (-1043.775) [-1051.610] -- 0:01:58
496500 -- (-1047.292) [-1048.707] (-1035.889) (-1053.525) * (-1054.104) [-1046.776] (-1060.292) (-1047.543) -- 0:01:58
497000 -- (-1047.832) (-1057.960) (-1037.822) [-1051.687] * (-1046.890) (-1035.985) (-1056.370) [-1044.916] -- 0:01:58
497500 -- (-1044.021) [-1044.281] (-1054.801) (-1058.538) * (-1040.845) [-1049.966] (-1041.089) (-1050.682) -- 0:01:58
498000 -- (-1049.767) [-1041.628] (-1043.337) (-1049.185) * (-1048.740) (-1049.583) (-1052.434) [-1041.949] -- 0:01:57
498500 -- (-1052.024) [-1039.988] (-1048.383) (-1045.836) * (-1048.145) [-1036.641] (-1046.916) (-1041.716) -- 0:01:57
499000 -- (-1057.921) [-1046.405] (-1063.266) (-1052.355) * (-1046.815) (-1048.478) [-1050.838] (-1046.160) -- 0:01:58
499500 -- [-1035.623] (-1051.532) (-1047.367) (-1062.193) * (-1058.069) (-1043.595) (-1044.717) [-1033.674] -- 0:01:58
500000 -- (-1039.688) (-1050.790) (-1054.123) [-1046.665] * (-1051.957) [-1056.715] (-1046.005) (-1054.010) -- 0:01:58
Average standard deviation of split frequencies: 0.014325
500500 -- (-1059.813) [-1042.530] (-1052.698) (-1038.710) * [-1053.940] (-1044.000) (-1044.154) (-1040.900) -- 0:01:57
501000 -- [-1038.003] (-1048.637) (-1048.450) (-1061.081) * (-1049.448) (-1049.995) (-1066.009) [-1034.259] -- 0:01:57
501500 -- (-1067.916) (-1042.385) (-1042.956) [-1039.893] * [-1046.758] (-1056.324) (-1049.922) (-1060.592) -- 0:01:57
502000 -- (-1060.610) (-1050.526) [-1046.703] (-1044.009) * (-1044.412) (-1046.088) [-1047.796] (-1037.992) -- 0:01:57
502500 -- (-1045.316) (-1047.687) [-1036.866] (-1047.829) * [-1036.458] (-1043.978) (-1055.978) (-1045.095) -- 0:01:56
503000 -- (-1051.669) [-1045.219] (-1045.300) (-1051.121) * (-1039.677) (-1063.124) [-1045.042] (-1042.981) -- 0:01:57
503500 -- (-1051.269) [-1053.958] (-1047.596) (-1054.354) * [-1044.955] (-1043.232) (-1049.417) (-1049.860) -- 0:01:57
504000 -- (-1063.286) [-1040.717] (-1043.310) (-1048.251) * (-1047.225) (-1055.223) (-1055.829) [-1041.311] -- 0:01:57
504500 -- [-1049.609] (-1044.617) (-1057.377) (-1048.702) * (-1058.850) (-1047.124) [-1046.028] (-1045.165) -- 0:01:56
505000 -- (-1048.924) [-1048.292] (-1046.813) (-1055.939) * (-1052.382) (-1056.003) (-1054.963) [-1043.997] -- 0:01:56
Average standard deviation of split frequencies: 0.013908
505500 -- (-1057.163) [-1038.320] (-1058.119) (-1059.568) * (-1044.765) (-1055.655) (-1041.294) [-1033.512] -- 0:01:56
506000 -- (-1049.521) [-1039.841] (-1044.866) (-1060.657) * (-1044.214) (-1048.203) [-1037.600] (-1038.615) -- 0:01:56
506500 -- (-1046.659) (-1042.028) [-1041.813] (-1051.021) * [-1042.337] (-1055.675) (-1045.241) (-1049.096) -- 0:01:55
507000 -- (-1048.181) (-1046.864) (-1074.478) [-1042.083] * (-1043.018) (-1053.352) [-1037.030] (-1040.724) -- 0:01:55
507500 -- [-1046.213] (-1048.108) (-1046.435) (-1040.073) * (-1043.354) (-1049.032) [-1045.924] (-1039.169) -- 0:01:56
508000 -- (-1048.096) (-1054.027) (-1044.084) [-1043.665] * (-1045.840) (-1050.199) [-1052.133] (-1041.208) -- 0:01:56
508500 -- [-1047.760] (-1043.358) (-1046.860) (-1056.667) * (-1053.964) [-1045.885] (-1038.336) (-1062.664) -- 0:01:55
509000 -- (-1054.585) (-1062.660) (-1044.825) [-1043.754] * (-1048.026) (-1060.293) [-1040.430] (-1039.765) -- 0:01:55
509500 -- [-1044.250] (-1051.171) (-1057.093) (-1050.752) * (-1061.127) (-1057.394) [-1050.907] (-1050.613) -- 0:01:55
510000 -- [-1038.975] (-1068.961) (-1051.300) (-1044.935) * (-1047.875) (-1041.139) (-1048.018) [-1037.669] -- 0:01:55
Average standard deviation of split frequencies: 0.013913
510500 -- (-1057.826) [-1042.963] (-1042.545) (-1047.977) * (-1047.424) (-1056.748) [-1039.696] (-1045.346) -- 0:01:55
511000 -- (-1067.593) (-1046.017) [-1045.562] (-1038.135) * [-1041.787] (-1037.080) (-1045.792) (-1055.366) -- 0:01:54
511500 -- (-1055.298) [-1041.666] (-1040.445) (-1041.025) * (-1035.902) (-1048.968) [-1035.810] (-1052.968) -- 0:01:55
512000 -- (-1039.994) [-1036.428] (-1052.410) (-1039.210) * [-1049.306] (-1047.457) (-1039.228) (-1040.661) -- 0:01:55
512500 -- [-1040.123] (-1046.571) (-1046.804) (-1049.915) * (-1037.444) (-1046.071) [-1042.590] (-1045.319) -- 0:01:55
513000 -- [-1032.967] (-1059.724) (-1044.511) (-1056.577) * (-1052.462) (-1048.321) (-1039.798) [-1048.014] -- 0:01:54
513500 -- (-1043.622) [-1039.848] (-1039.009) (-1062.676) * (-1050.272) (-1059.223) (-1038.696) [-1039.398] -- 0:01:54
514000 -- (-1043.145) (-1050.432) [-1037.671] (-1052.877) * (-1041.977) (-1050.149) (-1042.336) [-1039.231] -- 0:01:54
514500 -- (-1056.630) (-1041.936) [-1044.118] (-1056.991) * (-1053.093) (-1042.421) [-1046.119] (-1053.310) -- 0:01:54
515000 -- (-1057.343) (-1042.960) [-1047.905] (-1058.400) * (-1056.554) (-1041.209) [-1048.865] (-1049.059) -- 0:01:53
Average standard deviation of split frequencies: 0.014291
515500 -- [-1041.623] (-1057.199) (-1047.656) (-1042.448) * (-1045.083) (-1054.113) (-1057.539) [-1045.366] -- 0:01:53
516000 -- [-1044.053] (-1052.458) (-1051.236) (-1052.425) * (-1044.752) [-1039.163] (-1061.289) (-1039.734) -- 0:01:54
516500 -- (-1050.505) (-1053.093) (-1052.494) [-1052.063] * (-1050.698) (-1053.896) (-1057.792) [-1038.824] -- 0:01:54
517000 -- (-1041.111) [-1041.135] (-1055.009) (-1052.981) * (-1048.529) (-1054.794) (-1043.192) [-1042.707] -- 0:01:53
517500 -- (-1040.290) (-1049.423) (-1061.056) [-1042.267] * (-1050.239) (-1051.170) (-1048.419) [-1042.772] -- 0:01:53
518000 -- (-1057.792) [-1041.920] (-1059.124) (-1045.317) * (-1044.677) (-1047.477) (-1062.026) [-1050.108] -- 0:01:53
518500 -- [-1040.913] (-1051.283) (-1046.947) (-1034.023) * (-1049.093) [-1048.933] (-1051.524) (-1044.885) -- 0:01:53
519000 -- (-1043.591) [-1041.477] (-1047.401) (-1059.477) * (-1052.640) [-1056.267] (-1033.406) (-1054.148) -- 0:01:53
519500 -- [-1037.877] (-1040.575) (-1040.562) (-1054.874) * (-1045.135) (-1043.985) [-1049.156] (-1045.981) -- 0:01:52
520000 -- (-1047.815) [-1035.069] (-1042.714) (-1055.800) * (-1051.276) (-1040.371) (-1045.803) [-1042.832] -- 0:01:53
Average standard deviation of split frequencies: 0.013516
520500 -- (-1041.002) [-1038.166] (-1039.096) (-1053.589) * [-1036.382] (-1052.807) (-1046.053) (-1049.759) -- 0:01:53
521000 -- [-1045.290] (-1055.070) (-1046.538) (-1047.144) * (-1047.286) (-1052.191) [-1038.419] (-1051.812) -- 0:01:53
521500 -- (-1051.968) (-1042.372) (-1041.781) [-1039.676] * (-1046.066) [-1055.433] (-1039.209) (-1049.826) -- 0:01:52
522000 -- (-1038.186) [-1042.975] (-1051.987) (-1048.088) * (-1058.331) (-1041.567) [-1035.531] (-1058.539) -- 0:01:52
522500 -- (-1063.004) [-1037.059] (-1040.313) (-1045.833) * [-1045.421] (-1046.217) (-1053.469) (-1059.959) -- 0:01:52
523000 -- [-1046.017] (-1032.385) (-1049.675) (-1042.897) * [-1039.799] (-1062.526) (-1057.095) (-1060.749) -- 0:01:52
523500 -- (-1041.522) [-1038.058] (-1042.655) (-1055.757) * (-1046.124) (-1056.087) [-1042.816] (-1048.742) -- 0:01:51
524000 -- (-1054.898) (-1040.335) (-1046.963) [-1042.907] * (-1053.546) [-1055.633] (-1054.230) (-1040.132) -- 0:01:51
524500 -- (-1047.324) (-1040.826) [-1039.984] (-1050.382) * (-1041.694) [-1044.142] (-1045.686) (-1049.059) -- 0:01:52
525000 -- (-1046.998) (-1053.131) [-1047.036] (-1034.791) * (-1055.285) [-1048.382] (-1040.792) (-1056.435) -- 0:01:52
Average standard deviation of split frequencies: 0.013379
525500 -- (-1053.534) (-1041.213) (-1049.997) [-1045.735] * (-1048.982) [-1035.377] (-1044.660) (-1043.438) -- 0:01:51
526000 -- (-1049.293) [-1043.187] (-1044.113) (-1048.341) * (-1050.594) (-1047.008) [-1044.448] (-1046.916) -- 0:01:51
526500 -- (-1040.823) [-1036.434] (-1051.508) (-1046.622) * (-1065.126) (-1053.635) [-1039.696] (-1069.554) -- 0:01:51
527000 -- [-1044.310] (-1036.276) (-1051.359) (-1044.554) * (-1053.881) (-1052.268) [-1035.283] (-1047.590) -- 0:01:51
527500 -- [-1044.341] (-1046.169) (-1048.489) (-1056.607) * (-1058.661) [-1044.431] (-1039.131) (-1039.797) -- 0:01:51
528000 -- (-1041.119) (-1060.053) (-1045.310) [-1052.052] * (-1049.858) (-1051.640) [-1046.492] (-1038.808) -- 0:01:50
528500 -- [-1033.036] (-1057.651) (-1050.807) (-1062.429) * (-1068.617) (-1042.266) (-1061.408) [-1046.555] -- 0:01:51
529000 -- (-1054.891) [-1048.664] (-1041.109) (-1059.850) * (-1056.417) (-1047.615) (-1047.182) [-1044.477] -- 0:01:51
529500 -- [-1042.728] (-1046.743) (-1050.279) (-1047.863) * (-1046.897) (-1063.473) (-1050.578) [-1042.465] -- 0:01:51
530000 -- (-1048.633) (-1036.362) (-1049.504) [-1032.926] * (-1063.460) [-1042.707] (-1047.459) (-1046.321) -- 0:01:50
Average standard deviation of split frequencies: 0.012881
530500 -- [-1045.614] (-1046.214) (-1045.806) (-1052.982) * [-1041.407] (-1056.784) (-1054.053) (-1053.029) -- 0:01:50
531000 -- (-1043.353) [-1047.115] (-1043.761) (-1046.274) * (-1044.868) (-1048.922) (-1056.177) [-1040.293] -- 0:01:50
531500 -- (-1053.204) (-1044.015) [-1042.444] (-1050.866) * (-1046.905) [-1046.769] (-1054.042) (-1046.126) -- 0:01:50
532000 -- (-1053.018) (-1046.169) [-1047.571] (-1042.710) * (-1058.585) (-1051.828) (-1054.581) [-1041.591] -- 0:01:49
532500 -- (-1048.791) (-1045.878) [-1045.280] (-1040.604) * (-1048.607) (-1049.578) (-1049.731) [-1037.776] -- 0:01:49
533000 -- [-1042.654] (-1031.276) (-1057.311) (-1048.006) * (-1055.737) (-1053.839) [-1050.117] (-1049.114) -- 0:01:50
533500 -- [-1043.902] (-1058.921) (-1050.418) (-1053.082) * (-1039.354) (-1057.827) (-1059.322) [-1035.613] -- 0:01:50
534000 -- (-1051.262) (-1059.991) (-1037.624) [-1039.271] * (-1046.148) (-1065.305) [-1040.870] (-1045.889) -- 0:01:49
534500 -- (-1050.520) (-1041.296) (-1044.197) [-1055.397] * (-1042.595) [-1038.067] (-1041.864) (-1040.585) -- 0:01:49
535000 -- (-1048.523) (-1044.232) (-1053.001) [-1044.837] * (-1052.447) [-1045.791] (-1056.537) (-1042.273) -- 0:01:49
Average standard deviation of split frequencies: 0.012501
535500 -- (-1053.166) [-1045.325] (-1056.766) (-1050.596) * [-1043.825] (-1044.112) (-1047.217) (-1049.960) -- 0:01:49
536000 -- (-1053.226) [-1038.439] (-1054.684) (-1044.481) * [-1051.210] (-1033.190) (-1047.959) (-1054.019) -- 0:01:49
536500 -- (-1060.505) (-1052.393) [-1052.544] (-1048.291) * (-1050.611) (-1049.599) [-1048.353] (-1040.147) -- 0:01:48
537000 -- [-1046.184] (-1060.811) (-1055.489) (-1056.733) * (-1054.169) (-1040.209) [-1046.194] (-1047.652) -- 0:01:49
537500 -- (-1039.485) (-1063.524) [-1043.774] (-1048.640) * (-1046.129) (-1052.908) (-1052.726) [-1042.937] -- 0:01:49
538000 -- (-1044.366) (-1045.294) [-1050.108] (-1048.541) * [-1045.128] (-1038.268) (-1054.845) (-1040.381) -- 0:01:49
538500 -- [-1041.331] (-1048.475) (-1044.632) (-1044.940) * (-1042.483) [-1041.934] (-1052.003) (-1049.495) -- 0:01:48
539000 -- [-1043.184] (-1051.313) (-1045.198) (-1041.497) * (-1049.578) [-1042.012] (-1057.265) (-1044.471) -- 0:01:48
539500 -- [-1047.722] (-1045.491) (-1055.328) (-1045.767) * [-1038.775] (-1035.831) (-1059.702) (-1050.146) -- 0:01:48
540000 -- (-1048.332) (-1038.806) (-1050.534) [-1044.954] * (-1045.077) [-1046.505] (-1057.649) (-1039.769) -- 0:01:48
Average standard deviation of split frequencies: 0.011957
540500 -- (-1038.568) (-1049.362) [-1045.916] (-1055.090) * (-1045.808) (-1048.855) (-1051.628) [-1042.405] -- 0:01:47
541000 -- [-1035.761] (-1050.781) (-1044.527) (-1057.300) * (-1047.981) [-1047.931] (-1058.669) (-1058.549) -- 0:01:48
541500 -- (-1049.896) [-1042.511] (-1046.275) (-1049.036) * [-1044.828] (-1045.638) (-1054.644) (-1054.466) -- 0:01:48
542000 -- [-1047.291] (-1053.544) (-1049.230) (-1055.403) * (-1060.798) [-1035.879] (-1041.184) (-1048.905) -- 0:01:48
542500 -- (-1052.382) (-1057.683) [-1039.219] (-1052.701) * [-1046.344] (-1052.519) (-1046.303) (-1044.334) -- 0:01:47
543000 -- [-1045.231] (-1054.209) (-1047.267) (-1058.135) * (-1042.403) [-1036.409] (-1047.784) (-1045.924) -- 0:01:47
543500 -- (-1044.200) (-1057.737) [-1048.759] (-1060.280) * (-1055.194) (-1041.890) [-1048.101] (-1041.879) -- 0:01:47
544000 -- (-1043.240) [-1046.361] (-1043.924) (-1058.849) * (-1044.157) (-1040.661) (-1052.269) [-1047.715] -- 0:01:47
544500 -- (-1047.608) (-1051.270) [-1040.295] (-1060.500) * (-1055.474) (-1039.851) (-1049.947) [-1041.340] -- 0:01:47
545000 -- (-1048.775) (-1061.227) [-1040.580] (-1044.252) * (-1050.311) (-1053.694) (-1041.747) [-1045.056] -- 0:01:46
Average standard deviation of split frequencies: 0.012149
545500 -- (-1047.917) (-1053.282) [-1050.704] (-1048.192) * (-1045.441) [-1044.900] (-1044.130) (-1057.010) -- 0:01:47
546000 -- (-1040.660) (-1051.857) (-1062.008) [-1050.407] * [-1045.215] (-1048.008) (-1045.153) (-1047.343) -- 0:01:47
546500 -- (-1046.774) (-1047.153) (-1061.718) [-1047.150] * (-1035.977) (-1055.476) (-1052.342) [-1045.967] -- 0:01:47
547000 -- [-1032.731] (-1054.614) (-1047.309) (-1046.127) * [-1050.081] (-1043.222) (-1054.526) (-1042.865) -- 0:01:46
547500 -- [-1039.788] (-1041.426) (-1045.676) (-1044.744) * [-1042.853] (-1050.179) (-1054.090) (-1041.375) -- 0:01:46
548000 -- [-1038.875] (-1046.839) (-1047.307) (-1049.396) * [-1039.858] (-1053.663) (-1052.712) (-1051.550) -- 0:01:46
548500 -- [-1050.967] (-1035.211) (-1038.990) (-1053.635) * (-1046.345) (-1050.761) [-1044.322] (-1042.250) -- 0:01:46
549000 -- [-1056.946] (-1053.328) (-1039.819) (-1055.950) * (-1057.289) (-1052.503) [-1041.234] (-1052.780) -- 0:01:45
549500 -- (-1041.820) (-1047.124) [-1048.554] (-1056.322) * (-1051.930) (-1062.513) (-1050.107) [-1040.591] -- 0:01:46
550000 -- (-1048.514) [-1048.748] (-1063.440) (-1050.881) * (-1049.466) [-1051.112] (-1043.787) (-1043.787) -- 0:01:46
Average standard deviation of split frequencies: 0.012107
550500 -- (-1050.394) (-1050.712) [-1048.276] (-1044.158) * (-1050.407) [-1048.030] (-1042.212) (-1051.191) -- 0:01:46
551000 -- (-1047.565) (-1048.046) [-1040.292] (-1046.385) * [-1039.248] (-1048.879) (-1057.228) (-1048.004) -- 0:01:45
551500 -- [-1045.107] (-1052.024) (-1047.647) (-1041.429) * (-1045.192) (-1042.787) (-1048.867) [-1041.589] -- 0:01:45
552000 -- (-1050.474) (-1053.141) (-1050.951) [-1038.813] * [-1046.370] (-1046.948) (-1048.304) (-1053.188) -- 0:01:45
552500 -- (-1043.253) (-1039.063) (-1053.024) [-1047.245] * [-1038.014] (-1043.569) (-1047.083) (-1045.816) -- 0:01:45
553000 -- [-1037.653] (-1044.065) (-1042.190) (-1053.726) * [-1046.001] (-1052.653) (-1042.029) (-1053.306) -- 0:01:45
553500 -- [-1038.709] (-1045.247) (-1042.518) (-1056.862) * (-1047.669) (-1040.980) [-1056.135] (-1043.614) -- 0:01:44
554000 -- (-1043.100) [-1046.890] (-1047.634) (-1051.849) * [-1051.324] (-1046.982) (-1058.488) (-1053.567) -- 0:01:45
554500 -- (-1049.840) (-1048.221) [-1045.849] (-1053.040) * (-1061.348) (-1057.281) [-1045.523] (-1043.679) -- 0:01:45
555000 -- (-1057.793) (-1052.537) [-1047.904] (-1041.362) * [-1040.599] (-1054.252) (-1045.141) (-1041.120) -- 0:01:45
Average standard deviation of split frequencies: 0.011749
555500 -- (-1039.396) [-1043.527] (-1047.687) (-1044.332) * (-1055.885) (-1056.241) (-1061.333) [-1048.445] -- 0:01:44
556000 -- (-1048.180) (-1047.246) [-1043.399] (-1036.959) * (-1044.897) (-1053.261) [-1042.312] (-1053.190) -- 0:01:44
556500 -- (-1044.855) [-1047.114] (-1052.143) (-1042.015) * (-1059.339) (-1055.781) [-1043.698] (-1042.705) -- 0:01:44
557000 -- (-1044.255) [-1045.000] (-1037.563) (-1039.413) * (-1044.253) (-1056.665) (-1046.509) [-1034.022] -- 0:01:44
557500 -- (-1046.657) (-1061.455) [-1040.576] (-1057.787) * (-1047.960) (-1065.179) [-1041.529] (-1041.559) -- 0:01:43
558000 -- (-1045.869) (-1038.020) (-1055.347) [-1047.562] * (-1043.320) (-1055.627) (-1047.047) [-1043.160] -- 0:01:44
558500 -- (-1048.114) (-1040.868) (-1048.853) [-1035.849] * [-1043.896] (-1066.804) (-1044.978) (-1044.215) -- 0:01:44
559000 -- (-1046.312) (-1053.794) (-1051.869) [-1042.603] * (-1057.989) [-1055.587] (-1058.937) (-1047.132) -- 0:01:44
559500 -- (-1051.019) [-1049.781] (-1046.723) (-1042.468) * [-1053.972] (-1060.602) (-1054.772) (-1044.387) -- 0:01:43
560000 -- [-1040.129] (-1055.979) (-1043.736) (-1037.781) * (-1039.287) [-1048.566] (-1049.241) (-1047.491) -- 0:01:43
Average standard deviation of split frequencies: 0.010930
560500 -- (-1037.975) (-1056.547) [-1046.005] (-1051.827) * [-1042.883] (-1060.436) (-1048.275) (-1048.659) -- 0:01:43
561000 -- (-1056.536) [-1040.129] (-1051.403) (-1050.236) * (-1052.155) (-1054.808) [-1044.649] (-1069.782) -- 0:01:43
561500 -- (-1062.839) (-1044.570) (-1049.914) [-1047.132] * (-1041.402) (-1064.401) (-1041.121) [-1043.287] -- 0:01:43
562000 -- (-1049.680) [-1043.290] (-1047.948) (-1063.111) * (-1049.628) [-1045.148] (-1040.672) (-1050.270) -- 0:01:42
562500 -- [-1040.721] (-1050.537) (-1049.108) (-1041.980) * (-1056.313) [-1043.450] (-1052.516) (-1047.136) -- 0:01:43
563000 -- (-1038.915) [-1053.978] (-1051.754) (-1051.913) * [-1056.922] (-1040.207) (-1047.257) (-1052.603) -- 0:01:43
563500 -- (-1035.092) (-1046.124) [-1041.762] (-1059.558) * (-1056.361) (-1048.279) [-1043.306] (-1041.874) -- 0:01:43
564000 -- (-1035.312) (-1060.773) (-1047.303) [-1044.680] * (-1045.701) [-1056.887] (-1049.241) (-1046.635) -- 0:01:42
564500 -- (-1039.255) (-1059.557) (-1047.136) [-1042.124] * (-1044.736) (-1060.909) [-1047.956] (-1047.401) -- 0:01:42
565000 -- (-1037.227) (-1044.801) (-1068.371) [-1036.321] * [-1039.944] (-1057.584) (-1043.094) (-1048.495) -- 0:01:42
Average standard deviation of split frequencies: 0.011065
565500 -- (-1051.377) (-1058.677) (-1050.489) [-1035.004] * [-1048.569] (-1063.712) (-1055.364) (-1037.460) -- 0:01:42
566000 -- (-1051.908) (-1057.567) (-1042.359) [-1048.161] * (-1042.293) [-1046.984] (-1052.684) (-1051.530) -- 0:01:41
566500 -- (-1040.754) (-1055.245) (-1052.024) [-1042.626] * (-1038.377) (-1068.915) (-1046.765) [-1043.597] -- 0:01:42
567000 -- (-1053.393) (-1055.418) [-1038.707] (-1052.090) * (-1042.533) (-1058.905) (-1046.424) [-1043.538] -- 0:01:42
567500 -- [-1052.137] (-1061.258) (-1046.932) (-1046.837) * (-1048.573) (-1074.019) (-1040.203) [-1041.240] -- 0:01:42
568000 -- (-1057.913) (-1055.441) [-1042.647] (-1057.848) * (-1054.668) [-1050.784] (-1044.782) (-1041.319) -- 0:01:41
568500 -- [-1039.387] (-1052.964) (-1035.943) (-1046.510) * (-1044.755) (-1056.539) (-1058.398) [-1043.409] -- 0:01:41
569000 -- (-1048.298) (-1051.084) [-1048.171] (-1044.534) * (-1068.403) [-1061.765] (-1051.797) (-1061.011) -- 0:01:41
569500 -- (-1052.990) [-1046.083] (-1039.727) (-1054.132) * (-1047.961) (-1057.483) [-1039.919] (-1042.425) -- 0:01:41
570000 -- [-1041.440] (-1054.082) (-1052.072) (-1043.925) * (-1061.773) (-1055.011) (-1049.669) [-1045.769] -- 0:01:41
Average standard deviation of split frequencies: 0.010975
570500 -- (-1046.249) (-1054.189) [-1038.935] (-1064.989) * [-1051.715] (-1061.054) (-1052.850) (-1041.030) -- 0:01:40
571000 -- [-1043.985] (-1052.193) (-1040.323) (-1059.650) * (-1061.419) (-1050.406) [-1045.549] (-1047.128) -- 0:01:41
571500 -- (-1056.529) [-1040.279] (-1038.182) (-1060.799) * (-1054.189) (-1056.670) [-1040.984] (-1047.188) -- 0:01:41
572000 -- (-1044.603) (-1042.208) [-1037.421] (-1050.370) * (-1052.376) (-1047.109) (-1047.075) [-1050.170] -- 0:01:41
572500 -- (-1060.383) [-1040.622] (-1045.169) (-1054.397) * (-1063.404) [-1059.840] (-1046.528) (-1064.635) -- 0:01:40
573000 -- (-1050.458) (-1043.592) [-1040.646] (-1043.972) * (-1048.185) (-1048.907) (-1041.283) [-1041.703] -- 0:01:40
573500 -- [-1039.562] (-1056.932) (-1049.565) (-1044.958) * (-1049.194) (-1044.663) (-1037.787) [-1043.942] -- 0:01:40
574000 -- (-1043.493) (-1048.691) (-1050.713) [-1042.442] * (-1044.078) [-1037.954] (-1038.656) (-1041.369) -- 0:01:40
574500 -- (-1047.956) [-1046.075] (-1052.993) (-1045.118) * (-1059.214) [-1050.812] (-1052.151) (-1041.831) -- 0:01:39
575000 -- [-1041.542] (-1039.787) (-1051.603) (-1057.699) * (-1066.517) (-1042.102) [-1038.466] (-1046.795) -- 0:01:40
Average standard deviation of split frequencies: 0.011516
575500 -- [-1035.776] (-1038.521) (-1049.400) (-1059.091) * (-1045.915) (-1049.356) (-1054.449) [-1047.670] -- 0:01:40
576000 -- (-1041.843) (-1037.448) (-1043.982) [-1045.263] * (-1057.337) [-1042.078] (-1056.239) (-1039.359) -- 0:01:40
576500 -- (-1044.450) (-1046.323) (-1048.168) [-1032.340] * (-1049.441) [-1044.512] (-1044.578) (-1067.392) -- 0:01:39
577000 -- [-1048.193] (-1047.468) (-1048.651) (-1043.300) * (-1050.700) [-1057.169] (-1034.793) (-1051.351) -- 0:01:39
577500 -- [-1045.132] (-1039.221) (-1054.351) (-1052.780) * (-1050.857) (-1043.900) (-1050.367) [-1046.232] -- 0:01:39
578000 -- (-1042.107) [-1038.354] (-1057.837) (-1044.333) * (-1049.780) [-1037.357] (-1050.391) (-1044.140) -- 0:01:39
578500 -- (-1062.869) [-1039.830] (-1052.546) (-1043.124) * (-1045.822) [-1030.095] (-1060.780) (-1047.939) -- 0:01:39
579000 -- (-1049.775) (-1045.483) (-1052.835) [-1039.080] * [-1043.574] (-1037.406) (-1042.154) (-1051.691) -- 0:01:38
579500 -- (-1055.662) [-1040.998] (-1044.334) (-1048.416) * (-1047.023) (-1045.595) [-1046.226] (-1066.659) -- 0:01:39
580000 -- (-1052.157) (-1039.120) (-1049.896) [-1040.978] * (-1043.866) (-1050.412) [-1046.083] (-1038.822) -- 0:01:39
Average standard deviation of split frequencies: 0.011714
580500 -- (-1056.982) [-1045.931] (-1049.153) (-1052.638) * [-1048.603] (-1045.038) (-1048.592) (-1052.231) -- 0:01:39
581000 -- [-1045.314] (-1045.988) (-1041.145) (-1053.945) * [-1052.034] (-1054.279) (-1056.184) (-1036.631) -- 0:01:38
581500 -- (-1055.907) (-1045.568) [-1045.242] (-1045.495) * (-1045.597) (-1047.152) [-1038.788] (-1042.813) -- 0:01:38
582000 -- [-1039.902] (-1052.432) (-1048.054) (-1045.289) * (-1050.806) (-1051.926) [-1043.067] (-1047.336) -- 0:01:38
582500 -- (-1048.172) (-1045.146) (-1043.361) [-1043.388] * (-1050.833) [-1037.445] (-1046.802) (-1050.719) -- 0:01:38
583000 -- (-1042.586) (-1045.768) [-1042.017] (-1049.139) * (-1053.535) (-1064.569) [-1035.984] (-1054.959) -- 0:01:37
583500 -- (-1050.175) [-1036.506] (-1043.492) (-1049.624) * (-1042.094) [-1042.601] (-1059.180) (-1058.452) -- 0:01:38
584000 -- (-1048.586) (-1048.767) [-1042.029] (-1045.333) * [-1045.176] (-1051.558) (-1045.299) (-1067.539) -- 0:01:38
584500 -- (-1044.401) (-1046.215) [-1038.274] (-1039.214) * (-1048.914) [-1038.638] (-1056.053) (-1059.568) -- 0:01:38
585000 -- (-1051.451) [-1036.880] (-1057.150) (-1043.433) * (-1051.877) (-1056.988) [-1045.275] (-1052.752) -- 0:01:37
Average standard deviation of split frequencies: 0.011377
585500 -- (-1051.758) [-1049.213] (-1043.591) (-1051.599) * [-1049.990] (-1048.160) (-1049.833) (-1058.012) -- 0:01:37
586000 -- (-1056.962) (-1046.961) (-1042.888) [-1044.790] * (-1043.758) (-1049.932) [-1034.059] (-1054.230) -- 0:01:37
586500 -- (-1060.036) (-1042.040) (-1057.295) [-1050.141] * [-1038.727] (-1045.587) (-1041.796) (-1056.884) -- 0:01:37
587000 -- [-1048.305] (-1054.082) (-1047.696) (-1044.115) * (-1056.270) [-1043.264] (-1047.391) (-1052.968) -- 0:01:37
587500 -- [-1034.576] (-1045.797) (-1063.980) (-1050.233) * (-1052.058) [-1035.834] (-1050.290) (-1055.823) -- 0:01:36
588000 -- (-1054.481) (-1049.024) (-1048.420) [-1044.063] * (-1056.930) (-1054.150) [-1042.601] (-1057.191) -- 0:01:37
588500 -- (-1040.437) [-1044.666] (-1060.218) (-1054.547) * (-1051.491) (-1060.654) [-1042.043] (-1067.084) -- 0:01:37
589000 -- (-1045.596) (-1046.641) (-1053.760) [-1048.120] * (-1054.090) (-1045.884) [-1053.645] (-1058.053) -- 0:01:36
589500 -- (-1042.828) (-1063.503) [-1045.157] (-1048.049) * (-1049.028) [-1050.066] (-1052.709) (-1060.128) -- 0:01:36
590000 -- [-1035.195] (-1049.746) (-1049.563) (-1046.442) * [-1047.162] (-1039.829) (-1051.311) (-1044.936) -- 0:01:36
Average standard deviation of split frequencies: 0.010261
590500 -- (-1039.037) [-1048.583] (-1048.140) (-1044.824) * [-1040.441] (-1055.606) (-1049.908) (-1042.972) -- 0:01:36
591000 -- (-1053.015) (-1043.078) (-1040.654) [-1037.270] * (-1039.123) (-1046.554) [-1047.908] (-1047.569) -- 0:01:36
591500 -- (-1068.347) (-1055.606) (-1050.253) [-1043.841] * (-1047.527) (-1047.106) [-1047.026] (-1058.584) -- 0:01:35
592000 -- (-1047.607) (-1051.529) [-1046.154] (-1047.620) * (-1059.077) (-1044.373) [-1046.638] (-1061.520) -- 0:01:36
592500 -- (-1045.924) (-1048.684) (-1039.663) [-1047.672] * [-1042.555] (-1049.221) (-1052.746) (-1044.497) -- 0:01:36
593000 -- [-1044.507] (-1041.513) (-1057.933) (-1049.031) * (-1052.805) (-1057.279) [-1047.983] (-1052.276) -- 0:01:36
593500 -- [-1050.383] (-1054.198) (-1047.042) (-1054.617) * (-1049.464) [-1049.594] (-1056.538) (-1043.853) -- 0:01:35
594000 -- (-1047.788) (-1054.383) [-1045.293] (-1035.790) * (-1061.605) (-1046.462) (-1053.506) [-1034.599] -- 0:01:35
594500 -- [-1055.840] (-1062.924) (-1048.857) (-1055.755) * (-1056.913) (-1040.867) (-1072.161) [-1046.147] -- 0:01:35
595000 -- (-1045.293) [-1043.831] (-1054.521) (-1040.875) * (-1046.947) (-1047.661) (-1061.858) [-1040.350] -- 0:01:35
Average standard deviation of split frequencies: 0.010847
595500 -- (-1045.882) (-1047.523) (-1040.656) [-1036.465] * (-1050.066) [-1038.624] (-1076.464) (-1049.538) -- 0:01:35
596000 -- (-1049.019) (-1044.347) [-1054.004] (-1040.091) * (-1042.195) (-1046.013) (-1052.900) [-1048.781] -- 0:01:35
596500 -- (-1045.659) (-1048.425) [-1047.880] (-1037.625) * [-1044.613] (-1048.319) (-1045.192) (-1047.644) -- 0:01:35
597000 -- (-1040.868) (-1055.949) (-1068.041) [-1036.769] * [-1036.315] (-1033.808) (-1060.693) (-1041.491) -- 0:01:35
597500 -- [-1034.272] (-1056.495) (-1047.289) (-1049.363) * [-1044.276] (-1043.472) (-1052.440) (-1041.994) -- 0:01:34
598000 -- (-1049.635) [-1043.392] (-1048.620) (-1051.255) * [-1044.614] (-1057.833) (-1054.310) (-1043.058) -- 0:01:34
598500 -- [-1052.017] (-1042.177) (-1041.009) (-1043.013) * [-1039.416] (-1066.606) (-1045.299) (-1046.436) -- 0:01:34
599000 -- (-1054.905) (-1044.139) [-1045.777] (-1037.063) * [-1050.798] (-1053.369) (-1050.810) (-1056.740) -- 0:01:34
599500 -- (-1043.054) (-1063.584) [-1039.705] (-1053.310) * [-1037.979] (-1046.585) (-1052.808) (-1044.025) -- 0:01:34
600000 -- (-1059.469) (-1050.520) [-1039.265] (-1052.322) * [-1036.487] (-1066.643) (-1047.023) (-1053.257) -- 0:01:34
Average standard deviation of split frequencies: 0.010539
600500 -- [-1042.313] (-1044.964) (-1040.695) (-1057.046) * (-1048.701) (-1053.888) (-1046.125) [-1046.375] -- 0:01:34
601000 -- (-1045.338) [-1042.764] (-1061.834) (-1053.554) * (-1051.470) (-1044.280) (-1046.415) [-1032.519] -- 0:01:34
601500 -- [-1039.871] (-1036.166) (-1040.626) (-1055.714) * (-1039.937) (-1045.304) (-1040.048) [-1042.917] -- 0:01:34
602000 -- (-1045.313) [-1033.940] (-1048.705) (-1056.310) * (-1043.472) (-1057.309) [-1040.927] (-1049.922) -- 0:01:33
602500 -- (-1050.364) (-1039.981) [-1038.565] (-1038.758) * (-1044.112) [-1039.230] (-1040.978) (-1039.803) -- 0:01:33
603000 -- [-1047.734] (-1050.318) (-1049.387) (-1053.695) * (-1051.957) [-1039.279] (-1054.448) (-1057.260) -- 0:01:33
603500 -- (-1043.135) (-1050.074) [-1038.165] (-1053.727) * (-1045.093) (-1039.981) (-1044.345) [-1043.906] -- 0:01:33
604000 -- [-1036.466] (-1055.276) (-1044.258) (-1052.573) * (-1043.460) [-1036.575] (-1048.071) (-1045.566) -- 0:01:33
604500 -- (-1051.219) [-1046.044] (-1053.780) (-1049.142) * [-1047.342] (-1041.062) (-1044.259) (-1061.624) -- 0:01:33
605000 -- [-1053.859] (-1054.023) (-1039.334) (-1056.085) * (-1041.539) [-1038.173] (-1045.880) (-1070.800) -- 0:01:33
Average standard deviation of split frequencies: 0.010724
605500 -- (-1057.235) (-1052.658) (-1054.018) [-1039.786] * (-1046.378) [-1037.239] (-1045.555) (-1056.748) -- 0:01:33
606000 -- [-1037.878] (-1039.332) (-1045.999) (-1051.583) * (-1038.199) (-1047.688) [-1046.855] (-1041.420) -- 0:01:32
606500 -- (-1048.689) (-1050.963) (-1053.332) [-1037.246] * (-1039.833) [-1036.614] (-1044.920) (-1054.536) -- 0:01:32
607000 -- [-1037.354] (-1049.523) (-1042.604) (-1042.732) * [-1039.614] (-1042.526) (-1041.727) (-1067.126) -- 0:01:32
607500 -- (-1050.498) [-1037.550] (-1041.002) (-1036.711) * [-1044.260] (-1036.864) (-1052.653) (-1051.694) -- 0:01:32
608000 -- (-1046.702) (-1049.168) (-1038.538) [-1045.804] * (-1038.187) [-1051.709] (-1036.680) (-1059.901) -- 0:01:32
608500 -- [-1038.890] (-1046.940) (-1054.242) (-1052.944) * (-1049.425) (-1057.254) (-1057.601) [-1039.808] -- 0:01:32
609000 -- (-1040.691) (-1053.382) (-1039.627) [-1043.102] * (-1045.189) (-1047.679) (-1056.635) [-1045.080] -- 0:01:32
609500 -- (-1044.730) (-1049.482) (-1059.487) [-1041.921] * (-1056.425) [-1037.641] (-1051.439) (-1044.335) -- 0:01:32
610000 -- [-1044.957] (-1049.578) (-1055.209) (-1051.643) * (-1047.838) [-1045.204] (-1053.587) (-1040.929) -- 0:01:32
Average standard deviation of split frequencies: 0.010476
610500 -- [-1044.798] (-1037.022) (-1043.794) (-1058.010) * (-1045.750) (-1040.698) (-1047.467) [-1036.190] -- 0:01:31
611000 -- (-1043.076) [-1035.694] (-1033.870) (-1043.410) * (-1051.298) [-1047.589] (-1047.170) (-1044.571) -- 0:01:31
611500 -- (-1038.472) (-1048.916) (-1055.910) [-1040.298] * (-1055.283) (-1045.737) [-1037.824] (-1057.048) -- 0:01:31
612000 -- (-1048.558) [-1050.979] (-1052.458) (-1044.969) * (-1057.940) [-1037.175] (-1049.685) (-1057.120) -- 0:01:31
612500 -- (-1056.983) (-1046.044) (-1046.332) [-1041.705] * [-1050.315] (-1037.439) (-1052.108) (-1044.929) -- 0:01:31
613000 -- (-1050.007) (-1043.855) [-1036.170] (-1053.849) * (-1046.192) (-1042.373) [-1041.539] (-1040.427) -- 0:01:31
613500 -- (-1048.101) [-1045.088] (-1042.436) (-1053.066) * (-1048.133) (-1049.105) [-1045.457] (-1049.373) -- 0:01:31
614000 -- [-1044.255] (-1063.686) (-1046.000) (-1042.553) * (-1044.899) (-1051.486) [-1040.284] (-1046.154) -- 0:01:31
614500 -- (-1053.029) [-1037.092] (-1048.494) (-1051.485) * (-1051.116) (-1042.300) [-1047.037] (-1048.912) -- 0:01:30
615000 -- (-1050.595) [-1041.250] (-1043.322) (-1061.582) * (-1049.717) (-1048.217) [-1038.075] (-1039.352) -- 0:01:30
Average standard deviation of split frequencies: 0.010878
615500 -- (-1046.810) (-1052.487) (-1050.510) [-1038.302] * (-1054.978) (-1046.371) [-1047.232] (-1034.889) -- 0:01:30
616000 -- (-1048.060) (-1045.967) (-1038.040) [-1051.092] * (-1047.530) (-1044.801) [-1034.115] (-1049.924) -- 0:01:30
616500 -- (-1057.797) [-1040.006] (-1045.991) (-1050.080) * (-1055.142) (-1043.103) (-1043.907) [-1050.251] -- 0:01:30
617000 -- [-1051.076] (-1040.072) (-1056.526) (-1050.588) * (-1051.263) (-1064.016) (-1048.993) [-1044.126] -- 0:01:30
617500 -- (-1050.446) [-1048.287] (-1041.782) (-1051.338) * [-1059.387] (-1046.889) (-1047.029) (-1062.440) -- 0:01:30
618000 -- (-1050.829) (-1043.086) (-1038.500) [-1047.047] * [-1041.603] (-1043.796) (-1049.488) (-1045.402) -- 0:01:30
618500 -- (-1054.417) (-1052.255) [-1053.705] (-1043.521) * (-1043.895) [-1039.144] (-1058.756) (-1050.494) -- 0:01:30
619000 -- [-1048.449] (-1050.048) (-1038.177) (-1049.198) * (-1034.330) (-1044.261) [-1049.712] (-1072.160) -- 0:01:29
619500 -- (-1052.982) (-1036.409) (-1045.388) [-1042.698] * (-1041.520) (-1048.131) (-1056.686) [-1032.266] -- 0:01:29
620000 -- (-1055.425) [-1039.133] (-1055.584) (-1046.678) * (-1040.341) (-1053.600) [-1045.047] (-1036.301) -- 0:01:29
Average standard deviation of split frequencies: 0.010687
620500 -- [-1046.878] (-1039.339) (-1047.350) (-1053.711) * (-1042.538) (-1061.330) [-1037.367] (-1049.706) -- 0:01:29
621000 -- (-1052.950) (-1053.824) [-1044.271] (-1043.133) * (-1044.323) (-1056.431) (-1040.000) [-1040.576] -- 0:01:29
621500 -- [-1039.829] (-1061.276) (-1044.376) (-1040.566) * (-1040.930) (-1051.846) [-1044.951] (-1045.418) -- 0:01:29
622000 -- [-1039.901] (-1052.226) (-1039.327) (-1057.731) * (-1043.637) [-1053.293] (-1049.434) (-1051.442) -- 0:01:29
622500 -- (-1038.012) (-1047.273) (-1047.993) [-1043.464] * (-1046.898) (-1059.882) [-1046.561] (-1054.966) -- 0:01:29
623000 -- (-1037.792) [-1042.183] (-1052.317) (-1042.530) * (-1048.592) (-1043.202) (-1045.631) [-1044.477] -- 0:01:28
623500 -- (-1053.778) (-1049.200) [-1043.465] (-1037.205) * (-1051.058) [-1045.020] (-1045.497) (-1048.855) -- 0:01:28
624000 -- (-1065.029) [-1041.241] (-1041.273) (-1035.682) * (-1042.727) (-1048.181) [-1041.827] (-1046.161) -- 0:01:28
624500 -- (-1071.253) [-1034.261] (-1052.935) (-1056.090) * (-1040.642) [-1045.522] (-1071.082) (-1047.661) -- 0:01:28
625000 -- (-1047.172) [-1048.620] (-1045.796) (-1047.922) * [-1037.519] (-1052.692) (-1049.888) (-1047.029) -- 0:01:28
Average standard deviation of split frequencies: 0.010112
625500 -- (-1050.093) [-1041.364] (-1038.334) (-1063.523) * (-1034.338) (-1052.564) (-1052.460) [-1047.804] -- 0:01:28
626000 -- (-1048.990) (-1062.283) (-1048.996) [-1050.100] * (-1045.854) (-1046.697) [-1045.935] (-1043.379) -- 0:01:28
626500 -- (-1052.550) (-1055.943) (-1049.945) [-1052.226] * (-1045.866) [-1043.503] (-1052.794) (-1052.753) -- 0:01:28
627000 -- [-1042.166] (-1051.586) (-1047.916) (-1053.249) * (-1045.226) [-1051.315] (-1054.530) (-1053.206) -- 0:01:28
627500 -- [-1042.838] (-1046.819) (-1052.292) (-1055.746) * [-1035.761] (-1058.046) (-1051.924) (-1051.042) -- 0:01:27
628000 -- (-1045.234) [-1047.295] (-1050.972) (-1045.347) * [-1043.430] (-1046.978) (-1051.120) (-1053.419) -- 0:01:27
628500 -- [-1038.520] (-1059.219) (-1043.867) (-1056.262) * (-1055.771) (-1051.942) [-1048.615] (-1056.879) -- 0:01:27
629000 -- (-1042.902) (-1054.153) (-1048.454) [-1038.255] * (-1060.007) [-1054.482] (-1044.374) (-1046.653) -- 0:01:27
629500 -- (-1041.647) (-1047.876) (-1053.530) [-1043.590] * (-1044.586) [-1046.040] (-1059.564) (-1056.005) -- 0:01:27
630000 -- (-1064.175) (-1054.832) (-1046.825) [-1043.956] * (-1044.683) [-1042.114] (-1052.170) (-1066.210) -- 0:01:27
Average standard deviation of split frequencies: 0.009023
630500 -- (-1060.200) (-1046.107) (-1042.022) [-1050.640] * (-1051.692) (-1048.508) [-1052.541] (-1055.804) -- 0:01:27
631000 -- (-1061.054) [-1036.773] (-1042.344) (-1047.977) * (-1037.260) (-1044.049) (-1043.541) [-1048.025] -- 0:01:27
631500 -- [-1043.203] (-1040.513) (-1052.739) (-1048.888) * (-1051.907) (-1048.363) (-1051.669) [-1043.285] -- 0:01:26
632000 -- (-1040.753) (-1053.331) [-1034.870] (-1044.616) * (-1051.545) (-1047.971) (-1047.594) [-1041.796] -- 0:01:26
632500 -- [-1049.514] (-1043.437) (-1038.178) (-1047.820) * (-1049.375) (-1042.758) (-1054.949) [-1046.067] -- 0:01:26
633000 -- (-1045.211) [-1053.855] (-1037.854) (-1045.883) * (-1048.390) [-1043.612] (-1059.249) (-1053.747) -- 0:01:26
633500 -- (-1055.867) [-1049.346] (-1040.658) (-1043.400) * (-1039.390) (-1043.186) [-1042.687] (-1044.716) -- 0:01:26
634000 -- (-1055.906) (-1061.933) [-1041.407] (-1041.939) * [-1039.192] (-1052.409) (-1042.525) (-1041.728) -- 0:01:26
634500 -- (-1039.832) [-1037.015] (-1051.779) (-1038.865) * (-1042.138) [-1037.196] (-1051.708) (-1051.034) -- 0:01:26
635000 -- [-1052.956] (-1056.736) (-1054.588) (-1047.784) * (-1046.316) (-1052.599) [-1048.369] (-1052.912) -- 0:01:26
Average standard deviation of split frequencies: 0.009318
635500 -- [-1042.074] (-1054.400) (-1053.980) (-1058.271) * [-1042.377] (-1048.697) (-1056.071) (-1046.648) -- 0:01:26
636000 -- (-1055.409) [-1043.091] (-1046.420) (-1047.973) * [-1039.142] (-1055.056) (-1060.913) (-1050.380) -- 0:01:25
636500 -- (-1057.759) [-1038.504] (-1045.776) (-1053.010) * [-1036.116] (-1041.963) (-1054.772) (-1048.350) -- 0:01:25
637000 -- (-1051.961) (-1048.484) [-1051.308] (-1068.832) * (-1043.106) [-1036.418] (-1055.534) (-1048.360) -- 0:01:25
637500 -- (-1045.481) (-1051.877) (-1055.701) [-1043.308] * [-1038.342] (-1060.014) (-1043.715) (-1046.624) -- 0:01:25
638000 -- [-1043.385] (-1048.962) (-1045.020) (-1047.136) * [-1049.377] (-1045.436) (-1040.022) (-1058.395) -- 0:01:25
638500 -- [-1039.275] (-1050.817) (-1041.062) (-1047.729) * (-1048.262) (-1043.072) [-1055.539] (-1047.404) -- 0:01:25
639000 -- (-1047.313) (-1056.456) (-1047.230) [-1043.564] * (-1040.272) [-1037.566] (-1046.169) (-1051.032) -- 0:01:25
639500 -- [-1040.330] (-1050.657) (-1045.206) (-1058.165) * (-1044.730) [-1040.641] (-1044.402) (-1045.797) -- 0:01:25
640000 -- (-1042.398) [-1045.550] (-1039.207) (-1053.638) * [-1038.201] (-1043.842) (-1055.560) (-1041.513) -- 0:01:24
Average standard deviation of split frequencies: 0.009092
640500 -- [-1043.296] (-1049.193) (-1048.569) (-1050.302) * (-1047.754) (-1051.451) [-1043.317] (-1075.711) -- 0:01:24
641000 -- (-1069.583) [-1049.469] (-1045.225) (-1055.685) * [-1045.361] (-1058.352) (-1041.712) (-1052.893) -- 0:01:24
641500 -- (-1051.763) [-1053.635] (-1051.857) (-1052.297) * (-1046.644) (-1056.671) [-1042.932] (-1049.392) -- 0:01:24
642000 -- [-1038.865] (-1046.432) (-1049.711) (-1048.689) * (-1049.838) (-1052.949) [-1041.447] (-1040.410) -- 0:01:24
642500 -- (-1034.754) [-1044.164] (-1063.187) (-1051.869) * (-1046.918) [-1035.175] (-1048.564) (-1048.055) -- 0:01:24
643000 -- (-1045.692) [-1049.763] (-1052.501) (-1065.423) * (-1072.445) (-1043.867) [-1045.721] (-1056.086) -- 0:01:24
643500 -- [-1038.392] (-1047.656) (-1040.800) (-1064.946) * [-1047.640] (-1049.939) (-1045.116) (-1039.349) -- 0:01:24
644000 -- [-1041.072] (-1055.568) (-1050.281) (-1068.405) * (-1057.565) (-1049.594) [-1039.925] (-1045.147) -- 0:01:24
644500 -- (-1040.980) (-1066.667) [-1048.152] (-1040.945) * [-1035.239] (-1052.561) (-1056.735) (-1040.343) -- 0:01:23
645000 -- [-1037.991] (-1048.199) (-1044.850) (-1052.460) * [-1044.011] (-1043.901) (-1040.512) (-1042.453) -- 0:01:23
Average standard deviation of split frequencies: 0.010112
645500 -- (-1049.691) [-1040.790] (-1045.704) (-1046.039) * (-1053.760) (-1045.949) [-1034.597] (-1047.366) -- 0:01:23
646000 -- [-1048.694] (-1040.009) (-1049.296) (-1047.042) * [-1047.285] (-1052.560) (-1058.440) (-1061.604) -- 0:01:23
646500 -- (-1036.809) [-1041.686] (-1044.745) (-1055.022) * [-1040.377] (-1042.482) (-1051.277) (-1054.827) -- 0:01:23
647000 -- (-1045.903) [-1041.397] (-1051.227) (-1042.317) * (-1049.397) [-1043.025] (-1052.548) (-1050.484) -- 0:01:23
647500 -- (-1036.289) [-1052.569] (-1053.951) (-1047.269) * [-1041.880] (-1037.118) (-1046.635) (-1053.812) -- 0:01:23
648000 -- (-1047.720) (-1039.766) (-1040.284) [-1036.664] * (-1039.178) [-1051.439] (-1045.454) (-1047.524) -- 0:01:23
648500 -- (-1043.706) (-1047.753) [-1041.730] (-1060.640) * (-1049.713) (-1053.452) (-1048.365) [-1037.368] -- 0:01:22
649000 -- (-1053.697) (-1049.043) [-1046.098] (-1042.024) * (-1045.463) [-1044.836] (-1046.703) (-1050.463) -- 0:01:22
649500 -- (-1057.238) (-1053.881) (-1055.079) [-1044.417] * [-1042.496] (-1061.890) (-1042.967) (-1049.939) -- 0:01:22
650000 -- (-1040.126) (-1054.500) (-1058.249) [-1045.412] * (-1048.302) (-1051.598) [-1041.396] (-1046.828) -- 0:01:22
Average standard deviation of split frequencies: 0.009160
650500 -- [-1037.769] (-1059.704) (-1053.449) (-1050.412) * (-1046.249) (-1065.110) (-1050.589) [-1040.383] -- 0:01:22
651000 -- (-1047.596) [-1044.552] (-1065.934) (-1058.244) * (-1048.217) (-1066.347) [-1044.021] (-1043.123) -- 0:01:22
651500 -- [-1038.603] (-1050.672) (-1053.390) (-1052.693) * (-1039.638) (-1052.923) [-1042.104] (-1040.040) -- 0:01:22
652000 -- [-1041.580] (-1045.833) (-1059.548) (-1049.770) * (-1045.153) [-1042.935] (-1059.085) (-1042.776) -- 0:01:22
652500 -- (-1055.256) (-1034.932) [-1044.109] (-1047.070) * [-1038.783] (-1046.395) (-1049.206) (-1046.117) -- 0:01:22
653000 -- (-1046.853) (-1044.107) [-1042.484] (-1058.002) * (-1054.714) (-1049.609) [-1043.264] (-1066.130) -- 0:01:21
653500 -- (-1043.638) (-1047.572) [-1041.037] (-1047.717) * [-1045.700] (-1041.318) (-1066.339) (-1048.465) -- 0:01:21
654000 -- (-1053.183) (-1033.970) [-1048.155] (-1059.796) * (-1041.873) (-1053.015) [-1051.525] (-1052.781) -- 0:01:21
654500 -- (-1046.811) (-1043.205) [-1041.442] (-1059.705) * (-1041.162) (-1049.279) [-1043.772] (-1051.118) -- 0:01:21
655000 -- (-1037.729) (-1049.491) (-1049.919) [-1047.215] * (-1052.109) [-1052.733] (-1040.094) (-1073.375) -- 0:01:21
Average standard deviation of split frequencies: 0.008931
655500 -- (-1042.011) (-1054.875) [-1039.758] (-1045.044) * (-1051.056) (-1050.694) (-1054.910) [-1042.229] -- 0:01:21
656000 -- (-1041.898) (-1076.826) [-1040.742] (-1045.799) * (-1041.187) (-1052.406) [-1045.696] (-1055.245) -- 0:01:21
656500 -- [-1042.436] (-1046.177) (-1047.923) (-1046.187) * (-1041.374) (-1050.674) (-1044.549) [-1038.800] -- 0:01:21
657000 -- (-1045.774) (-1040.963) [-1053.624] (-1047.073) * [-1038.137] (-1041.875) (-1048.529) (-1060.516) -- 0:01:20
657500 -- (-1045.165) [-1038.146] (-1063.868) (-1043.130) * (-1051.664) (-1039.371) (-1051.894) [-1044.591] -- 0:01:20
658000 -- (-1042.372) [-1040.317] (-1054.325) (-1038.276) * (-1068.439) (-1050.919) (-1039.867) [-1046.985] -- 0:01:20
658500 -- (-1048.343) (-1053.713) (-1053.477) [-1040.340] * (-1050.692) (-1049.167) (-1055.913) [-1045.810] -- 0:01:20
659000 -- (-1047.527) [-1041.129] (-1052.173) (-1038.672) * (-1048.474) (-1046.281) (-1061.764) [-1051.231] -- 0:01:20
659500 -- (-1060.232) [-1047.562] (-1046.904) (-1042.284) * (-1048.346) [-1039.664] (-1045.748) (-1050.980) -- 0:01:20
660000 -- [-1039.663] (-1047.852) (-1044.616) (-1050.442) * (-1062.526) (-1043.531) (-1055.312) [-1041.630] -- 0:01:20
Average standard deviation of split frequencies: 0.008766
660500 -- [-1037.870] (-1050.838) (-1046.295) (-1046.644) * (-1043.291) [-1044.996] (-1063.017) (-1049.087) -- 0:01:20
661000 -- (-1055.615) [-1042.191] (-1052.483) (-1043.475) * [-1044.507] (-1051.708) (-1055.908) (-1062.818) -- 0:01:20
661500 -- [-1036.452] (-1047.711) (-1055.340) (-1038.507) * (-1048.544) (-1040.853) [-1043.459] (-1060.957) -- 0:01:19
662000 -- (-1056.118) (-1042.537) (-1044.816) [-1046.036] * (-1037.668) [-1029.670] (-1041.798) (-1055.454) -- 0:01:19
662500 -- (-1061.247) [-1048.951] (-1058.655) (-1050.100) * (-1038.822) (-1049.267) [-1044.768] (-1054.878) -- 0:01:19
663000 -- [-1046.444] (-1037.090) (-1056.610) (-1056.931) * (-1047.512) [-1047.948] (-1045.690) (-1047.569) -- 0:01:19
663500 -- [-1038.177] (-1046.444) (-1052.581) (-1047.717) * (-1052.173) (-1043.669) (-1041.000) [-1050.953] -- 0:01:19
664000 -- (-1050.380) [-1035.531] (-1053.160) (-1043.222) * (-1053.604) (-1066.425) [-1033.813] (-1047.295) -- 0:01:19
664500 -- (-1049.054) (-1046.429) [-1045.635] (-1044.568) * (-1053.954) (-1048.143) [-1037.555] (-1048.755) -- 0:01:19
665000 -- (-1045.294) [-1035.334] (-1049.028) (-1040.328) * (-1034.891) [-1040.975] (-1056.451) (-1038.706) -- 0:01:19
Average standard deviation of split frequencies: 0.007837
665500 -- (-1048.245) (-1048.055) (-1053.303) [-1047.085] * (-1056.489) (-1045.288) (-1049.972) [-1045.461] -- 0:01:18
666000 -- (-1048.871) [-1042.618] (-1050.213) (-1052.396) * (-1042.529) (-1043.148) (-1043.520) [-1038.717] -- 0:01:18
666500 -- (-1054.802) [-1047.037] (-1047.527) (-1056.149) * (-1053.286) (-1055.723) (-1049.567) [-1045.234] -- 0:01:18
667000 -- (-1039.639) [-1050.832] (-1061.556) (-1034.996) * (-1040.122) (-1052.936) [-1035.145] (-1059.857) -- 0:01:18
667500 -- (-1048.386) (-1067.674) [-1044.431] (-1047.979) * (-1050.871) (-1044.646) [-1041.046] (-1046.527) -- 0:01:18
668000 -- (-1049.146) [-1047.906] (-1051.103) (-1048.168) * (-1042.630) (-1038.145) (-1037.214) [-1045.332] -- 0:01:18
668500 -- (-1056.036) (-1058.211) (-1064.480) [-1031.871] * [-1044.584] (-1042.796) (-1042.744) (-1050.719) -- 0:01:18
669000 -- (-1052.679) [-1036.029] (-1052.981) (-1055.518) * (-1052.184) [-1034.151] (-1037.685) (-1057.908) -- 0:01:18
669500 -- (-1058.097) [-1037.881] (-1043.499) (-1039.466) * (-1050.951) [-1049.497] (-1045.286) (-1041.024) -- 0:01:17
670000 -- (-1037.969) [-1040.360] (-1054.900) (-1052.564) * (-1049.970) (-1037.842) [-1039.247] (-1045.758) -- 0:01:17
Average standard deviation of split frequencies: 0.006979
670500 -- [-1039.871] (-1045.948) (-1043.492) (-1054.241) * [-1043.536] (-1044.554) (-1056.756) (-1057.401) -- 0:01:17
671000 -- (-1049.215) (-1056.933) (-1054.060) [-1050.851] * (-1061.801) [-1047.735] (-1043.787) (-1040.114) -- 0:01:17
671500 -- (-1063.378) (-1048.695) [-1043.126] (-1059.499) * (-1036.492) [-1036.597] (-1056.705) (-1046.219) -- 0:01:17
672000 -- [-1038.448] (-1054.647) (-1047.185) (-1052.815) * (-1049.703) (-1040.174) (-1051.786) [-1038.213] -- 0:01:17
672500 -- [-1044.146] (-1049.308) (-1048.373) (-1048.165) * (-1050.093) (-1053.633) (-1050.953) [-1039.135] -- 0:01:17
673000 -- (-1059.983) [-1053.177] (-1035.032) (-1048.808) * (-1048.912) [-1036.903] (-1051.247) (-1048.276) -- 0:01:17
673500 -- (-1044.688) [-1044.702] (-1046.043) (-1058.948) * (-1057.125) [-1044.663] (-1049.937) (-1042.704) -- 0:01:17
674000 -- (-1048.108) (-1044.589) (-1042.713) [-1048.532] * (-1052.676) (-1038.183) (-1038.056) [-1037.453] -- 0:01:16
674500 -- (-1063.374) (-1049.064) (-1037.410) [-1046.581] * [-1050.262] (-1040.460) (-1057.170) (-1039.592) -- 0:01:16
675000 -- [-1043.616] (-1038.319) (-1045.898) (-1046.861) * (-1043.769) (-1048.243) (-1065.685) [-1037.651] -- 0:01:16
Average standard deviation of split frequencies: 0.006675
675500 -- (-1053.890) [-1037.897] (-1036.330) (-1041.982) * [-1040.553] (-1045.958) (-1053.583) (-1052.295) -- 0:01:16
676000 -- [-1042.138] (-1048.375) (-1050.099) (-1042.698) * (-1055.296) [-1044.037] (-1062.105) (-1042.687) -- 0:01:16
676500 -- (-1039.210) [-1054.102] (-1047.271) (-1047.070) * (-1041.836) [-1043.713] (-1057.935) (-1045.064) -- 0:01:16
677000 -- (-1043.032) (-1051.470) (-1050.092) [-1048.134] * (-1047.928) (-1038.406) (-1065.756) [-1053.141] -- 0:01:16
677500 -- (-1042.180) (-1047.001) (-1046.474) [-1050.738] * (-1056.568) (-1040.551) (-1055.242) [-1046.795] -- 0:01:16
678000 -- (-1040.917) (-1049.841) [-1037.471] (-1053.310) * (-1059.881) [-1051.155] (-1061.644) (-1041.981) -- 0:01:15
678500 -- (-1041.356) (-1054.751) [-1041.501] (-1053.898) * (-1046.560) [-1046.296] (-1054.146) (-1058.014) -- 0:01:15
679000 -- (-1047.534) (-1053.548) [-1034.882] (-1055.325) * (-1042.718) (-1052.345) (-1054.544) [-1040.493] -- 0:01:15
679500 -- [-1039.903] (-1054.131) (-1037.946) (-1054.243) * [-1038.020] (-1056.599) (-1059.684) (-1052.851) -- 0:01:15
680000 -- (-1042.796) (-1045.170) [-1045.305] (-1058.855) * [-1049.992] (-1050.960) (-1052.826) (-1045.602) -- 0:01:15
Average standard deviation of split frequencies: 0.006184
680500 -- (-1043.254) [-1039.502] (-1042.100) (-1048.889) * (-1053.561) [-1042.370] (-1044.804) (-1044.722) -- 0:01:15
681000 -- (-1051.331) [-1042.682] (-1049.597) (-1054.552) * [-1043.113] (-1060.538) (-1062.770) (-1051.972) -- 0:01:15
681500 -- (-1044.549) (-1048.401) [-1043.361] (-1050.029) * (-1058.583) (-1040.820) [-1040.937] (-1046.196) -- 0:01:15
682000 -- (-1045.634) [-1043.772] (-1045.706) (-1052.302) * (-1057.993) (-1053.662) [-1040.912] (-1041.438) -- 0:01:15
682500 -- [-1038.446] (-1041.942) (-1035.205) (-1042.132) * [-1037.331] (-1040.307) (-1053.744) (-1046.230) -- 0:01:14
683000 -- (-1056.093) (-1044.542) [-1039.611] (-1047.425) * (-1051.407) [-1045.197] (-1041.526) (-1049.290) -- 0:01:14
683500 -- (-1052.998) [-1035.317] (-1048.174) (-1050.628) * (-1062.521) [-1035.441] (-1042.147) (-1046.346) -- 0:01:14
684000 -- (-1055.764) [-1048.224] (-1040.961) (-1052.484) * (-1048.008) (-1056.717) [-1042.261] (-1051.790) -- 0:01:14
684500 -- [-1048.570] (-1054.078) (-1057.615) (-1044.951) * (-1056.948) [-1039.168] (-1049.872) (-1043.496) -- 0:01:14
685000 -- (-1054.158) (-1057.219) [-1047.846] (-1050.384) * [-1043.935] (-1062.845) (-1042.786) (-1046.842) -- 0:01:14
Average standard deviation of split frequencies: 0.006283
685500 -- (-1062.123) (-1068.647) (-1045.636) [-1053.362] * (-1044.280) (-1070.974) (-1045.606) [-1041.182] -- 0:01:14
686000 -- (-1047.664) (-1047.909) (-1051.824) [-1041.162] * [-1048.530] (-1068.632) (-1063.980) (-1048.627) -- 0:01:14
686500 -- (-1038.426) [-1055.272] (-1048.626) (-1040.164) * (-1047.916) (-1054.906) (-1053.817) [-1047.992] -- 0:01:13
687000 -- [-1040.350] (-1051.238) (-1057.468) (-1055.283) * (-1049.159) (-1053.694) (-1045.640) [-1041.079] -- 0:01:13
687500 -- (-1044.365) (-1052.173) (-1052.414) [-1040.043] * (-1057.726) [-1051.561] (-1054.111) (-1056.349) -- 0:01:13
688000 -- (-1041.906) (-1052.981) (-1052.889) [-1041.026] * [-1045.619] (-1046.514) (-1049.221) (-1062.252) -- 0:01:13
688500 -- (-1043.101) (-1054.286) [-1050.353] (-1058.777) * [-1045.356] (-1053.885) (-1041.938) (-1055.484) -- 0:01:13
689000 -- [-1041.723] (-1060.926) (-1048.033) (-1040.397) * (-1042.012) (-1055.455) [-1052.998] (-1062.613) -- 0:01:13
689500 -- (-1056.326) [-1043.401] (-1040.879) (-1041.946) * (-1040.944) (-1063.013) (-1044.174) [-1042.915] -- 0:01:13
690000 -- (-1047.813) (-1052.434) (-1046.499) [-1046.550] * [-1035.686] (-1060.401) (-1040.875) (-1044.083) -- 0:01:13
Average standard deviation of split frequencies: 0.006728
690500 -- (-1047.640) (-1048.746) (-1052.499) [-1044.880] * (-1040.063) [-1049.718] (-1042.928) (-1054.922) -- 0:01:13
691000 -- (-1044.943) [-1043.249] (-1059.374) (-1047.002) * (-1042.192) (-1055.610) (-1045.291) [-1043.708] -- 0:01:12
691500 -- (-1060.560) (-1057.593) [-1039.824] (-1042.089) * (-1052.699) [-1048.438] (-1054.883) (-1038.805) -- 0:01:12
692000 -- (-1038.081) (-1043.982) (-1044.151) [-1040.285] * (-1054.460) (-1052.316) (-1066.658) [-1044.587] -- 0:01:12
692500 -- (-1056.095) (-1037.815) [-1043.729] (-1059.680) * (-1051.255) [-1049.106] (-1052.325) (-1044.375) -- 0:01:12
693000 -- (-1044.733) (-1043.220) (-1063.823) [-1045.749] * (-1049.949) (-1045.700) (-1045.505) [-1042.071] -- 0:01:12
693500 -- [-1039.850] (-1041.622) (-1038.240) (-1050.390) * (-1052.679) (-1056.694) (-1043.324) [-1039.815] -- 0:01:12
694000 -- [-1038.065] (-1051.520) (-1067.246) (-1061.900) * (-1045.920) (-1055.922) [-1035.114] (-1040.854) -- 0:01:12
694500 -- (-1048.524) (-1042.874) (-1065.370) [-1037.243] * (-1047.551) (-1039.653) [-1048.616] (-1042.398) -- 0:01:12
695000 -- (-1043.915) (-1054.790) [-1043.138] (-1050.643) * (-1052.466) [-1054.649] (-1036.266) (-1046.415) -- 0:01:11
Average standard deviation of split frequencies: 0.006386
695500 -- [-1041.132] (-1040.357) (-1043.637) (-1054.882) * (-1053.776) (-1048.970) (-1051.554) [-1044.404] -- 0:01:11
696000 -- [-1039.282] (-1056.715) (-1051.137) (-1051.635) * (-1040.333) [-1051.682] (-1045.740) (-1050.975) -- 0:01:11
696500 -- (-1053.174) (-1045.577) (-1045.629) [-1052.012] * (-1051.607) [-1037.949] (-1041.010) (-1060.286) -- 0:01:11
697000 -- [-1046.775] (-1056.333) (-1061.514) (-1060.646) * (-1048.137) [-1044.060] (-1043.332) (-1045.972) -- 0:01:11
697500 -- (-1047.735) (-1054.662) [-1046.864] (-1054.165) * (-1040.300) [-1040.992] (-1054.813) (-1041.776) -- 0:01:11
698000 -- (-1044.709) (-1059.855) [-1039.095] (-1049.235) * [-1039.567] (-1051.611) (-1045.240) (-1043.392) -- 0:01:11
698500 -- (-1050.850) (-1066.108) [-1044.224] (-1048.063) * [-1045.400] (-1048.378) (-1038.134) (-1050.775) -- 0:01:11
699000 -- (-1045.533) [-1038.172] (-1053.446) (-1037.943) * [-1043.683] (-1048.234) (-1044.024) (-1044.885) -- 0:01:11
699500 -- (-1051.725) (-1059.432) (-1050.176) [-1036.984] * [-1047.741] (-1041.487) (-1056.156) (-1044.588) -- 0:01:10
700000 -- (-1048.710) (-1043.158) [-1048.365] (-1038.434) * (-1053.232) [-1047.097] (-1056.030) (-1041.590) -- 0:01:10
Average standard deviation of split frequencies: 0.005815
700500 -- (-1048.665) (-1055.302) [-1040.074] (-1048.082) * (-1053.032) (-1040.180) (-1042.668) [-1039.273] -- 0:01:10
701000 -- (-1054.351) (-1046.883) [-1040.811] (-1053.581) * (-1056.379) (-1065.905) [-1046.389] (-1044.750) -- 0:01:10
701500 -- (-1046.362) [-1038.265] (-1043.683) (-1037.587) * (-1050.180) (-1053.342) (-1063.717) [-1051.594] -- 0:01:10
702000 -- (-1053.779) (-1039.349) (-1050.115) [-1047.702] * (-1043.788) (-1065.444) [-1045.542] (-1045.167) -- 0:01:10
702500 -- (-1046.978) (-1040.751) [-1035.709] (-1043.294) * [-1044.857] (-1043.540) (-1037.625) (-1049.715) -- 0:01:10
703000 -- (-1054.941) [-1048.128] (-1053.794) (-1041.976) * [-1049.321] (-1050.890) (-1044.095) (-1051.404) -- 0:01:10
703500 -- (-1046.675) (-1052.546) [-1040.039] (-1046.281) * [-1048.886] (-1048.281) (-1050.378) (-1049.884) -- 0:01:09
704000 -- (-1046.315) [-1042.162] (-1049.425) (-1047.183) * [-1041.680] (-1047.246) (-1040.889) (-1056.053) -- 0:01:09
704500 -- (-1045.461) (-1046.627) (-1050.184) [-1045.942] * [-1044.332] (-1049.688) (-1040.624) (-1055.860) -- 0:01:09
705000 -- (-1057.385) (-1068.934) (-1054.320) [-1048.137] * [-1049.613] (-1056.753) (-1042.376) (-1048.702) -- 0:01:09
Average standard deviation of split frequencies: 0.005819
705500 -- (-1043.422) (-1075.543) (-1046.881) [-1044.806] * (-1044.213) (-1050.641) (-1046.888) [-1047.301] -- 0:01:09
706000 -- (-1058.368) (-1047.552) (-1040.177) [-1035.424] * [-1046.603] (-1043.150) (-1040.702) (-1054.455) -- 0:01:09
706500 -- (-1047.337) (-1055.067) [-1047.524] (-1041.387) * (-1037.317) (-1050.051) [-1045.705] (-1045.900) -- 0:01:09
707000 -- (-1041.169) (-1045.234) (-1051.532) [-1041.682] * (-1049.413) [-1049.166] (-1050.346) (-1045.928) -- 0:01:09
707500 -- (-1046.554) (-1054.242) [-1044.799] (-1046.298) * (-1040.042) [-1046.062] (-1046.268) (-1050.300) -- 0:01:09
708000 -- (-1069.662) (-1047.405) [-1037.926] (-1043.954) * (-1053.887) (-1058.729) (-1045.124) [-1042.964] -- 0:01:08
708500 -- [-1038.184] (-1064.296) (-1045.880) (-1059.159) * (-1046.122) (-1052.207) (-1053.011) [-1033.445] -- 0:01:08
709000 -- [-1040.001] (-1053.137) (-1049.878) (-1054.037) * [-1046.402] (-1039.943) (-1043.164) (-1043.170) -- 0:01:08
709500 -- [-1045.298] (-1052.952) (-1046.390) (-1051.904) * (-1047.787) (-1042.053) [-1039.964] (-1056.535) -- 0:01:08
710000 -- (-1038.753) (-1063.256) (-1060.681) [-1051.429] * (-1041.753) (-1055.483) [-1036.166] (-1046.353) -- 0:01:08
Average standard deviation of split frequencies: 0.005780
710500 -- [-1048.603] (-1053.762) (-1054.836) (-1061.004) * (-1048.392) (-1053.796) [-1044.535] (-1041.477) -- 0:01:08
711000 -- (-1057.884) (-1068.494) (-1055.000) [-1046.592] * (-1043.839) [-1050.146] (-1044.791) (-1043.407) -- 0:01:08
711500 -- (-1044.072) [-1044.306] (-1042.659) (-1050.664) * [-1039.672] (-1050.261) (-1051.826) (-1050.659) -- 0:01:08
712000 -- (-1039.850) (-1063.021) [-1032.014] (-1041.136) * [-1034.785] (-1038.569) (-1050.262) (-1057.010) -- 0:01:07
712500 -- (-1046.152) (-1064.631) [-1033.064] (-1073.532) * [-1040.393] (-1040.721) (-1068.826) (-1040.659) -- 0:01:07
713000 -- (-1042.655) [-1045.900] (-1049.786) (-1067.507) * (-1044.237) (-1038.212) (-1069.948) [-1038.309] -- 0:01:07
713500 -- (-1048.717) (-1043.849) [-1040.734] (-1049.813) * [-1033.828] (-1060.021) (-1062.284) (-1037.952) -- 0:01:07
714000 -- [-1036.908] (-1050.078) (-1059.604) (-1051.685) * (-1056.364) [-1040.341] (-1057.955) (-1055.837) -- 0:01:07
714500 -- (-1054.696) [-1042.619] (-1051.583) (-1044.858) * (-1040.334) (-1041.127) [-1042.849] (-1049.907) -- 0:01:07
715000 -- (-1047.679) (-1056.998) (-1063.852) [-1042.780] * (-1044.502) (-1047.997) [-1043.253] (-1045.305) -- 0:01:07
Average standard deviation of split frequencies: 0.005220
715500 -- (-1052.327) (-1043.560) (-1055.948) [-1050.423] * (-1050.639) (-1060.561) [-1048.750] (-1049.547) -- 0:01:07
716000 -- (-1058.502) (-1042.845) [-1037.285] (-1048.495) * [-1043.834] (-1045.741) (-1042.353) (-1036.563) -- 0:01:07
716500 -- (-1053.654) (-1054.782) [-1050.072] (-1053.401) * (-1055.648) (-1049.490) [-1038.330] (-1048.106) -- 0:01:06
717000 -- (-1047.035) [-1044.210] (-1044.444) (-1050.377) * (-1059.343) (-1042.293) [-1037.227] (-1049.697) -- 0:01:06
717500 -- (-1043.517) (-1042.551) [-1041.443] (-1055.095) * (-1058.101) [-1042.243] (-1048.848) (-1055.747) -- 0:01:06
718000 -- (-1037.202) (-1048.975) (-1047.264) [-1033.847] * (-1047.749) (-1045.702) (-1052.266) [-1047.057] -- 0:01:06
718500 -- (-1039.947) (-1056.331) (-1055.469) [-1047.401] * (-1048.716) [-1034.607] (-1051.298) (-1049.518) -- 0:01:06
719000 -- (-1045.157) (-1051.065) (-1036.630) [-1042.003] * (-1049.488) [-1039.113] (-1055.125) (-1045.913) -- 0:01:06
719500 -- (-1050.046) (-1039.765) [-1045.444] (-1050.875) * (-1062.435) [-1053.743] (-1047.189) (-1048.096) -- 0:01:06
720000 -- (-1041.636) [-1037.068] (-1052.821) (-1052.288) * (-1043.506) [-1048.791] (-1050.034) (-1046.527) -- 0:01:06
Average standard deviation of split frequencies: 0.005186
720500 -- (-1052.654) (-1047.556) [-1040.468] (-1038.787) * [-1044.681] (-1054.176) (-1053.974) (-1051.541) -- 0:01:05
721000 -- (-1042.891) (-1063.038) [-1037.210] (-1051.306) * [-1043.655] (-1058.047) (-1044.078) (-1053.101) -- 0:01:05
721500 -- [-1038.214] (-1047.733) (-1040.416) (-1044.468) * (-1040.455) [-1039.656] (-1051.401) (-1042.990) -- 0:01:05
722000 -- [-1036.904] (-1055.214) (-1065.070) (-1056.332) * (-1056.558) (-1039.297) (-1049.494) [-1043.758] -- 0:01:05
722500 -- [-1053.452] (-1045.506) (-1064.291) (-1056.798) * [-1041.110] (-1041.840) (-1062.211) (-1041.944) -- 0:01:05
723000 -- (-1052.527) [-1044.945] (-1045.002) (-1052.790) * (-1035.873) (-1047.704) (-1054.219) [-1045.676] -- 0:01:05
723500 -- (-1057.468) (-1049.703) [-1048.825] (-1039.965) * [-1032.624] (-1059.051) (-1043.884) (-1048.539) -- 0:01:05
724000 -- (-1063.235) [-1046.277] (-1037.949) (-1041.780) * (-1047.800) (-1045.164) (-1043.853) [-1034.996] -- 0:01:05
724500 -- (-1054.929) [-1042.648] (-1043.772) (-1041.483) * [-1035.468] (-1039.904) (-1042.677) (-1050.400) -- 0:01:05
725000 -- (-1054.527) (-1043.918) (-1041.073) [-1039.088] * (-1039.012) (-1052.801) (-1052.867) [-1045.295] -- 0:01:04
Average standard deviation of split frequencies: 0.005148
725500 -- (-1045.118) [-1042.711] (-1049.455) (-1051.450) * (-1054.698) [-1037.697] (-1046.250) (-1036.753) -- 0:01:04
726000 -- (-1048.122) (-1050.436) (-1056.898) [-1053.630] * [-1045.762] (-1040.845) (-1047.206) (-1040.475) -- 0:01:04
726500 -- (-1068.622) (-1050.484) (-1039.040) [-1043.408] * (-1053.647) (-1032.262) [-1033.786] (-1044.401) -- 0:01:04
727000 -- (-1054.762) [-1037.866] (-1041.232) (-1037.767) * (-1044.258) [-1051.144] (-1058.790) (-1051.544) -- 0:01:04
727500 -- (-1066.601) (-1055.885) (-1047.799) [-1044.030] * [-1039.777] (-1057.324) (-1042.341) (-1067.969) -- 0:01:04
728000 -- (-1047.742) (-1045.220) (-1062.317) [-1037.731] * [-1035.743] (-1064.072) (-1046.741) (-1040.632) -- 0:01:04
728500 -- (-1046.391) (-1048.278) (-1067.690) [-1039.249] * [-1043.230] (-1046.596) (-1047.429) (-1065.093) -- 0:01:04
729000 -- (-1048.674) [-1043.868] (-1050.552) (-1045.385) * [-1044.781] (-1069.361) (-1051.220) (-1041.313) -- 0:01:03
729500 -- (-1050.690) (-1047.721) (-1046.574) [-1041.221] * (-1043.903) (-1044.878) (-1050.860) [-1035.376] -- 0:01:03
730000 -- (-1041.844) [-1039.945] (-1047.432) (-1048.520) * [-1046.822] (-1045.188) (-1050.090) (-1047.894) -- 0:01:03
Average standard deviation of split frequencies: 0.005346
730500 -- [-1034.796] (-1040.281) (-1050.002) (-1043.107) * (-1048.410) [-1046.649] (-1056.543) (-1042.292) -- 0:01:03
731000 -- [-1048.330] (-1061.094) (-1046.976) (-1038.049) * [-1041.676] (-1045.231) (-1042.605) (-1047.946) -- 0:01:03
731500 -- [-1039.706] (-1037.924) (-1058.458) (-1048.523) * (-1054.043) (-1045.713) (-1037.688) [-1040.786] -- 0:01:03
732000 -- (-1046.049) [-1050.494] (-1047.165) (-1049.351) * (-1038.545) (-1046.499) [-1041.083] (-1060.534) -- 0:01:03
732500 -- (-1052.375) [-1038.807] (-1033.515) (-1048.507) * [-1051.210] (-1057.089) (-1044.619) (-1045.797) -- 0:01:03
733000 -- (-1046.550) (-1045.517) (-1038.766) [-1043.702] * [-1035.771] (-1052.866) (-1044.085) (-1051.564) -- 0:01:03
733500 -- (-1055.665) [-1036.229] (-1044.434) (-1050.906) * (-1041.543) (-1058.533) (-1043.506) [-1035.873] -- 0:01:02
734000 -- (-1050.079) [-1042.230] (-1042.600) (-1044.876) * (-1046.761) (-1055.312) (-1047.769) [-1043.440] -- 0:01:02
734500 -- (-1054.413) [-1045.363] (-1046.918) (-1047.853) * [-1046.880] (-1046.368) (-1050.833) (-1049.153) -- 0:01:02
735000 -- (-1053.043) (-1062.385) (-1049.635) [-1036.751] * (-1046.754) (-1038.158) [-1039.292] (-1047.211) -- 0:01:02
Average standard deviation of split frequencies: 0.005490
735500 -- (-1035.692) (-1057.602) [-1041.532] (-1038.719) * (-1039.403) (-1044.279) [-1038.814] (-1050.197) -- 0:01:02
736000 -- (-1043.673) (-1074.423) (-1053.599) [-1037.495] * [-1042.576] (-1039.443) (-1045.517) (-1040.427) -- 0:01:02
736500 -- (-1046.800) (-1058.498) (-1046.263) [-1044.209] * (-1045.597) (-1041.049) (-1046.903) [-1039.925] -- 0:01:02
737000 -- (-1045.599) (-1060.301) [-1037.665] (-1043.200) * (-1047.489) (-1066.462) [-1046.090] (-1052.015) -- 0:01:02
737500 -- (-1045.799) (-1054.773) [-1042.104] (-1049.782) * (-1060.482) (-1059.977) (-1041.906) [-1049.010] -- 0:01:01
738000 -- (-1037.422) (-1055.389) (-1054.744) [-1045.496] * (-1061.127) (-1079.415) (-1048.137) [-1036.236] -- 0:01:01
738500 -- (-1044.264) (-1044.168) [-1037.516] (-1051.773) * (-1045.091) (-1045.236) [-1036.840] (-1046.510) -- 0:01:01
739000 -- (-1053.610) [-1036.995] (-1041.549) (-1046.205) * [-1044.411] (-1056.011) (-1048.839) (-1053.929) -- 0:01:01
739500 -- (-1057.249) (-1041.193) (-1042.014) [-1040.145] * [-1040.020] (-1051.730) (-1041.922) (-1047.854) -- 0:01:01
740000 -- [-1048.988] (-1047.892) (-1043.610) (-1047.469) * (-1044.601) (-1057.987) [-1041.816] (-1046.976) -- 0:01:01
Average standard deviation of split frequencies: 0.005728
740500 -- (-1046.239) (-1052.898) (-1054.903) [-1045.089] * (-1041.936) (-1051.999) [-1039.560] (-1057.341) -- 0:01:01
741000 -- (-1042.979) (-1051.825) (-1046.409) [-1048.354] * [-1031.509] (-1064.617) (-1041.029) (-1041.139) -- 0:01:01
741500 -- (-1062.320) (-1047.768) (-1043.103) [-1040.930] * [-1048.583] (-1054.690) (-1049.745) (-1038.411) -- 0:01:01
742000 -- (-1054.408) [-1045.376] (-1039.365) (-1050.404) * (-1038.214) (-1050.635) (-1051.788) [-1055.912] -- 0:01:00
742500 -- (-1044.944) (-1045.506) [-1049.682] (-1065.191) * (-1044.694) (-1051.903) [-1040.942] (-1052.486) -- 0:01:00
743000 -- (-1054.475) (-1045.267) [-1040.409] (-1056.438) * (-1036.727) (-1061.116) [-1041.669] (-1072.951) -- 0:01:00
743500 -- (-1041.047) (-1039.774) (-1049.859) [-1035.068] * (-1059.760) [-1055.769] (-1047.139) (-1054.613) -- 0:01:00
744000 -- (-1054.345) [-1051.288] (-1052.692) (-1046.756) * [-1046.720] (-1052.494) (-1043.187) (-1046.318) -- 0:01:00
744500 -- (-1043.552) [-1043.385] (-1053.797) (-1048.729) * (-1057.774) (-1051.652) (-1062.363) [-1041.892] -- 0:01:00
745000 -- (-1042.612) (-1044.364) [-1036.406] (-1043.114) * (-1039.432) (-1054.554) (-1047.806) [-1040.108] -- 0:01:00
Average standard deviation of split frequencies: 0.005777
745500 -- (-1045.299) [-1042.426] (-1048.652) (-1040.328) * [-1046.002] (-1047.589) (-1045.922) (-1044.302) -- 0:01:00
746000 -- (-1046.296) [-1034.949] (-1044.342) (-1045.938) * (-1050.984) (-1059.745) [-1039.281] (-1048.243) -- 0:00:59
746500 -- (-1053.791) (-1043.552) [-1040.184] (-1039.510) * (-1045.118) (-1052.673) [-1038.505] (-1041.715) -- 0:00:59
747000 -- (-1057.912) (-1054.441) (-1046.332) [-1039.846] * (-1056.089) [-1042.875] (-1042.654) (-1043.892) -- 0:00:59
747500 -- (-1046.490) [-1044.049] (-1042.646) (-1043.178) * [-1043.382] (-1047.309) (-1048.923) (-1048.485) -- 0:00:59
748000 -- (-1053.477) (-1048.027) (-1042.856) [-1054.221] * (-1049.345) [-1045.871] (-1060.135) (-1043.068) -- 0:00:59
748500 -- (-1042.072) [-1041.328] (-1055.716) (-1065.110) * [-1044.849] (-1041.647) (-1050.713) (-1044.467) -- 0:00:59
749000 -- [-1040.013] (-1036.970) (-1048.948) (-1044.670) * (-1055.041) (-1049.419) (-1047.100) [-1041.382] -- 0:00:59
749500 -- (-1052.759) [-1049.722] (-1042.252) (-1047.035) * (-1039.224) (-1039.809) [-1043.989] (-1059.504) -- 0:00:59
750000 -- (-1051.319) [-1042.013] (-1046.067) (-1037.532) * (-1040.702) (-1049.510) [-1046.198] (-1049.727) -- 0:00:59
Average standard deviation of split frequencies: 0.005786
750500 -- (-1048.669) (-1048.393) [-1040.890] (-1044.503) * (-1045.451) [-1040.448] (-1042.263) (-1046.213) -- 0:00:58
751000 -- (-1049.760) [-1052.001] (-1054.610) (-1047.332) * (-1037.146) (-1057.563) (-1049.587) [-1050.819] -- 0:00:58
751500 -- (-1055.724) (-1058.130) [-1044.958] (-1056.500) * (-1049.799) [-1047.168] (-1042.141) (-1058.407) -- 0:00:58
752000 -- (-1048.419) (-1042.661) (-1051.565) [-1043.750] * (-1049.284) [-1039.941] (-1052.490) (-1052.219) -- 0:00:58
752500 -- (-1045.097) (-1046.315) (-1040.958) [-1038.187] * (-1044.002) (-1053.368) (-1041.540) [-1052.319] -- 0:00:58
753000 -- (-1052.273) (-1040.862) (-1049.865) [-1038.933] * [-1038.761] (-1056.380) (-1040.397) (-1045.337) -- 0:00:58
753500 -- (-1056.656) (-1051.602) (-1065.910) [-1038.443] * [-1038.446] (-1052.372) (-1045.340) (-1047.382) -- 0:00:58
754000 -- (-1049.860) (-1054.350) (-1057.303) [-1044.222] * [-1041.384] (-1042.540) (-1038.841) (-1056.411) -- 0:00:58
754500 -- [-1054.684] (-1047.434) (-1048.200) (-1051.331) * (-1050.304) (-1038.831) (-1048.874) [-1040.477] -- 0:00:57
755000 -- [-1040.523] (-1050.752) (-1045.064) (-1046.507) * [-1047.742] (-1070.321) (-1047.831) (-1053.943) -- 0:00:57
Average standard deviation of split frequencies: 0.005167
755500 -- (-1055.259) (-1061.822) (-1052.211) [-1035.639] * (-1050.978) [-1045.402] (-1053.059) (-1037.341) -- 0:00:57
756000 -- (-1043.299) [-1048.273] (-1053.198) (-1061.201) * (-1042.545) (-1043.212) (-1061.784) [-1035.843] -- 0:00:57
756500 -- (-1059.160) (-1073.316) [-1041.404] (-1050.438) * (-1041.039) (-1056.078) (-1048.856) [-1042.047] -- 0:00:57
757000 -- (-1059.936) [-1046.569] (-1054.836) (-1068.407) * (-1055.582) (-1048.342) (-1043.255) [-1038.596] -- 0:00:57
757500 -- (-1049.673) (-1041.555) (-1055.757) [-1047.682] * (-1055.428) (-1049.737) (-1042.860) [-1043.354] -- 0:00:57
758000 -- (-1050.672) [-1044.013] (-1052.465) (-1047.275) * (-1052.439) (-1056.965) (-1057.100) [-1038.268] -- 0:00:57
758500 -- [-1041.272] (-1032.877) (-1055.026) (-1049.141) * (-1047.921) [-1055.475] (-1063.802) (-1063.182) -- 0:00:56
759000 -- [-1037.546] (-1048.122) (-1046.479) (-1040.373) * (-1055.372) [-1041.843] (-1052.179) (-1060.714) -- 0:00:56
759500 -- (-1044.053) (-1041.406) [-1039.616] (-1056.975) * (-1069.115) [-1048.319] (-1054.752) (-1055.145) -- 0:00:56
760000 -- (-1058.671) [-1039.733] (-1050.278) (-1053.301) * (-1045.829) (-1060.834) [-1043.613] (-1050.090) -- 0:00:56
Average standard deviation of split frequencies: 0.005533
760500 -- (-1044.229) [-1035.300] (-1043.476) (-1067.117) * [-1049.662] (-1056.351) (-1049.295) (-1053.925) -- 0:00:56
761000 -- (-1053.887) [-1039.361] (-1054.243) (-1053.601) * (-1042.390) (-1059.853) [-1052.561] (-1045.589) -- 0:00:56
761500 -- (-1055.758) (-1059.442) (-1044.610) [-1047.326] * [-1046.159] (-1051.069) (-1057.567) (-1053.145) -- 0:00:56
762000 -- (-1060.937) (-1048.974) [-1052.307] (-1050.324) * (-1070.484) [-1044.104] (-1058.903) (-1049.801) -- 0:00:56
762500 -- (-1048.458) (-1043.454) (-1055.564) [-1050.142] * (-1062.986) (-1044.503) [-1038.035] (-1048.505) -- 0:00:56
763000 -- (-1059.652) (-1045.178) [-1045.519] (-1054.040) * (-1051.482) (-1052.934) (-1051.906) [-1035.149] -- 0:00:55
763500 -- (-1062.634) (-1048.013) (-1056.943) [-1035.787] * [-1041.367] (-1063.088) (-1041.248) (-1048.054) -- 0:00:55
764000 -- (-1054.427) (-1047.333) [-1043.987] (-1051.344) * (-1045.954) (-1061.424) [-1036.143] (-1053.297) -- 0:00:55
764500 -- (-1044.396) [-1043.238] (-1060.273) (-1049.364) * (-1053.412) (-1058.349) (-1046.936) [-1058.879] -- 0:00:55
765000 -- (-1053.018) (-1044.342) (-1058.070) [-1044.693] * [-1047.602] (-1050.086) (-1046.364) (-1045.353) -- 0:00:55
Average standard deviation of split frequencies: 0.006110
765500 -- (-1052.253) (-1048.247) [-1052.070] (-1046.134) * (-1045.620) [-1045.208] (-1044.914) (-1043.329) -- 0:00:55
766000 -- (-1052.718) [-1041.299] (-1043.639) (-1051.140) * (-1051.090) (-1046.251) (-1056.681) [-1050.526] -- 0:00:55
766500 -- (-1048.626) [-1041.445] (-1048.741) (-1058.332) * (-1066.766) [-1046.671] (-1049.211) (-1050.754) -- 0:00:55
767000 -- [-1046.425] (-1039.849) (-1046.814) (-1044.371) * (-1051.783) (-1048.771) [-1052.163] (-1053.879) -- 0:00:54
767500 -- (-1047.784) [-1036.337] (-1053.147) (-1049.289) * (-1057.541) (-1045.538) [-1043.683] (-1053.094) -- 0:00:54
768000 -- (-1047.460) [-1039.033] (-1036.251) (-1052.140) * (-1059.869) (-1039.375) (-1040.559) [-1046.969] -- 0:00:54
768500 -- [-1059.355] (-1046.629) (-1045.119) (-1061.954) * (-1057.972) (-1053.306) (-1042.442) [-1047.653] -- 0:00:54
769000 -- (-1054.020) (-1057.453) [-1049.389] (-1057.828) * (-1065.005) [-1045.009] (-1049.031) (-1056.593) -- 0:00:54
769500 -- [-1038.754] (-1046.562) (-1053.924) (-1040.437) * (-1052.079) (-1049.439) (-1056.022) [-1047.154] -- 0:00:54
770000 -- (-1046.270) (-1037.856) (-1052.420) [-1038.666] * (-1043.221) (-1065.685) (-1050.585) [-1045.252] -- 0:00:54
Average standard deviation of split frequencies: 0.005724
770500 -- (-1050.413) (-1056.952) [-1047.654] (-1041.176) * [-1047.670] (-1058.138) (-1050.307) (-1042.198) -- 0:00:54
771000 -- (-1040.374) (-1057.223) (-1037.318) [-1042.119] * (-1049.311) [-1050.632] (-1047.302) (-1046.666) -- 0:00:54
771500 -- (-1047.704) (-1055.696) (-1041.389) [-1038.562] * (-1045.708) (-1045.248) [-1039.723] (-1038.724) -- 0:00:53
772000 -- (-1053.059) (-1047.713) [-1048.089] (-1052.323) * (-1050.779) (-1046.976) [-1041.783] (-1039.825) -- 0:00:53
772500 -- (-1049.363) [-1046.649] (-1050.319) (-1046.398) * (-1047.652) [-1041.624] (-1060.287) (-1057.217) -- 0:00:53
773000 -- (-1045.538) [-1040.069] (-1050.466) (-1063.315) * (-1053.117) (-1057.183) (-1037.422) [-1038.832] -- 0:00:53
773500 -- (-1057.065) (-1050.074) [-1043.190] (-1065.411) * (-1050.473) (-1047.684) [-1046.494] (-1049.268) -- 0:00:53
774000 -- (-1059.223) [-1044.490] (-1054.184) (-1055.267) * [-1039.265] (-1060.065) (-1037.076) (-1055.947) -- 0:00:53
774500 -- [-1047.162] (-1049.826) (-1037.396) (-1043.275) * [-1039.952] (-1044.529) (-1052.244) (-1050.618) -- 0:00:53
775000 -- (-1042.479) (-1056.104) (-1040.108) [-1043.316] * [-1043.134] (-1056.277) (-1051.596) (-1048.081) -- 0:00:53
Average standard deviation of split frequencies: 0.005511
775500 -- [-1035.360] (-1066.013) (-1040.219) (-1062.202) * [-1052.827] (-1064.089) (-1049.346) (-1040.458) -- 0:00:52
776000 -- (-1051.365) (-1052.889) [-1038.005] (-1053.529) * [-1040.575] (-1070.538) (-1052.331) (-1039.276) -- 0:00:52
776500 -- (-1063.144) (-1057.722) (-1052.462) [-1041.500] * (-1042.236) (-1063.005) (-1052.619) [-1038.779] -- 0:00:52
777000 -- [-1042.945] (-1049.137) (-1047.442) (-1056.859) * (-1048.886) (-1044.375) [-1049.252] (-1044.924) -- 0:00:52
777500 -- (-1042.914) [-1052.359] (-1050.276) (-1041.320) * (-1050.180) [-1046.509] (-1043.333) (-1055.075) -- 0:00:52
778000 -- (-1050.485) (-1047.557) [-1041.083] (-1047.217) * (-1043.353) [-1056.409] (-1053.258) (-1046.304) -- 0:00:52
778500 -- (-1055.913) [-1037.560] (-1043.422) (-1054.215) * [-1036.140] (-1070.236) (-1057.380) (-1045.319) -- 0:00:52
779000 -- (-1058.464) [-1043.260] (-1046.698) (-1043.844) * (-1055.722) [-1046.530] (-1054.089) (-1051.363) -- 0:00:52
779500 -- (-1052.365) [-1046.245] (-1055.011) (-1052.319) * (-1060.985) [-1046.665] (-1060.285) (-1056.142) -- 0:00:52
780000 -- (-1052.845) [-1057.629] (-1046.708) (-1055.036) * (-1049.785) (-1054.383) (-1059.340) [-1046.246] -- 0:00:51
Average standard deviation of split frequencies: 0.005995
780500 -- (-1045.086) (-1037.134) [-1038.798] (-1050.139) * (-1043.709) [-1045.161] (-1046.858) (-1043.121) -- 0:00:51
781000 -- (-1046.196) (-1049.257) [-1050.345] (-1052.606) * (-1052.163) (-1046.312) (-1054.890) [-1041.953] -- 0:00:51
781500 -- (-1041.344) (-1048.100) [-1037.991] (-1043.533) * [-1038.269] (-1055.439) (-1048.442) (-1045.006) -- 0:00:51
782000 -- (-1035.141) (-1070.623) [-1063.105] (-1042.090) * (-1036.343) (-1055.840) (-1047.582) [-1039.132] -- 0:00:51
782500 -- (-1042.797) (-1053.313) [-1041.560] (-1056.009) * [-1034.537] (-1051.216) (-1050.443) (-1051.873) -- 0:00:51
783000 -- (-1064.597) (-1043.121) [-1043.334] (-1043.325) * [-1040.750] (-1054.480) (-1058.096) (-1041.281) -- 0:00:51
783500 -- [-1052.923] (-1046.197) (-1044.959) (-1045.859) * (-1044.847) [-1048.889] (-1054.750) (-1049.400) -- 0:00:51
784000 -- (-1043.666) (-1036.642) (-1045.025) [-1045.424] * [-1048.909] (-1050.962) (-1058.018) (-1046.623) -- 0:00:50
784500 -- (-1050.614) [-1038.429] (-1048.010) (-1049.339) * (-1048.190) (-1050.865) (-1060.902) [-1050.259] -- 0:00:50
785000 -- (-1056.359) [-1048.738] (-1047.766) (-1039.499) * [-1044.583] (-1046.186) (-1057.806) (-1059.849) -- 0:00:50
Average standard deviation of split frequencies: 0.006040
785500 -- [-1042.039] (-1045.304) (-1057.268) (-1058.040) * (-1047.622) [-1045.180] (-1063.977) (-1045.410) -- 0:00:50
786000 -- (-1051.108) (-1062.524) (-1052.526) [-1049.584] * [-1037.384] (-1043.073) (-1049.974) (-1055.907) -- 0:00:50
786500 -- (-1037.210) (-1044.118) (-1074.191) [-1049.145] * (-1036.846) (-1046.472) [-1048.670] (-1045.589) -- 0:00:50
787000 -- (-1046.653) [-1039.540] (-1050.925) (-1050.085) * (-1056.518) (-1040.037) [-1052.228] (-1051.738) -- 0:00:50
787500 -- (-1041.785) (-1047.599) (-1067.116) [-1046.880] * (-1052.192) [-1036.010] (-1043.267) (-1046.482) -- 0:00:50
788000 -- (-1053.051) (-1041.686) (-1059.524) [-1043.996] * (-1044.739) (-1046.424) [-1048.527] (-1037.645) -- 0:00:50
788500 -- [-1046.186] (-1050.680) (-1045.507) (-1044.728) * [-1041.088] (-1042.112) (-1057.863) (-1042.611) -- 0:00:49
789000 -- (-1048.152) (-1048.298) (-1056.492) [-1044.435] * (-1039.817) (-1053.667) (-1058.233) [-1048.343] -- 0:00:49
789500 -- (-1055.311) [-1037.945] (-1053.569) (-1044.213) * (-1037.811) (-1049.820) [-1044.375] (-1044.657) -- 0:00:49
790000 -- (-1045.665) [-1034.974] (-1048.986) (-1052.416) * (-1034.350) (-1064.635) [-1047.269] (-1049.270) -- 0:00:49
Average standard deviation of split frequencies: 0.005877
790500 -- (-1041.836) [-1047.217] (-1045.733) (-1047.646) * [-1037.879] (-1048.434) (-1043.902) (-1045.098) -- 0:00:49
791000 -- (-1042.772) [-1044.522] (-1053.366) (-1069.196) * (-1054.526) [-1044.396] (-1049.579) (-1037.091) -- 0:00:49
791500 -- [-1042.337] (-1054.391) (-1052.421) (-1060.836) * (-1049.450) (-1047.671) [-1038.962] (-1046.908) -- 0:00:49
792000 -- [-1043.449] (-1068.177) (-1044.187) (-1046.016) * (-1054.474) (-1049.017) [-1051.392] (-1047.346) -- 0:00:49
792500 -- [-1044.822] (-1058.118) (-1039.874) (-1046.336) * (-1038.702) (-1046.864) [-1042.893] (-1046.962) -- 0:00:48
793000 -- (-1053.574) (-1053.073) [-1038.635] (-1050.016) * (-1040.986) (-1055.243) (-1043.411) [-1051.459] -- 0:00:48
793500 -- (-1045.029) (-1063.738) [-1041.910] (-1055.095) * (-1042.067) [-1045.022] (-1043.992) (-1045.487) -- 0:00:48
794000 -- [-1042.489] (-1052.254) (-1044.918) (-1045.093) * (-1047.456) (-1052.215) [-1039.050] (-1048.679) -- 0:00:48
794500 -- (-1064.084) [-1047.265] (-1048.035) (-1040.612) * [-1049.136] (-1046.712) (-1057.349) (-1047.431) -- 0:00:48
795000 -- (-1061.137) (-1051.707) [-1042.544] (-1052.276) * (-1047.217) [-1037.979] (-1039.952) (-1046.894) -- 0:00:48
Average standard deviation of split frequencies: 0.006091
795500 -- (-1065.895) (-1062.958) (-1045.626) [-1043.189] * (-1045.118) (-1055.485) (-1065.381) [-1045.851] -- 0:00:48
796000 -- (-1061.660) (-1052.815) (-1044.253) [-1039.464] * (-1048.378) (-1054.976) [-1044.954] (-1055.196) -- 0:00:48
796500 -- [-1044.597] (-1048.249) (-1050.426) (-1049.565) * [-1045.996] (-1050.186) (-1058.959) (-1055.181) -- 0:00:48
797000 -- (-1051.976) (-1061.240) [-1045.691] (-1047.531) * (-1037.216) (-1053.174) (-1061.240) [-1048.687] -- 0:00:47
797500 -- (-1044.678) [-1051.874] (-1052.665) (-1048.875) * [-1036.395] (-1054.490) (-1065.278) (-1043.030) -- 0:00:47
798000 -- (-1045.797) (-1057.401) (-1052.938) [-1046.852] * (-1051.341) [-1043.249] (-1063.516) (-1039.029) -- 0:00:47
798500 -- (-1051.271) (-1053.358) (-1059.259) [-1039.375] * (-1047.941) [-1040.499] (-1063.709) (-1051.473) -- 0:00:47
799000 -- (-1059.869) (-1061.382) (-1037.321) [-1051.120] * (-1045.637) (-1048.258) (-1082.444) [-1041.730] -- 0:00:47
799500 -- (-1045.718) (-1055.442) (-1050.851) [-1041.972] * [-1043.336] (-1053.566) (-1082.852) (-1054.273) -- 0:00:47
800000 -- (-1052.511) [-1048.460] (-1040.232) (-1055.070) * [-1035.414] (-1049.976) (-1066.292) (-1042.207) -- 0:00:47
Average standard deviation of split frequencies: 0.006771
800500 -- (-1056.475) (-1063.630) (-1049.610) [-1035.282] * (-1043.321) [-1047.924] (-1056.574) (-1044.224) -- 0:00:47
801000 -- (-1051.057) (-1056.100) (-1048.925) [-1041.655] * (-1043.329) (-1034.867) [-1047.685] (-1046.903) -- 0:00:46
801500 -- (-1051.464) (-1064.872) (-1045.060) [-1043.172] * (-1047.305) [-1043.928] (-1056.119) (-1041.295) -- 0:00:46
802000 -- [-1040.732] (-1056.602) (-1041.944) (-1048.259) * (-1051.968) (-1039.975) [-1038.346] (-1058.145) -- 0:00:46
802500 -- (-1053.051) [-1033.003] (-1043.168) (-1051.723) * [-1042.280] (-1047.504) (-1039.049) (-1045.039) -- 0:00:46
803000 -- (-1064.714) [-1035.900] (-1038.005) (-1049.291) * [-1046.550] (-1052.383) (-1054.582) (-1058.659) -- 0:00:46
803500 -- (-1053.098) [-1032.268] (-1049.150) (-1046.361) * (-1039.906) (-1048.797) [-1038.332] (-1054.866) -- 0:00:46
804000 -- [-1047.027] (-1051.071) (-1057.227) (-1035.195) * (-1050.120) (-1045.136) [-1042.126] (-1050.482) -- 0:00:46
804500 -- [-1040.516] (-1060.379) (-1037.316) (-1037.775) * (-1052.936) (-1056.518) (-1044.533) [-1051.301] -- 0:00:46
805000 -- (-1041.223) (-1050.775) (-1045.126) [-1035.549] * (-1054.806) (-1045.063) [-1033.489] (-1057.931) -- 0:00:46
Average standard deviation of split frequencies: 0.007018
805500 -- (-1049.074) (-1045.518) (-1048.729) [-1042.207] * (-1051.200) (-1047.386) (-1041.877) [-1050.789] -- 0:00:45
806000 -- (-1056.968) (-1048.774) [-1050.584] (-1046.782) * (-1052.566) (-1068.874) [-1041.014] (-1061.950) -- 0:00:45
806500 -- (-1068.664) (-1046.969) [-1048.604] (-1049.297) * (-1052.056) (-1057.735) [-1046.431] (-1043.371) -- 0:00:45
807000 -- (-1062.520) (-1053.234) (-1051.112) [-1043.583] * (-1036.473) (-1069.144) (-1046.953) [-1041.927] -- 0:00:45
807500 -- (-1050.482) [-1041.804] (-1041.042) (-1041.322) * (-1048.653) (-1067.617) [-1043.849] (-1036.747) -- 0:00:45
808000 -- (-1059.374) [-1043.776] (-1051.211) (-1056.117) * (-1065.183) (-1043.118) [-1058.040] (-1036.867) -- 0:00:45
808500 -- (-1067.021) (-1052.274) [-1040.415] (-1053.070) * (-1063.705) [-1044.064] (-1039.328) (-1042.945) -- 0:00:45
809000 -- (-1045.199) (-1044.844) [-1043.873] (-1035.294) * (-1052.797) [-1049.535] (-1051.149) (-1050.560) -- 0:00:45
809500 -- (-1059.821) (-1044.959) (-1050.216) [-1043.957] * (-1043.703) [-1043.489] (-1042.903) (-1052.263) -- 0:00:44
810000 -- (-1038.808) (-1054.779) [-1036.477] (-1052.787) * [-1048.896] (-1047.041) (-1051.813) (-1051.577) -- 0:00:44
Average standard deviation of split frequencies: 0.007144
810500 -- [-1046.790] (-1042.259) (-1042.607) (-1054.051) * [-1051.480] (-1054.882) (-1048.184) (-1051.490) -- 0:00:44
811000 -- (-1037.537) (-1048.146) [-1033.881] (-1038.155) * (-1043.748) [-1044.925] (-1048.448) (-1063.961) -- 0:00:44
811500 -- (-1049.554) (-1043.998) (-1058.526) [-1033.043] * [-1043.610] (-1051.917) (-1046.291) (-1065.492) -- 0:00:44
812000 -- (-1044.804) (-1055.177) [-1042.455] (-1047.407) * (-1041.984) (-1037.223) (-1034.701) [-1049.625] -- 0:00:44
812500 -- (-1037.600) [-1046.152] (-1034.932) (-1056.401) * [-1037.501] (-1039.301) (-1043.568) (-1069.244) -- 0:00:44
813000 -- [-1044.193] (-1041.918) (-1052.547) (-1054.023) * (-1044.151) [-1047.695] (-1054.975) (-1068.390) -- 0:00:44
813500 -- [-1039.877] (-1046.229) (-1057.820) (-1049.742) * (-1042.371) (-1051.127) [-1044.123] (-1061.169) -- 0:00:44
814000 -- (-1050.246) [-1032.848] (-1057.226) (-1049.370) * (-1045.627) (-1050.923) (-1037.663) [-1054.301] -- 0:00:43
814500 -- (-1037.749) [-1044.732] (-1047.114) (-1057.554) * (-1045.551) (-1056.306) [-1044.493] (-1047.190) -- 0:00:43
815000 -- (-1048.216) (-1073.530) (-1045.800) [-1037.063] * (-1040.586) (-1048.175) [-1037.678] (-1047.092) -- 0:00:43
Average standard deviation of split frequencies: 0.006891
815500 -- (-1058.574) [-1040.031] (-1052.104) (-1052.022) * (-1058.262) (-1047.132) [-1042.701] (-1056.811) -- 0:00:43
816000 -- (-1049.915) (-1049.403) [-1047.993] (-1055.919) * (-1052.245) (-1045.584) (-1051.314) [-1044.916] -- 0:00:43
816500 -- (-1044.982) (-1043.458) [-1037.724] (-1049.959) * (-1056.877) (-1043.788) (-1041.410) [-1039.100] -- 0:00:43
817000 -- (-1059.750) (-1035.350) [-1050.479] (-1056.410) * (-1049.781) (-1056.009) (-1034.828) [-1048.350] -- 0:00:43
817500 -- (-1066.574) [-1044.088] (-1047.678) (-1059.353) * [-1047.181] (-1041.491) (-1057.468) (-1045.196) -- 0:00:43
818000 -- (-1052.537) (-1047.715) [-1039.752] (-1054.558) * (-1047.001) (-1068.842) (-1051.708) [-1042.622] -- 0:00:42
818500 -- (-1067.432) (-1044.766) [-1039.270] (-1057.440) * (-1046.579) (-1050.482) (-1045.582) [-1049.050] -- 0:00:42
819000 -- (-1051.097) (-1053.755) [-1044.268] (-1063.458) * (-1043.062) (-1053.253) (-1044.349) [-1040.318] -- 0:00:42
819500 -- (-1056.852) [-1036.200] (-1057.840) (-1057.507) * (-1044.053) (-1041.721) (-1045.074) [-1045.677] -- 0:00:42
820000 -- (-1060.694) [-1045.342] (-1041.904) (-1051.319) * [-1041.167] (-1041.829) (-1044.986) (-1041.448) -- 0:00:42
Average standard deviation of split frequencies: 0.007057
820500 -- [-1045.157] (-1037.644) (-1044.597) (-1058.721) * (-1046.723) (-1049.788) [-1046.633] (-1058.313) -- 0:00:42
821000 -- (-1050.790) [-1040.931] (-1058.715) (-1053.034) * (-1049.925) (-1058.109) (-1038.115) [-1047.884] -- 0:00:42
821500 -- (-1048.708) [-1045.793] (-1053.088) (-1047.608) * (-1043.679) [-1047.195] (-1040.835) (-1046.343) -- 0:00:42
822000 -- (-1052.790) (-1042.758) (-1061.651) [-1043.884] * [-1046.646] (-1042.705) (-1050.191) (-1045.182) -- 0:00:42
822500 -- (-1054.857) (-1038.456) [-1056.049] (-1042.806) * [-1049.553] (-1050.260) (-1039.992) (-1046.678) -- 0:00:41
823000 -- (-1057.120) (-1046.292) (-1045.874) [-1048.861] * (-1044.841) [-1042.916] (-1047.110) (-1042.514) -- 0:00:41
823500 -- [-1041.171] (-1049.832) (-1049.583) (-1049.821) * (-1034.692) (-1057.769) (-1050.440) [-1038.109] -- 0:00:41
824000 -- (-1047.358) [-1040.418] (-1049.158) (-1061.174) * (-1048.219) (-1052.037) (-1039.767) [-1037.193] -- 0:00:41
824500 -- (-1050.040) (-1045.365) (-1038.739) [-1038.839] * (-1032.649) [-1044.507] (-1046.475) (-1041.175) -- 0:00:41
825000 -- (-1053.608) (-1047.290) (-1048.530) [-1046.262] * [-1042.127] (-1052.116) (-1054.635) (-1059.431) -- 0:00:41
Average standard deviation of split frequencies: 0.007134
825500 -- [-1043.070] (-1052.267) (-1051.901) (-1042.178) * (-1041.301) (-1039.809) (-1057.963) [-1040.438] -- 0:00:41
826000 -- (-1050.391) (-1058.276) (-1057.532) [-1040.174] * [-1045.487] (-1034.515) (-1062.686) (-1043.777) -- 0:00:41
826500 -- [-1044.190] (-1041.579) (-1055.456) (-1054.991) * (-1049.381) [-1049.633] (-1051.994) (-1048.140) -- 0:00:40
827000 -- (-1048.467) [-1051.376] (-1046.388) (-1046.687) * (-1051.037) [-1039.914] (-1044.349) (-1043.501) -- 0:00:40
827500 -- (-1055.786) (-1048.941) (-1058.038) [-1055.182] * (-1068.664) [-1046.993] (-1062.162) (-1046.835) -- 0:00:40
828000 -- (-1039.092) [-1039.296] (-1061.083) (-1044.086) * (-1054.871) [-1042.334] (-1057.454) (-1039.515) -- 0:00:40
828500 -- (-1037.904) (-1051.386) [-1040.777] (-1036.888) * [-1047.736] (-1056.379) (-1060.306) (-1045.973) -- 0:00:40
829000 -- (-1051.365) [-1054.110] (-1041.216) (-1042.406) * (-1051.662) (-1047.203) (-1044.190) [-1043.610] -- 0:00:40
829500 -- (-1058.263) (-1047.680) [-1038.999] (-1049.041) * (-1042.674) (-1047.728) (-1049.387) [-1048.374] -- 0:00:40
830000 -- (-1053.224) (-1046.279) (-1053.610) [-1033.618] * (-1039.042) (-1042.461) [-1044.662] (-1053.431) -- 0:00:40
Average standard deviation of split frequencies: 0.007540
830500 -- (-1039.529) (-1047.003) (-1041.280) [-1054.099] * [-1041.317] (-1055.732) (-1042.892) (-1053.163) -- 0:00:40
831000 -- (-1058.430) (-1062.257) [-1046.582] (-1051.136) * (-1034.458) (-1035.271) (-1051.423) [-1053.870] -- 0:00:39
831500 -- [-1042.963] (-1042.923) (-1048.738) (-1050.902) * [-1042.335] (-1037.789) (-1045.643) (-1058.455) -- 0:00:39
832000 -- (-1049.743) [-1037.031] (-1052.156) (-1054.084) * (-1037.705) (-1047.581) (-1054.835) [-1049.684] -- 0:00:39
832500 -- (-1053.003) [-1041.150] (-1062.828) (-1046.414) * (-1047.303) (-1042.794) (-1039.949) [-1046.034] -- 0:00:39
833000 -- (-1040.869) (-1051.209) (-1053.927) [-1042.029] * (-1057.118) (-1053.388) [-1046.479] (-1046.180) -- 0:00:39
833500 -- (-1051.828) [-1037.011] (-1058.789) (-1040.816) * (-1051.408) (-1049.220) [-1043.750] (-1052.238) -- 0:00:39
834000 -- (-1053.340) (-1043.930) (-1058.353) [-1044.513] * [-1046.519] (-1045.921) (-1040.306) (-1047.346) -- 0:00:39
834500 -- (-1052.207) [-1042.822] (-1055.862) (-1049.875) * (-1049.674) [-1041.844] (-1044.413) (-1045.298) -- 0:00:39
835000 -- [-1051.011] (-1043.318) (-1052.779) (-1056.775) * (-1053.374) (-1039.096) (-1050.236) [-1038.825] -- 0:00:38
Average standard deviation of split frequencies: 0.007411
835500 -- [-1036.591] (-1043.744) (-1056.529) (-1047.248) * [-1046.348] (-1048.155) (-1044.763) (-1043.941) -- 0:00:38
836000 -- (-1043.523) [-1042.596] (-1040.307) (-1046.275) * [-1044.893] (-1055.126) (-1061.887) (-1039.452) -- 0:00:38
836500 -- (-1058.609) [-1039.746] (-1045.944) (-1057.013) * (-1054.545) [-1052.479] (-1052.424) (-1034.937) -- 0:00:38
837000 -- [-1049.133] (-1040.870) (-1059.204) (-1036.657) * (-1044.048) (-1046.816) (-1052.567) [-1035.693] -- 0:00:38
837500 -- (-1044.139) (-1037.861) [-1038.963] (-1037.809) * (-1057.583) [-1039.875] (-1049.779) (-1044.965) -- 0:00:38
838000 -- (-1037.549) (-1041.099) [-1042.912] (-1050.594) * (-1062.823) [-1040.334] (-1046.514) (-1052.251) -- 0:00:38
838500 -- [-1037.054] (-1040.529) (-1043.115) (-1049.454) * (-1053.420) (-1044.991) (-1057.926) [-1040.244] -- 0:00:38
839000 -- (-1044.436) [-1044.892] (-1055.843) (-1047.568) * (-1065.766) (-1056.520) (-1050.192) [-1052.077] -- 0:00:37
839500 -- (-1066.013) (-1047.717) (-1052.324) [-1043.447] * (-1058.626) (-1054.702) [-1037.725] (-1057.829) -- 0:00:37
840000 -- (-1058.317) (-1052.780) (-1049.981) [-1043.973] * (-1037.509) (-1052.388) (-1042.655) [-1058.379] -- 0:00:37
Average standard deviation of split frequencies: 0.007410
840500 -- (-1073.341) (-1042.081) (-1064.809) [-1045.352] * [-1049.872] (-1039.474) (-1042.234) (-1053.980) -- 0:00:37
841000 -- (-1054.584) (-1040.627) (-1060.489) [-1043.624] * [-1053.868] (-1047.924) (-1042.079) (-1053.408) -- 0:00:37
841500 -- [-1039.097] (-1035.807) (-1050.882) (-1045.142) * (-1049.549) (-1052.580) (-1046.664) [-1045.092] -- 0:00:37
842000 -- [-1044.365] (-1048.685) (-1044.087) (-1048.536) * [-1050.743] (-1041.852) (-1037.476) (-1054.258) -- 0:00:37
842500 -- [-1038.960] (-1056.836) (-1042.037) (-1059.057) * [-1046.314] (-1049.069) (-1043.469) (-1035.837) -- 0:00:37
843000 -- (-1039.708) (-1048.650) [-1039.315] (-1059.185) * (-1048.272) (-1048.245) (-1066.924) [-1040.397] -- 0:00:37
843500 -- (-1046.581) (-1057.775) (-1047.999) [-1034.150] * (-1054.413) [-1044.382] (-1045.279) (-1049.558) -- 0:00:36
844000 -- (-1049.577) (-1042.362) [-1039.622] (-1047.949) * (-1057.362) (-1041.660) (-1039.819) [-1037.861] -- 0:00:36
844500 -- (-1044.371) [-1039.322] (-1043.234) (-1044.486) * (-1059.746) (-1051.867) [-1041.850] (-1045.086) -- 0:00:36
845000 -- [-1046.512] (-1049.963) (-1043.958) (-1048.193) * (-1043.384) (-1052.010) [-1046.980] (-1044.161) -- 0:00:36
Average standard deviation of split frequencies: 0.007721
845500 -- (-1050.429) (-1065.020) [-1042.384] (-1042.010) * (-1040.584) [-1042.518] (-1052.797) (-1048.388) -- 0:00:36
846000 -- (-1062.519) (-1042.376) (-1038.615) [-1044.887] * (-1042.706) (-1047.255) [-1037.644] (-1044.032) -- 0:00:36
846500 -- (-1048.609) (-1045.822) [-1045.866] (-1052.175) * (-1056.105) [-1040.089] (-1061.753) (-1042.924) -- 0:00:36
847000 -- (-1052.785) (-1056.733) [-1038.829] (-1051.730) * (-1051.059) [-1047.576] (-1055.809) (-1049.441) -- 0:00:36
847500 -- (-1048.448) [-1050.023] (-1044.320) (-1052.325) * (-1048.505) [-1042.631] (-1053.948) (-1048.543) -- 0:00:35
848000 -- (-1048.172) [-1043.811] (-1044.294) (-1039.036) * [-1043.742] (-1041.338) (-1045.666) (-1055.530) -- 0:00:35
848500 -- (-1052.032) [-1036.771] (-1047.529) (-1051.996) * (-1055.457) (-1038.592) [-1046.805] (-1060.490) -- 0:00:35
849000 -- (-1053.183) (-1040.180) (-1034.931) [-1040.951] * (-1050.734) (-1048.570) [-1051.456] (-1051.684) -- 0:00:35
849500 -- (-1037.654) (-1039.953) (-1045.986) [-1033.472] * [-1040.811] (-1050.252) (-1044.479) (-1046.870) -- 0:00:35
850000 -- (-1042.887) (-1066.050) [-1038.249] (-1050.552) * (-1045.871) [-1055.036] (-1056.084) (-1045.836) -- 0:00:35
Average standard deviation of split frequencies: 0.007362
850500 -- (-1056.942) (-1054.694) (-1049.907) [-1041.953] * (-1049.218) [-1045.337] (-1048.680) (-1054.001) -- 0:00:35
851000 -- (-1057.350) (-1047.703) [-1049.860] (-1045.053) * (-1049.026) (-1045.725) [-1046.323] (-1035.957) -- 0:00:35
851500 -- [-1047.456] (-1052.678) (-1054.593) (-1049.568) * [-1039.652] (-1040.622) (-1040.366) (-1049.397) -- 0:00:35
852000 -- [-1035.466] (-1056.077) (-1045.786) (-1053.200) * (-1058.804) (-1041.326) (-1053.266) [-1049.548] -- 0:00:34
852500 -- (-1046.870) (-1059.188) [-1047.638] (-1040.702) * (-1049.206) [-1040.865] (-1040.110) (-1065.782) -- 0:00:34
853000 -- [-1042.917] (-1052.400) (-1038.120) (-1036.537) * (-1046.605) [-1047.175] (-1046.125) (-1058.561) -- 0:00:34
853500 -- [-1037.308] (-1041.302) (-1063.881) (-1048.185) * (-1049.430) (-1049.170) (-1053.758) [-1042.165] -- 0:00:34
854000 -- (-1045.304) (-1054.069) [-1038.215] (-1046.635) * (-1046.617) (-1060.634) (-1056.230) [-1051.434] -- 0:00:34
854500 -- [-1043.960] (-1045.310) (-1050.112) (-1052.254) * (-1045.281) [-1045.101] (-1063.389) (-1061.136) -- 0:00:34
855000 -- (-1045.030) (-1052.656) [-1036.164] (-1037.498) * [-1041.673] (-1048.419) (-1050.636) (-1051.542) -- 0:00:34
Average standard deviation of split frequencies: 0.007277
855500 -- (-1059.280) [-1050.870] (-1048.779) (-1055.317) * (-1051.621) (-1054.869) [-1041.115] (-1049.880) -- 0:00:34
856000 -- (-1042.558) (-1042.994) [-1042.525] (-1042.537) * (-1058.647) [-1047.666] (-1062.426) (-1054.358) -- 0:00:33
856500 -- (-1041.625) [-1041.572] (-1063.307) (-1050.877) * (-1045.669) (-1050.972) [-1051.277] (-1045.752) -- 0:00:33
857000 -- (-1048.290) (-1045.173) (-1048.482) [-1055.595] * [-1037.832] (-1043.994) (-1051.081) (-1040.027) -- 0:00:33
857500 -- (-1035.647) (-1047.571) (-1041.216) [-1036.662] * (-1037.808) [-1040.131] (-1048.099) (-1058.315) -- 0:00:33
858000 -- [-1047.489] (-1032.588) (-1040.101) (-1058.271) * (-1041.992) [-1046.533] (-1043.308) (-1069.501) -- 0:00:33
858500 -- (-1044.379) (-1047.151) [-1033.866] (-1041.643) * (-1054.212) (-1051.529) (-1049.043) [-1043.374] -- 0:00:33
859000 -- [-1039.934] (-1042.156) (-1046.203) (-1053.379) * (-1044.975) (-1060.034) [-1048.001] (-1047.713) -- 0:00:33
859500 -- [-1033.851] (-1039.110) (-1060.931) (-1045.324) * (-1040.519) [-1046.504] (-1046.793) (-1053.957) -- 0:00:33
860000 -- (-1045.036) [-1037.536] (-1054.410) (-1037.386) * (-1048.720) [-1037.815] (-1042.942) (-1052.727) -- 0:00:33
Average standard deviation of split frequencies: 0.007238
860500 -- (-1042.443) (-1054.553) [-1041.418] (-1045.889) * (-1051.447) [-1042.892] (-1049.697) (-1060.371) -- 0:00:32
861000 -- (-1047.022) (-1042.268) (-1037.648) [-1043.609] * [-1037.513] (-1053.127) (-1060.072) (-1052.184) -- 0:00:32
861500 -- (-1046.958) [-1044.388] (-1042.620) (-1042.156) * (-1053.300) (-1053.054) [-1042.281] (-1055.683) -- 0:00:32
862000 -- (-1049.026) (-1036.030) [-1039.025] (-1062.185) * [-1046.177] (-1058.830) (-1042.603) (-1049.025) -- 0:00:32
862500 -- [-1046.813] (-1053.158) (-1043.438) (-1040.515) * (-1052.763) (-1047.465) [-1041.982] (-1060.102) -- 0:00:32
863000 -- [-1042.231] (-1051.287) (-1041.376) (-1049.166) * (-1051.187) [-1050.108] (-1038.279) (-1053.354) -- 0:00:32
863500 -- (-1051.138) (-1055.087) (-1057.658) [-1046.475] * [-1043.198] (-1056.079) (-1049.742) (-1056.279) -- 0:00:32
864000 -- [-1033.511] (-1041.830) (-1043.068) (-1047.543) * (-1041.359) [-1041.605] (-1047.860) (-1049.321) -- 0:00:32
864500 -- [-1041.565] (-1044.184) (-1048.264) (-1046.602) * (-1047.714) [-1053.418] (-1044.909) (-1042.233) -- 0:00:31
865000 -- [-1042.222] (-1035.450) (-1040.827) (-1051.475) * (-1045.958) [-1035.111] (-1046.305) (-1051.979) -- 0:00:31
Average standard deviation of split frequencies: 0.007077
865500 -- (-1041.009) (-1042.458) (-1061.218) [-1036.852] * [-1050.422] (-1049.490) (-1053.728) (-1047.784) -- 0:00:31
866000 -- (-1042.762) [-1045.130] (-1048.828) (-1034.866) * [-1045.606] (-1051.323) (-1046.365) (-1044.732) -- 0:00:31
866500 -- (-1073.230) [-1042.045] (-1059.524) (-1046.481) * (-1037.600) [-1046.634] (-1051.616) (-1052.259) -- 0:00:31
867000 -- (-1053.113) (-1040.786) [-1045.671] (-1064.094) * (-1048.825) [-1048.425] (-1049.549) (-1051.277) -- 0:00:31
867500 -- (-1049.344) [-1054.748] (-1055.025) (-1043.583) * (-1056.790) (-1036.534) (-1054.246) [-1049.287] -- 0:00:31
868000 -- (-1040.393) (-1055.833) [-1043.754] (-1036.656) * (-1042.693) [-1040.432] (-1044.900) (-1047.502) -- 0:00:31
868500 -- (-1042.643) (-1047.523) (-1053.377) [-1050.188] * (-1040.744) (-1050.897) [-1042.062] (-1044.830) -- 0:00:31
869000 -- (-1052.222) (-1054.299) (-1045.194) [-1035.593] * (-1049.984) [-1038.153] (-1051.921) (-1050.061) -- 0:00:30
869500 -- (-1040.581) (-1053.017) (-1046.314) [-1038.964] * (-1052.403) (-1041.419) (-1047.960) [-1043.536] -- 0:00:30
870000 -- (-1067.175) [-1032.186] (-1042.941) (-1055.644) * [-1042.354] (-1042.296) (-1055.394) (-1056.072) -- 0:00:30
Average standard deviation of split frequencies: 0.007039
870500 -- (-1044.587) [-1041.938] (-1051.291) (-1044.787) * (-1046.270) (-1059.963) (-1050.338) [-1048.110] -- 0:00:30
871000 -- (-1047.608) (-1041.256) [-1050.480] (-1036.905) * (-1044.560) (-1047.616) [-1042.585] (-1049.885) -- 0:00:30
871500 -- [-1052.864] (-1043.923) (-1051.645) (-1055.830) * (-1038.747) (-1045.145) [-1045.485] (-1043.151) -- 0:00:30
872000 -- (-1049.212) (-1045.834) [-1044.655] (-1062.620) * (-1050.672) (-1056.612) [-1043.793] (-1041.489) -- 0:00:30
872500 -- (-1047.612) [-1036.259] (-1049.855) (-1044.768) * (-1057.512) (-1038.477) (-1064.360) [-1039.671] -- 0:00:30
873000 -- (-1053.015) [-1048.863] (-1040.119) (-1060.344) * [-1042.833] (-1055.683) (-1052.282) (-1048.583) -- 0:00:29
873500 -- [-1043.103] (-1053.170) (-1048.184) (-1043.335) * (-1045.269) (-1046.423) (-1050.988) [-1042.714] -- 0:00:29
874000 -- (-1047.616) (-1051.134) (-1045.886) [-1046.703] * (-1047.349) (-1056.330) (-1050.628) [-1046.844] -- 0:00:29
874500 -- (-1052.527) (-1049.164) [-1044.027] (-1046.059) * (-1042.393) (-1060.961) [-1038.781] (-1049.159) -- 0:00:29
875000 -- (-1042.517) (-1040.515) [-1038.393] (-1071.991) * [-1046.229] (-1050.513) (-1047.263) (-1045.336) -- 0:00:29
Average standard deviation of split frequencies: 0.006611
875500 -- (-1048.980) [-1044.549] (-1044.529) (-1046.566) * (-1052.053) (-1048.735) (-1065.405) [-1037.363] -- 0:00:29
876000 -- (-1060.628) (-1045.399) (-1047.239) [-1048.422] * (-1046.490) [-1042.156] (-1058.953) (-1037.390) -- 0:00:29
876500 -- (-1061.461) (-1048.356) (-1062.166) [-1039.665] * [-1036.541] (-1053.338) (-1053.459) (-1037.720) -- 0:00:29
877000 -- (-1050.362) (-1041.520) (-1059.444) [-1053.015] * [-1034.983] (-1040.769) (-1053.620) (-1047.891) -- 0:00:29
877500 -- [-1046.994] (-1049.552) (-1045.305) (-1046.343) * (-1044.982) [-1038.480] (-1044.148) (-1038.650) -- 0:00:28
878000 -- (-1051.791) (-1044.511) [-1043.460] (-1051.978) * (-1040.721) [-1039.514] (-1044.654) (-1049.061) -- 0:00:28
878500 -- (-1048.669) (-1048.116) [-1041.839] (-1042.144) * (-1047.002) (-1045.663) [-1048.322] (-1056.624) -- 0:00:28
879000 -- (-1047.207) [-1048.606] (-1061.409) (-1057.084) * (-1050.727) (-1052.371) [-1046.853] (-1046.065) -- 0:00:28
879500 -- (-1055.834) [-1039.800] (-1060.466) (-1053.041) * (-1046.094) [-1042.949] (-1046.093) (-1061.678) -- 0:00:28
880000 -- (-1053.959) (-1046.621) [-1042.647] (-1059.699) * (-1059.550) [-1042.798] (-1056.876) (-1038.748) -- 0:00:28
Average standard deviation of split frequencies: 0.006997
880500 -- (-1048.012) [-1050.151] (-1047.198) (-1046.210) * [-1040.381] (-1060.569) (-1043.788) (-1050.081) -- 0:00:28
881000 -- (-1070.568) (-1054.492) [-1047.585] (-1044.639) * (-1038.499) (-1047.185) (-1039.062) [-1045.044] -- 0:00:28
881500 -- (-1051.517) (-1042.998) [-1046.030] (-1052.860) * (-1049.403) (-1050.966) [-1044.642] (-1042.201) -- 0:00:27
882000 -- (-1040.603) [-1041.073] (-1060.798) (-1052.880) * (-1051.121) (-1046.183) [-1041.002] (-1049.958) -- 0:00:27
882500 -- (-1055.049) (-1051.703) (-1058.221) [-1042.084] * (-1052.289) (-1039.155) [-1044.656] (-1042.267) -- 0:00:27
883000 -- (-1055.239) (-1054.304) [-1049.421] (-1063.284) * [-1053.599] (-1041.866) (-1052.756) (-1044.703) -- 0:00:27
883500 -- (-1043.577) (-1040.569) (-1043.351) [-1043.969] * (-1052.612) (-1059.740) [-1052.819] (-1040.706) -- 0:00:27
884000 -- [-1048.154] (-1042.860) (-1042.713) (-1045.556) * (-1048.186) [-1046.324] (-1053.586) (-1039.209) -- 0:00:27
884500 -- (-1055.508) (-1046.075) (-1042.382) [-1042.642] * (-1046.998) (-1041.477) (-1056.030) [-1045.879] -- 0:00:27
885000 -- (-1045.987) [-1050.694] (-1045.449) (-1039.199) * (-1043.121) [-1038.159] (-1051.738) (-1048.209) -- 0:00:27
Average standard deviation of split frequencies: 0.007183
885500 -- [-1041.580] (-1039.803) (-1045.139) (-1048.978) * [-1043.304] (-1043.080) (-1052.055) (-1057.733) -- 0:00:27
886000 -- (-1046.661) [-1039.149] (-1049.780) (-1052.507) * (-1042.298) (-1051.489) (-1062.786) [-1042.597] -- 0:00:26
886500 -- [-1043.178] (-1041.749) (-1043.928) (-1045.911) * (-1046.363) (-1055.231) [-1054.126] (-1046.986) -- 0:00:26
887000 -- (-1060.662) [-1045.842] (-1071.670) (-1048.463) * [-1038.143] (-1044.724) (-1057.769) (-1049.265) -- 0:00:26
887500 -- (-1045.850) (-1038.261) (-1063.776) [-1042.239] * (-1057.815) (-1051.837) [-1037.864] (-1048.149) -- 0:00:26
888000 -- [-1040.693] (-1042.435) (-1060.342) (-1040.122) * (-1063.588) (-1046.474) [-1045.159] (-1046.724) -- 0:00:26
888500 -- (-1052.251) (-1050.260) [-1054.636] (-1052.172) * (-1043.156) (-1048.066) (-1047.036) [-1044.505] -- 0:00:26
889000 -- (-1058.837) [-1042.192] (-1059.759) (-1046.854) * [-1044.431] (-1056.513) (-1055.587) (-1058.830) -- 0:00:26
889500 -- (-1054.682) [-1044.144] (-1054.061) (-1049.139) * [-1038.640] (-1045.997) (-1059.915) (-1055.511) -- 0:00:26
890000 -- (-1047.168) (-1045.515) [-1055.239] (-1038.752) * (-1042.185) (-1043.265) [-1047.680] (-1051.648) -- 0:00:25
Average standard deviation of split frequencies: 0.007070
890500 -- (-1060.621) (-1061.118) (-1043.879) [-1040.580] * [-1048.631] (-1044.743) (-1040.022) (-1047.261) -- 0:00:25
891000 -- [-1038.127] (-1055.219) (-1059.640) (-1046.723) * [-1038.764] (-1044.189) (-1063.222) (-1050.144) -- 0:00:25
891500 -- (-1050.822) (-1053.604) (-1057.957) [-1041.532] * [-1040.663] (-1055.161) (-1047.716) (-1047.540) -- 0:00:25
892000 -- (-1046.363) (-1061.230) (-1065.022) [-1051.857] * (-1044.317) (-1057.273) (-1057.643) [-1051.824] -- 0:00:25
892500 -- (-1047.274) (-1053.447) [-1045.813] (-1050.793) * [-1044.362] (-1041.858) (-1052.666) (-1045.185) -- 0:00:25
893000 -- (-1047.401) (-1057.330) [-1050.647] (-1049.716) * (-1041.781) (-1040.752) (-1044.510) [-1040.980] -- 0:00:25
893500 -- (-1052.525) [-1035.846] (-1050.278) (-1048.476) * (-1053.300) (-1037.587) [-1039.477] (-1053.235) -- 0:00:25
894000 -- [-1041.493] (-1055.366) (-1051.287) (-1045.289) * [-1048.959] (-1052.332) (-1038.987) (-1045.717) -- 0:00:25
894500 -- [-1042.715] (-1042.906) (-1045.031) (-1039.525) * [-1050.320] (-1048.386) (-1043.628) (-1038.901) -- 0:00:24
895000 -- (-1038.512) (-1068.108) (-1046.814) [-1045.879] * [-1040.273] (-1062.682) (-1046.750) (-1035.984) -- 0:00:24
Average standard deviation of split frequencies: 0.007027
895500 -- [-1048.094] (-1044.027) (-1040.524) (-1046.600) * (-1044.959) [-1045.002] (-1054.138) (-1046.364) -- 0:00:24
896000 -- [-1052.081] (-1054.326) (-1039.298) (-1040.610) * [-1044.334] (-1042.976) (-1042.209) (-1057.229) -- 0:00:24
896500 -- (-1045.217) (-1059.061) [-1043.955] (-1050.193) * [-1042.459] (-1040.905) (-1044.452) (-1052.805) -- 0:00:24
897000 -- (-1051.591) [-1040.385] (-1047.321) (-1053.733) * [-1035.107] (-1041.400) (-1054.468) (-1047.155) -- 0:00:24
897500 -- (-1034.757) (-1038.654) (-1050.871) [-1056.790] * (-1041.310) [-1043.358] (-1054.863) (-1038.405) -- 0:00:24
898000 -- (-1034.766) (-1047.685) [-1049.459] (-1047.729) * (-1045.537) (-1046.257) (-1046.906) [-1047.811] -- 0:00:24
898500 -- (-1040.488) (-1037.661) (-1060.724) [-1047.457] * (-1047.529) (-1064.205) [-1043.093] (-1053.361) -- 0:00:23
899000 -- [-1044.135] (-1058.369) (-1044.570) (-1050.340) * [-1053.463] (-1054.281) (-1049.647) (-1055.522) -- 0:00:23
899500 -- (-1054.247) (-1063.199) (-1049.336) [-1051.801] * (-1043.892) (-1055.687) [-1040.160] (-1049.324) -- 0:00:23
900000 -- (-1058.493) (-1043.720) [-1040.386] (-1051.725) * (-1041.573) (-1049.157) (-1067.209) [-1036.439] -- 0:00:23
Average standard deviation of split frequencies: 0.007328
900500 -- (-1048.907) (-1045.750) (-1037.985) [-1049.825] * [-1045.548] (-1047.163) (-1055.115) (-1040.671) -- 0:00:23
901000 -- (-1056.987) (-1039.429) [-1041.887] (-1046.788) * [-1034.875] (-1066.813) (-1054.975) (-1044.242) -- 0:00:23
901500 -- [-1043.633] (-1059.805) (-1038.970) (-1041.488) * (-1055.915) (-1059.220) (-1046.437) [-1040.412] -- 0:00:23
902000 -- (-1044.565) (-1051.306) (-1048.707) [-1044.028] * [-1040.269] (-1044.978) (-1049.006) (-1043.888) -- 0:00:23
902500 -- (-1059.227) [-1044.848] (-1038.457) (-1045.353) * (-1042.292) (-1044.698) [-1037.393] (-1040.979) -- 0:00:23
903000 -- (-1048.415) (-1042.163) (-1036.326) [-1038.585] * (-1047.477) (-1050.580) [-1042.877] (-1040.314) -- 0:00:22
903500 -- [-1042.219] (-1055.991) (-1040.510) (-1057.425) * (-1040.718) (-1068.349) [-1047.729] (-1047.125) -- 0:00:22
904000 -- (-1045.286) (-1042.158) [-1044.496] (-1042.996) * [-1043.726] (-1064.506) (-1066.610) (-1040.424) -- 0:00:22
904500 -- (-1050.113) (-1039.440) (-1041.126) [-1041.175] * [-1036.039] (-1055.598) (-1053.891) (-1053.874) -- 0:00:22
905000 -- [-1047.634] (-1045.504) (-1052.399) (-1041.572) * [-1044.284] (-1058.648) (-1048.186) (-1043.299) -- 0:00:22
Average standard deviation of split frequencies: 0.007507
905500 -- (-1054.764) (-1046.070) (-1048.356) [-1043.087] * (-1056.068) (-1053.158) (-1034.693) [-1037.283] -- 0:00:22
906000 -- [-1041.580] (-1049.539) (-1050.736) (-1043.899) * (-1042.058) (-1061.190) (-1039.661) [-1033.082] -- 0:00:22
906500 -- (-1043.421) (-1050.225) (-1046.626) [-1040.874] * (-1039.116) (-1052.385) (-1045.943) [-1049.993] -- 0:00:22
907000 -- [-1045.673] (-1053.286) (-1050.863) (-1053.138) * (-1040.437) [-1052.248] (-1048.208) (-1043.853) -- 0:00:21
907500 -- (-1052.892) (-1049.861) [-1036.514] (-1041.771) * (-1047.830) [-1042.549] (-1046.500) (-1041.231) -- 0:00:21
908000 -- (-1056.039) [-1039.251] (-1062.983) (-1045.582) * (-1049.295) (-1047.251) (-1049.350) [-1036.460] -- 0:00:21
908500 -- [-1032.202] (-1041.457) (-1057.608) (-1043.223) * (-1052.260) (-1051.915) (-1043.515) [-1042.693] -- 0:00:21
909000 -- (-1052.494) (-1039.952) (-1058.856) [-1042.719] * (-1054.898) (-1048.745) [-1044.604] (-1056.805) -- 0:00:21
909500 -- (-1052.463) (-1044.740) [-1048.072] (-1061.374) * (-1053.628) (-1049.117) (-1051.072) [-1040.486] -- 0:00:21
910000 -- [-1035.769] (-1049.508) (-1049.159) (-1049.239) * (-1048.292) [-1034.635] (-1052.443) (-1038.479) -- 0:00:21
Average standard deviation of split frequencies: 0.007210
910500 -- (-1038.781) [-1037.652] (-1069.517) (-1051.392) * [-1045.457] (-1050.432) (-1038.237) (-1061.819) -- 0:00:21
911000 -- (-1050.146) [-1044.720] (-1053.688) (-1048.275) * [-1040.327] (-1050.648) (-1058.693) (-1053.600) -- 0:00:21
911500 -- [-1049.227] (-1050.924) (-1052.362) (-1039.476) * (-1043.945) [-1047.236] (-1048.161) (-1046.796) -- 0:00:20
912000 -- (-1044.598) [-1046.394] (-1081.156) (-1045.018) * (-1049.384) [-1037.453] (-1066.376) (-1054.463) -- 0:00:20
912500 -- (-1047.108) (-1042.331) (-1058.453) [-1042.911] * (-1037.824) [-1047.712] (-1046.954) (-1044.153) -- 0:00:20
913000 -- (-1047.332) [-1046.407] (-1053.847) (-1053.170) * [-1049.225] (-1060.459) (-1053.757) (-1054.293) -- 0:00:20
913500 -- (-1053.349) (-1041.906) (-1058.339) [-1045.703] * (-1059.201) (-1052.249) [-1046.117] (-1055.362) -- 0:00:20
914000 -- (-1047.494) [-1048.508] (-1066.652) (-1054.898) * (-1050.753) (-1051.935) [-1054.714] (-1066.566) -- 0:00:20
914500 -- (-1045.394) [-1051.370] (-1067.181) (-1044.060) * [-1040.567] (-1048.094) (-1046.598) (-1045.457) -- 0:00:20
915000 -- [-1049.702] (-1048.340) (-1058.409) (-1078.548) * (-1041.117) (-1043.802) [-1044.883] (-1047.165) -- 0:00:20
Average standard deviation of split frequencies: 0.007572
915500 -- (-1047.407) [-1038.904] (-1048.015) (-1055.535) * (-1043.998) (-1062.792) (-1056.509) [-1047.155] -- 0:00:19
916000 -- (-1055.763) (-1056.044) (-1041.047) [-1060.001] * [-1036.149] (-1047.406) (-1046.087) (-1045.416) -- 0:00:19
916500 -- (-1048.638) [-1045.389] (-1049.253) (-1037.589) * [-1039.711] (-1049.947) (-1042.641) (-1044.803) -- 0:00:19
917000 -- (-1045.206) (-1054.587) (-1070.314) [-1041.882] * (-1041.243) [-1051.481] (-1046.599) (-1043.532) -- 0:00:19
917500 -- (-1052.381) [-1042.254] (-1066.079) (-1045.473) * (-1076.936) (-1051.185) (-1056.701) [-1045.688] -- 0:00:19
918000 -- (-1047.924) (-1050.209) (-1064.123) [-1038.353] * (-1061.585) (-1059.645) [-1033.806] (-1037.685) -- 0:00:19
918500 -- (-1051.671) [-1046.400] (-1050.273) (-1048.726) * (-1044.970) (-1052.553) (-1040.178) [-1050.389] -- 0:00:19
919000 -- (-1055.873) [-1039.616] (-1058.651) (-1046.521) * [-1041.422] (-1044.013) (-1055.834) (-1059.079) -- 0:00:19
919500 -- (-1041.700) (-1038.992) (-1053.364) [-1047.601] * (-1050.211) (-1047.259) [-1043.518] (-1061.101) -- 0:00:18
920000 -- [-1047.537] (-1042.964) (-1046.789) (-1049.238) * (-1043.977) [-1045.461] (-1054.187) (-1039.962) -- 0:00:18
Average standard deviation of split frequencies: 0.007498
920500 -- (-1050.283) [-1044.357] (-1046.607) (-1051.462) * (-1057.948) (-1045.178) (-1054.296) [-1048.094] -- 0:00:18
921000 -- [-1041.751] (-1051.835) (-1049.149) (-1044.735) * (-1064.046) [-1046.940] (-1042.773) (-1054.171) -- 0:00:18
921500 -- (-1051.926) (-1053.696) [-1047.129] (-1043.562) * (-1049.132) (-1051.240) [-1040.852] (-1046.143) -- 0:00:18
922000 -- (-1052.881) [-1048.255] (-1065.572) (-1050.520) * [-1038.682] (-1051.744) (-1051.582) (-1048.322) -- 0:00:18
922500 -- [-1048.248] (-1040.756) (-1045.307) (-1060.201) * (-1059.043) (-1038.571) (-1061.110) [-1038.789] -- 0:00:18
923000 -- (-1050.445) (-1047.514) (-1052.999) [-1055.909] * (-1055.206) [-1046.765] (-1054.740) (-1044.172) -- 0:00:18
923500 -- [-1043.226] (-1049.248) (-1046.452) (-1056.434) * (-1060.046) (-1048.933) (-1057.296) [-1039.865] -- 0:00:18
924000 -- (-1040.636) (-1053.296) [-1039.188] (-1041.033) * (-1046.235) [-1038.378] (-1045.161) (-1056.590) -- 0:00:17
924500 -- (-1046.875) [-1041.635] (-1034.705) (-1057.031) * (-1039.175) (-1039.498) (-1046.764) [-1054.694] -- 0:00:17
925000 -- (-1040.661) (-1048.973) (-1049.162) [-1041.263] * (-1043.674) (-1047.836) [-1042.936] (-1051.216) -- 0:00:17
Average standard deviation of split frequencies: 0.007927
925500 -- (-1050.033) [-1040.970] (-1052.773) (-1044.597) * (-1047.468) (-1048.323) (-1042.655) [-1036.281] -- 0:00:17
926000 -- (-1048.739) (-1057.042) [-1055.443] (-1050.681) * [-1042.997] (-1062.629) (-1066.506) (-1039.750) -- 0:00:17
926500 -- (-1038.106) (-1057.398) [-1040.746] (-1041.411) * (-1051.699) (-1046.212) (-1052.963) [-1041.149] -- 0:00:17
927000 -- (-1048.666) (-1046.823) (-1055.731) [-1043.332] * (-1038.887) (-1054.840) (-1044.250) [-1039.519] -- 0:00:17
927500 -- (-1046.103) (-1051.858) [-1040.632] (-1054.258) * (-1045.451) (-1049.893) (-1044.833) [-1042.241] -- 0:00:17
928000 -- (-1037.949) [-1047.627] (-1054.458) (-1050.974) * (-1053.263) (-1060.268) (-1041.096) [-1036.380] -- 0:00:16
928500 -- (-1051.277) (-1042.677) (-1048.201) [-1042.140] * (-1055.981) (-1047.732) (-1057.300) [-1041.826] -- 0:00:16
929000 -- [-1045.175] (-1051.092) (-1051.676) (-1037.882) * (-1042.900) (-1042.820) (-1049.025) [-1048.810] -- 0:00:16
929500 -- (-1052.975) [-1048.499] (-1053.515) (-1050.165) * (-1055.817) (-1043.923) (-1037.410) [-1055.209] -- 0:00:16
930000 -- (-1051.304) [-1043.439] (-1039.349) (-1042.791) * [-1037.371] (-1043.373) (-1055.467) (-1047.268) -- 0:00:16
Average standard deviation of split frequencies: 0.007634
930500 -- (-1046.088) (-1051.934) (-1046.850) [-1037.746] * [-1034.323] (-1048.593) (-1056.793) (-1052.383) -- 0:00:16
931000 -- (-1051.168) (-1056.542) (-1045.838) [-1042.397] * (-1045.514) (-1046.701) (-1053.184) [-1038.770] -- 0:00:16
931500 -- [-1046.692] (-1044.646) (-1054.988) (-1041.006) * (-1039.654) (-1055.318) (-1044.552) [-1039.570] -- 0:00:16
932000 -- (-1060.468) (-1051.932) (-1039.989) [-1036.456] * (-1046.549) (-1039.931) (-1051.380) [-1039.879] -- 0:00:16
932500 -- (-1057.510) [-1039.935] (-1040.388) (-1043.795) * [-1049.546] (-1042.446) (-1052.302) (-1059.222) -- 0:00:15
933000 -- (-1044.638) [-1046.644] (-1044.439) (-1045.611) * (-1038.138) (-1052.501) [-1047.112] (-1059.660) -- 0:00:15
933500 -- (-1047.824) (-1043.503) [-1045.651] (-1047.010) * (-1045.934) [-1044.309] (-1052.036) (-1048.732) -- 0:00:15
934000 -- (-1061.280) (-1047.999) [-1053.205] (-1047.712) * [-1041.999] (-1042.836) (-1060.234) (-1053.192) -- 0:00:15
934500 -- (-1044.512) (-1047.611) (-1059.932) [-1042.183] * (-1034.416) [-1051.650] (-1052.825) (-1051.025) -- 0:00:15
935000 -- (-1050.071) [-1037.920] (-1048.769) (-1047.626) * (-1036.802) (-1046.571) (-1052.861) [-1040.813] -- 0:00:15
Average standard deviation of split frequencies: 0.007375
935500 -- (-1047.463) [-1036.426] (-1059.702) (-1053.645) * [-1038.460] (-1046.613) (-1049.950) (-1049.569) -- 0:00:15
936000 -- (-1042.464) (-1048.669) [-1046.593] (-1035.452) * (-1046.487) (-1047.000) (-1037.238) [-1036.143] -- 0:00:15
936500 -- (-1036.885) (-1057.355) (-1053.682) [-1058.605] * (-1045.774) (-1039.949) [-1045.292] (-1041.713) -- 0:00:14
937000 -- (-1042.952) (-1045.032) (-1048.005) [-1049.493] * [-1041.979] (-1049.052) (-1049.386) (-1052.634) -- 0:00:14
937500 -- [-1040.878] (-1056.706) (-1038.787) (-1056.104) * (-1047.104) (-1047.840) [-1043.212] (-1059.475) -- 0:00:14
938000 -- (-1034.602) [-1039.213] (-1055.343) (-1066.368) * (-1052.027) (-1054.578) (-1036.432) [-1056.178] -- 0:00:14
938500 -- (-1055.785) (-1036.542) [-1050.744] (-1059.234) * [-1048.209] (-1044.961) (-1049.739) (-1050.607) -- 0:00:14
939000 -- [-1039.798] (-1034.388) (-1048.674) (-1053.751) * (-1051.563) [-1051.489] (-1048.463) (-1042.429) -- 0:00:14
939500 -- (-1051.256) (-1062.980) [-1039.456] (-1050.796) * [-1039.880] (-1047.842) (-1037.094) (-1056.080) -- 0:00:14
940000 -- (-1052.341) (-1047.937) [-1044.879] (-1043.740) * (-1045.094) (-1048.801) [-1053.792] (-1044.391) -- 0:00:14
Average standard deviation of split frequencies: 0.007374
940500 -- (-1044.173) (-1061.167) (-1061.307) [-1034.210] * [-1036.146] (-1043.201) (-1039.140) (-1041.380) -- 0:00:14
941000 -- (-1056.097) (-1044.097) (-1062.001) [-1046.562] * (-1038.825) (-1049.157) (-1058.090) [-1044.772] -- 0:00:13
941500 -- (-1047.299) (-1043.146) (-1048.393) [-1046.528] * [-1044.561] (-1047.604) (-1045.037) (-1040.560) -- 0:00:13
942000 -- [-1041.922] (-1047.201) (-1052.999) (-1044.408) * (-1039.689) [-1035.409] (-1053.968) (-1052.573) -- 0:00:13
942500 -- (-1047.130) (-1042.313) [-1048.091] (-1047.006) * (-1078.072) (-1043.203) [-1042.134] (-1047.657) -- 0:00:13
943000 -- (-1047.322) [-1046.756] (-1070.516) (-1057.906) * (-1059.124) [-1042.575] (-1049.414) (-1049.166) -- 0:00:13
943500 -- (-1039.730) (-1044.993) (-1054.500) [-1044.956] * (-1051.577) (-1046.538) [-1039.820] (-1049.583) -- 0:00:13
944000 -- (-1048.735) [-1046.434] (-1070.197) (-1064.682) * (-1043.367) (-1061.022) [-1050.729] (-1058.962) -- 0:00:13
944500 -- [-1043.860] (-1039.920) (-1053.631) (-1056.204) * (-1045.472) (-1048.162) [-1039.146] (-1055.519) -- 0:00:13
945000 -- [-1037.611] (-1064.240) (-1048.143) (-1044.675) * (-1065.523) (-1055.528) [-1041.357] (-1045.399) -- 0:00:12
Average standard deviation of split frequencies: 0.007048
945500 -- (-1051.316) [-1046.389] (-1051.166) (-1046.371) * (-1047.812) (-1049.868) [-1038.542] (-1036.616) -- 0:00:12
946000 -- (-1064.546) (-1055.339) [-1054.888] (-1047.520) * (-1039.852) (-1052.100) (-1055.766) [-1046.786] -- 0:00:12
946500 -- (-1045.482) (-1039.685) (-1062.839) [-1051.299] * (-1050.608) (-1055.854) [-1035.543] (-1035.771) -- 0:00:12
947000 -- (-1062.017) (-1057.481) [-1051.051] (-1062.982) * [-1043.814] (-1063.201) (-1054.270) (-1046.333) -- 0:00:12
947500 -- (-1040.473) (-1053.056) (-1051.437) [-1045.252] * [-1042.336] (-1046.007) (-1046.590) (-1047.343) -- 0:00:12
948000 -- (-1050.620) [-1049.409] (-1053.688) (-1049.858) * [-1043.037] (-1042.661) (-1054.105) (-1055.159) -- 0:00:12
948500 -- (-1043.640) (-1049.037) [-1042.753] (-1060.603) * (-1045.912) [-1043.716] (-1049.598) (-1055.237) -- 0:00:12
949000 -- (-1053.477) (-1053.158) [-1046.594] (-1064.659) * (-1048.907) [-1041.234] (-1041.652) (-1061.258) -- 0:00:12
949500 -- (-1052.079) (-1039.920) (-1048.929) [-1043.827] * (-1056.936) (-1047.852) [-1044.621] (-1055.914) -- 0:00:11
950000 -- (-1051.539) (-1043.078) (-1051.691) [-1047.680] * [-1041.432] (-1062.646) (-1049.746) (-1049.345) -- 0:00:11
Average standard deviation of split frequencies: 0.007225
950500 -- (-1054.979) (-1044.691) [-1047.558] (-1060.223) * (-1036.641) [-1042.434] (-1048.868) (-1052.661) -- 0:00:11
951000 -- (-1054.318) (-1038.964) (-1055.744) [-1040.074] * [-1040.434] (-1042.441) (-1050.580) (-1042.352) -- 0:00:11
951500 -- (-1049.221) (-1061.714) (-1050.042) [-1033.397] * (-1049.716) (-1042.642) (-1062.553) [-1037.947] -- 0:00:11
952000 -- (-1035.296) (-1052.306) (-1046.494) [-1032.277] * (-1047.150) (-1047.414) (-1048.268) [-1047.328] -- 0:00:11
952500 -- (-1039.118) [-1048.140] (-1047.186) (-1043.158) * (-1050.815) (-1045.141) (-1064.065) [-1044.653] -- 0:00:11
953000 -- (-1040.423) [-1038.973] (-1038.546) (-1049.136) * (-1037.819) [-1051.944] (-1057.697) (-1068.973) -- 0:00:11
953500 -- (-1044.958) (-1044.279) [-1047.669] (-1041.142) * (-1068.337) (-1044.041) [-1046.330] (-1042.370) -- 0:00:10
954000 -- (-1039.669) (-1041.500) (-1063.643) [-1054.266] * (-1052.552) [-1038.370] (-1045.505) (-1045.123) -- 0:00:10
954500 -- (-1039.434) (-1038.639) (-1045.455) [-1044.462] * (-1054.971) [-1048.401] (-1041.392) (-1036.002) -- 0:00:10
955000 -- [-1042.931] (-1047.947) (-1051.205) (-1047.992) * (-1049.545) [-1046.647] (-1046.979) (-1049.027) -- 0:00:10
Average standard deviation of split frequencies: 0.007009
955500 -- (-1044.278) [-1035.416] (-1039.860) (-1056.258) * (-1055.597) (-1063.415) [-1046.138] (-1052.221) -- 0:00:10
956000 -- (-1043.727) (-1043.339) (-1051.803) [-1045.553] * (-1056.138) (-1045.507) [-1044.994] (-1056.488) -- 0:00:10
956500 -- (-1059.056) (-1045.751) [-1041.138] (-1056.819) * [-1040.678] (-1054.563) (-1052.182) (-1056.364) -- 0:00:10
957000 -- (-1064.824) (-1044.588) [-1041.022] (-1054.173) * (-1051.030) (-1047.641) [-1047.766] (-1056.390) -- 0:00:10
957500 -- [-1039.742] (-1036.146) (-1053.787) (-1061.348) * (-1058.201) (-1047.741) [-1040.113] (-1058.683) -- 0:00:10
958000 -- (-1047.670) (-1046.496) (-1059.129) [-1046.856] * (-1041.861) (-1058.234) [-1044.072] (-1062.388) -- 0:00:09
958500 -- (-1046.655) [-1047.367] (-1045.709) (-1040.167) * (-1051.816) (-1051.570) [-1050.453] (-1076.295) -- 0:00:09
959000 -- (-1042.654) (-1050.120) [-1046.031] (-1052.738) * (-1048.493) [-1042.080] (-1047.661) (-1059.767) -- 0:00:09
959500 -- (-1041.568) [-1039.273] (-1055.101) (-1050.895) * [-1042.007] (-1041.205) (-1053.319) (-1056.485) -- 0:00:09
960000 -- (-1057.718) [-1052.747] (-1046.710) (-1040.210) * (-1051.141) (-1055.998) (-1044.949) [-1048.982] -- 0:00:09
Average standard deviation of split frequencies: 0.006800
960500 -- [-1039.687] (-1041.128) (-1055.132) (-1040.977) * [-1050.130] (-1048.260) (-1059.551) (-1048.641) -- 0:00:09
961000 -- [-1038.948] (-1047.354) (-1051.586) (-1047.641) * (-1044.429) (-1060.305) [-1041.513] (-1054.880) -- 0:00:09
961500 -- [-1039.933] (-1043.282) (-1049.589) (-1036.152) * (-1052.461) (-1055.147) (-1045.289) [-1056.796] -- 0:00:09
962000 -- (-1059.446) (-1040.685) (-1049.218) [-1044.057] * [-1041.819] (-1053.497) (-1051.270) (-1050.251) -- 0:00:08
962500 -- (-1044.317) [-1042.438] (-1048.824) (-1060.729) * (-1055.906) (-1050.541) [-1047.744] (-1058.757) -- 0:00:08
963000 -- (-1048.866) (-1038.733) [-1038.127] (-1054.048) * (-1053.272) (-1050.564) [-1043.896] (-1061.972) -- 0:00:08
963500 -- (-1058.344) (-1048.526) [-1041.639] (-1043.738) * (-1047.780) (-1049.015) [-1043.324] (-1067.668) -- 0:00:08
964000 -- (-1055.542) (-1050.248) [-1050.937] (-1039.268) * (-1047.491) (-1053.932) [-1041.057] (-1069.140) -- 0:00:08
964500 -- (-1049.998) [-1036.621] (-1054.097) (-1053.511) * [-1046.630] (-1042.999) (-1051.256) (-1047.591) -- 0:00:08
965000 -- (-1042.462) (-1047.574) [-1048.620] (-1047.787) * (-1047.927) (-1039.256) [-1059.165] (-1064.848) -- 0:00:08
Average standard deviation of split frequencies: 0.007146
965500 -- [-1045.087] (-1051.938) (-1050.299) (-1051.942) * (-1053.460) [-1043.311] (-1050.788) (-1043.050) -- 0:00:08
966000 -- (-1040.882) (-1049.365) (-1052.817) [-1051.760] * (-1052.327) (-1061.573) (-1055.181) [-1040.389] -- 0:00:08
966500 -- [-1043.021] (-1048.349) (-1054.768) (-1045.592) * (-1061.126) [-1048.762] (-1055.297) (-1045.509) -- 0:00:07
967000 -- (-1043.598) (-1050.324) (-1043.685) [-1040.997] * (-1046.429) (-1052.160) (-1051.440) [-1043.662] -- 0:00:07
967500 -- (-1045.376) [-1040.327] (-1043.100) (-1056.786) * (-1056.739) [-1046.389] (-1044.151) (-1052.086) -- 0:00:07
968000 -- (-1042.982) (-1047.649) [-1044.891] (-1058.222) * (-1045.808) [-1044.157] (-1042.851) (-1063.489) -- 0:00:07
968500 -- (-1043.199) (-1069.504) (-1051.075) [-1057.434] * [-1039.520] (-1044.259) (-1047.332) (-1065.430) -- 0:00:07
969000 -- (-1046.743) (-1039.991) [-1040.822] (-1047.866) * [-1042.810] (-1039.406) (-1054.963) (-1046.947) -- 0:00:07
969500 -- [-1043.689] (-1045.804) (-1060.045) (-1037.958) * (-1047.894) [-1042.797] (-1051.783) (-1060.506) -- 0:00:07
970000 -- (-1045.399) (-1042.651) (-1047.412) [-1048.201] * (-1041.073) (-1052.256) [-1046.161] (-1039.692) -- 0:00:07
Average standard deviation of split frequencies: 0.006730
970500 -- [-1046.549] (-1055.752) (-1051.546) (-1049.160) * (-1050.317) [-1045.027] (-1047.868) (-1050.523) -- 0:00:06
971000 -- (-1051.612) (-1041.021) [-1045.456] (-1041.397) * (-1044.320) (-1043.960) [-1045.155] (-1054.741) -- 0:00:06
971500 -- (-1045.694) [-1052.059] (-1063.619) (-1046.598) * [-1047.388] (-1035.115) (-1036.815) (-1040.359) -- 0:00:06
972000 -- (-1041.514) (-1043.981) [-1043.731] (-1046.515) * (-1045.648) (-1054.973) [-1045.093] (-1038.109) -- 0:00:06
972500 -- [-1038.495] (-1048.959) (-1055.304) (-1046.705) * (-1045.160) [-1042.869] (-1053.707) (-1055.437) -- 0:00:06
973000 -- [-1049.265] (-1069.213) (-1058.172) (-1037.305) * (-1039.678) (-1037.504) (-1055.047) [-1047.346] -- 0:00:06
973500 -- (-1057.574) (-1043.417) [-1056.858] (-1048.458) * (-1042.257) [-1043.111] (-1059.625) (-1063.984) -- 0:00:06
974000 -- [-1044.047] (-1041.387) (-1058.057) (-1044.914) * [-1053.977] (-1042.160) (-1066.339) (-1052.726) -- 0:00:06
974500 -- (-1040.630) [-1045.426] (-1048.894) (-1038.178) * (-1055.247) (-1038.773) [-1046.902] (-1048.212) -- 0:00:06
975000 -- (-1051.668) (-1045.226) [-1038.791] (-1041.981) * (-1038.201) (-1050.522) (-1042.932) [-1040.173] -- 0:00:05
Average standard deviation of split frequencies: 0.006382
975500 -- (-1043.309) [-1034.642] (-1055.183) (-1040.071) * [-1037.007] (-1044.827) (-1046.481) (-1034.206) -- 0:00:05
976000 -- (-1047.601) [-1038.014] (-1041.245) (-1042.698) * [-1044.843] (-1049.648) (-1055.180) (-1055.883) -- 0:00:05
976500 -- (-1046.385) (-1057.400) [-1036.400] (-1039.845) * [-1037.075] (-1041.263) (-1055.845) (-1041.401) -- 0:00:05
977000 -- (-1063.699) (-1039.388) [-1044.145] (-1041.796) * [-1047.401] (-1043.993) (-1066.379) (-1044.264) -- 0:00:05
977500 -- (-1046.192) (-1049.719) (-1055.261) [-1045.658] * [-1054.096] (-1039.220) (-1053.903) (-1055.235) -- 0:00:05
978000 -- (-1052.264) (-1048.702) [-1035.409] (-1050.540) * (-1046.135) [-1044.939] (-1046.082) (-1050.762) -- 0:00:05
978500 -- [-1040.656] (-1047.601) (-1060.327) (-1047.038) * (-1044.909) (-1060.301) [-1038.340] (-1046.490) -- 0:00:05
979000 -- (-1057.398) [-1042.536] (-1033.407) (-1047.740) * [-1039.787] (-1046.937) (-1045.465) (-1046.827) -- 0:00:04
979500 -- (-1050.156) (-1049.362) [-1045.842] (-1046.807) * [-1046.547] (-1060.917) (-1053.833) (-1056.532) -- 0:00:04
980000 -- (-1057.236) (-1048.607) (-1049.377) [-1041.593] * (-1048.603) (-1055.155) (-1048.435) [-1046.623] -- 0:00:04
Average standard deviation of split frequencies: 0.006558
980500 -- [-1034.808] (-1051.683) (-1053.963) (-1054.219) * (-1045.150) (-1043.135) [-1047.760] (-1050.816) -- 0:00:04
981000 -- [-1039.468] (-1046.435) (-1058.798) (-1046.179) * (-1050.486) (-1070.615) (-1055.554) [-1038.836] -- 0:00:04
981500 -- (-1039.418) (-1047.759) [-1040.872] (-1048.323) * [-1035.754] (-1043.835) (-1049.859) (-1050.527) -- 0:00:04
982000 -- [-1040.696] (-1048.827) (-1055.944) (-1050.340) * (-1048.448) (-1051.372) (-1057.380) [-1045.581] -- 0:00:04
982500 -- (-1047.368) [-1037.569] (-1055.923) (-1058.960) * [-1047.146] (-1056.126) (-1049.682) (-1048.225) -- 0:00:04
983000 -- (-1038.135) [-1049.159] (-1049.012) (-1059.156) * (-1068.634) (-1044.129) (-1043.587) [-1042.258] -- 0:00:04
983500 -- [-1035.263] (-1060.622) (-1045.337) (-1043.565) * (-1050.752) (-1048.521) [-1052.300] (-1053.068) -- 0:00:03
984000 -- (-1054.991) (-1054.653) [-1039.921] (-1048.398) * [-1041.090] (-1042.262) (-1040.070) (-1048.625) -- 0:00:03
984500 -- (-1050.674) (-1056.402) [-1050.386] (-1047.868) * (-1040.651) [-1046.383] (-1064.095) (-1055.099) -- 0:00:03
985000 -- (-1048.115) (-1063.077) [-1044.123] (-1046.766) * (-1056.649) (-1051.947) (-1061.898) [-1043.620] -- 0:00:03
Average standard deviation of split frequencies: 0.006830
985500 -- (-1048.178) (-1066.389) [-1034.859] (-1044.569) * (-1057.604) (-1056.704) (-1051.717) [-1041.721] -- 0:00:03
986000 -- (-1047.812) (-1058.748) [-1040.531] (-1049.505) * (-1057.323) (-1046.877) [-1048.872] (-1049.546) -- 0:00:03
986500 -- (-1055.414) (-1064.027) [-1035.629] (-1061.249) * [-1044.956] (-1047.854) (-1054.918) (-1051.710) -- 0:00:03
987000 -- (-1052.151) (-1043.155) [-1043.669] (-1060.502) * (-1051.521) [-1047.579] (-1052.452) (-1055.204) -- 0:00:03
987500 -- (-1046.775) (-1055.418) (-1036.254) [-1048.437] * (-1040.321) (-1048.790) (-1050.743) [-1040.097] -- 0:00:02
988000 -- (-1036.610) (-1059.947) [-1043.422] (-1044.032) * (-1051.581) (-1063.556) [-1047.801] (-1044.965) -- 0:00:02
988500 -- [-1038.019] (-1056.362) (-1060.501) (-1051.211) * (-1051.028) [-1058.746] (-1057.227) (-1054.782) -- 0:00:02
989000 -- (-1046.381) (-1045.368) (-1050.606) [-1042.580] * [-1041.843] (-1059.831) (-1066.776) (-1048.978) -- 0:00:02
989500 -- (-1043.813) (-1066.145) [-1045.817] (-1042.310) * (-1053.956) [-1042.854] (-1063.380) (-1039.066) -- 0:00:02
990000 -- (-1043.072) (-1064.432) [-1050.263] (-1039.212) * (-1049.903) [-1040.837] (-1044.128) (-1050.873) -- 0:00:02
Average standard deviation of split frequencies: 0.007002
990500 -- (-1047.880) (-1062.052) [-1049.495] (-1046.791) * [-1043.201] (-1055.433) (-1047.987) (-1048.789) -- 0:00:02
991000 -- [-1039.884] (-1047.348) (-1058.694) (-1038.983) * (-1046.938) (-1055.347) [-1039.852] (-1055.121) -- 0:00:02
991500 -- (-1052.931) [-1046.221] (-1059.561) (-1043.063) * (-1043.503) (-1058.445) [-1039.996] (-1055.146) -- 0:00:02
992000 -- [-1039.881] (-1041.955) (-1058.377) (-1057.040) * (-1054.341) [-1039.292] (-1051.762) (-1053.575) -- 0:00:01
992500 -- (-1061.802) (-1062.293) (-1052.282) [-1047.234] * (-1058.040) [-1049.749] (-1054.019) (-1053.137) -- 0:00:01
993000 -- (-1043.839) (-1058.534) [-1047.629] (-1052.885) * (-1063.107) [-1052.219] (-1043.937) (-1051.703) -- 0:00:01
993500 -- (-1035.448) (-1049.759) (-1053.210) [-1050.436] * (-1047.476) [-1038.691] (-1052.124) (-1053.790) -- 0:00:01
994000 -- [-1036.281] (-1048.648) (-1052.528) (-1045.232) * [-1052.341] (-1037.476) (-1057.193) (-1066.772) -- 0:00:01
994500 -- [-1040.924] (-1061.192) (-1049.704) (-1052.515) * (-1061.540) [-1046.074] (-1058.632) (-1054.254) -- 0:00:01
995000 -- [-1040.266] (-1066.609) (-1043.993) (-1053.356) * (-1053.697) (-1040.368) (-1061.695) [-1033.845] -- 0:00:01
Average standard deviation of split frequencies: 0.006795
995500 -- (-1051.375) (-1047.301) [-1045.500] (-1061.863) * (-1039.308) (-1040.424) (-1060.792) [-1042.067] -- 0:00:01
996000 -- [-1047.732] (-1037.946) (-1036.801) (-1053.502) * [-1039.396] (-1050.999) (-1047.857) (-1045.138) -- 0:00:00
996500 -- [-1036.956] (-1037.303) (-1048.699) (-1063.046) * (-1047.465) [-1040.186] (-1057.994) (-1050.845) -- 0:00:00
997000 -- (-1039.295) [-1036.598] (-1049.011) (-1054.244) * [-1043.352] (-1041.560) (-1046.240) (-1062.164) -- 0:00:00
997500 -- [-1037.096] (-1044.883) (-1051.898) (-1066.275) * (-1045.377) (-1052.204) [-1038.229] (-1043.989) -- 0:00:00
998000 -- (-1046.149) [-1041.193] (-1044.427) (-1057.863) * (-1048.500) (-1060.910) [-1040.689] (-1044.828) -- 0:00:00
998500 -- [-1043.275] (-1041.423) (-1051.987) (-1045.100) * (-1044.569) (-1059.793) [-1040.232] (-1065.464) -- 0:00:00
999000 -- (-1053.306) [-1040.688] (-1045.318) (-1053.269) * [-1046.135] (-1056.446) (-1051.534) (-1054.580) -- 0:00:00
999500 -- [-1043.942] (-1050.216) (-1052.258) (-1060.364) * [-1042.255] (-1066.288) (-1033.999) (-1045.558) -- 0:00:00
1000000 -- [-1050.284] (-1058.493) (-1044.588) (-1067.037) * (-1048.059) (-1048.460) (-1045.414) [-1042.774] -- 0:00:00
Average standard deviation of split frequencies: 0.007235
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1050.284235 -- 27.386767
Chain 1 -- -1050.284238 -- 27.386767
Chain 2 -- -1058.492643 -- 25.328626
Chain 2 -- -1058.492645 -- 25.328626
Chain 3 -- -1044.587718 -- 26.819442
Chain 3 -- -1044.587715 -- 26.819442
Chain 4 -- -1067.036733 -- 21.412217
Chain 4 -- -1067.036733 -- 21.412217
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1048.059183 -- 24.145321
Chain 1 -- -1048.059178 -- 24.145321
Chain 2 -- -1048.460258 -- 25.083978
Chain 2 -- -1048.460250 -- 25.083978
Chain 3 -- -1045.414350 -- 27.143848
Chain 3 -- -1045.414351 -- 27.143848
Chain 4 -- -1042.773558 -- 25.715815
Chain 4 -- -1042.773558 -- 25.715815
Analysis completed in 3 mins 56 seconds
Analysis used 236.72 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1027.46
Likelihood of best state for "cold" chain of run 2 was -1027.61
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
54.4 % ( 41 %) Dirichlet(Revmat{all})
74.0 % ( 59 %) Slider(Revmat{all})
29.3 % ( 27 %) Dirichlet(Pi{all})
31.1 % ( 31 %) Slider(Pi{all})
60.6 % ( 36 %) Multiplier(Alpha{1,2})
50.6 % ( 31 %) Multiplier(Alpha{3})
45.8 % ( 20 %) Slider(Pinvar{all})
22.1 % ( 16 %) ExtSPR(Tau{all},V{all})
7.6 % ( 7 %) ExtTBR(Tau{all},V{all})
24.7 % ( 19 %) NNI(Tau{all},V{all})
18.9 % ( 19 %) ParsSPR(Tau{all},V{all})
27.2 % ( 29 %) Multiplier(V{all})
57.0 % ( 62 %) Nodeslider(V{all})
26.7 % ( 26 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
55.4 % ( 51 %) Dirichlet(Revmat{all})
73.7 % ( 66 %) Slider(Revmat{all})
30.4 % ( 29 %) Dirichlet(Pi{all})
31.5 % ( 28 %) Slider(Pi{all})
61.1 % ( 38 %) Multiplier(Alpha{1,2})
50.5 % ( 28 %) Multiplier(Alpha{3})
45.3 % ( 26 %) Slider(Pinvar{all})
22.3 % ( 24 %) ExtSPR(Tau{all},V{all})
7.6 % ( 5 %) ExtTBR(Tau{all},V{all})
24.7 % ( 30 %) NNI(Tau{all},V{all})
19.0 % ( 25 %) ParsSPR(Tau{all},V{all})
27.2 % ( 33 %) Multiplier(V{all})
56.8 % ( 56 %) Nodeslider(V{all})
26.4 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.70 0.44 0.26
2 | 166534 0.71 0.46
3 | 166332 167059 0.72
4 | 167365 166229 166481
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.69 0.44 0.25
2 | 166358 0.70 0.46
3 | 166924 166654 0.71
4 | 166899 166194 166971
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1040.43
| 1 |
| 1 2 1 |
| 2 2 1 21 1 2 |
| 1 1 2 2 1 2 |
| 1 2 222 11 21 1 1 1 |
|1 11 2 111 2 1 11 1 1 |
|2 2 2 21 * * ** 2 1 212 2 12 *|
| 2 2 12 1 21 21 1 * 1 2 2 |
| 1 211 1 1 1 * 2 21 2 2 1 2 |
| 2 1 1 2 2* 22 1 2 |
| 2 2 2 2 2 12 |
| 2 1 * |
| 1 |
| |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1047.07
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1036.13 -1056.01
2 -1035.57 -1055.58
--------------------------------------
TOTAL -1035.81 -1055.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.502454 0.013206 0.303897 0.738691 0.485575 847.82 1111.12 1.000
r(A<->C){all} 0.014359 0.000152 0.000001 0.038374 0.011240 829.56 918.44 1.001
r(A<->G){all} 0.184487 0.004569 0.064227 0.319684 0.176656 451.92 533.18 1.003
r(A<->T){all} 0.127286 0.003022 0.032680 0.233709 0.121646 607.80 625.99 1.000
r(C<->G){all} 0.024685 0.000401 0.000011 0.064211 0.019767 586.56 802.94 1.000
r(C<->T){all} 0.388413 0.010098 0.200378 0.592322 0.383256 374.90 452.64 1.000
r(G<->T){all} 0.260770 0.007080 0.105653 0.426002 0.254728 299.09 447.91 1.001
pi(A){all} 0.319319 0.000441 0.279689 0.361674 0.318818 1205.52 1282.45 1.001
pi(C){all} 0.311586 0.000411 0.268930 0.348686 0.311460 1185.69 1236.05 1.000
pi(G){all} 0.198203 0.000311 0.164557 0.233611 0.197957 1267.51 1295.72 1.000
pi(T){all} 0.170891 0.000255 0.140903 0.202530 0.170256 1220.31 1273.88 1.000
alpha{1,2} 0.052587 0.001249 0.000105 0.116000 0.049012 1092.54 1116.91 1.000
alpha{3} 1.514823 0.435671 0.516429 2.875891 1.394310 1435.42 1468.21 1.000
pinvar{all} 0.698038 0.002125 0.604684 0.782088 0.700952 1264.02 1341.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- .....******
13 -- ...**......
14 -- .**........
15 -- ...********
16 -- ......**...
17 -- .....*..*..
18 -- .....*****.
19 -- .....****..
20 -- ......**.*.
21 -- ......**.**
22 -- ......****.
23 -- ......***..
24 -- .....****.*
25 -- .........**
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2998 0.998668 0.001884 0.997335 1.000000 2
13 2902 0.966689 0.004711 0.963358 0.970020 2
14 2749 0.915723 0.001413 0.914724 0.916722 2
15 2652 0.883411 0.005653 0.879414 0.887408 2
16 2525 0.841106 0.009893 0.834111 0.848101 2
17 1614 0.537642 0.001884 0.536309 0.538974 2
18 1285 0.428048 0.015546 0.417055 0.439041 2
19 1040 0.346436 0.013191 0.337109 0.355763 2
20 814 0.271153 0.017901 0.258494 0.283811 2
21 576 0.191872 0.006595 0.187209 0.196536 2
22 372 0.123917 0.009422 0.117255 0.130580 2
23 360 0.119920 0.000000 0.119920 0.119920 2
24 346 0.115256 0.012248 0.106596 0.123917 2
25 342 0.113924 0.000942 0.113258 0.114590 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.009986 0.000067 0.000001 0.025339 0.008058 1.001 2
length{all}[2] 0.005140 0.000031 0.000001 0.015703 0.003327 1.001 2
length{all}[3] 0.014730 0.000089 0.001089 0.033401 0.012679 1.000 2
length{all}[4] 0.004407 0.000021 0.000000 0.013366 0.003037 1.000 2
length{all}[5] 0.008410 0.000043 0.000042 0.020675 0.006787 1.000 2
length{all}[6] 0.035052 0.000416 0.001980 0.072878 0.032035 1.000 2
length{all}[7] 0.035771 0.000361 0.005713 0.072270 0.032632 1.000 2
length{all}[8] 0.031126 0.000323 0.001638 0.064631 0.027963 1.000 2
length{all}[9] 0.102755 0.001614 0.034174 0.179937 0.095529 1.000 2
length{all}[10] 0.072363 0.000955 0.023316 0.132633 0.067620 1.000 2
length{all}[11] 0.020153 0.000185 0.000409 0.045113 0.017329 1.000 2
length{all}[12] 0.048122 0.000629 0.009451 0.099850 0.042858 1.000 2
length{all}[13] 0.017312 0.000142 0.000507 0.040934 0.014706 1.000 2
length{all}[14] 0.013918 0.000087 0.000040 0.031757 0.011793 1.000 2
length{all}[15] 0.015665 0.000128 0.000004 0.036600 0.013150 1.000 2
length{all}[16] 0.025075 0.000276 0.000225 0.056879 0.021469 1.000 2
length{all}[17] 0.023205 0.000294 0.000047 0.055105 0.019283 1.000 2
length{all}[18] 0.014585 0.000146 0.000156 0.037897 0.011441 0.999 2
length{all}[19] 0.016636 0.000171 0.000052 0.040691 0.013853 1.002 2
length{all}[20] 0.015355 0.000186 0.000006 0.042094 0.011544 0.999 2
length{all}[21] 0.013548 0.000140 0.000012 0.037310 0.010500 1.000 2
length{all}[22] 0.013969 0.000130 0.000000 0.036932 0.011253 0.998 2
length{all}[23] 0.014020 0.000169 0.000021 0.040588 0.010497 1.002 2
length{all}[24] 0.012787 0.000214 0.000001 0.038951 0.008177 0.997 2
length{all}[25] 0.009635 0.000108 0.000011 0.028963 0.006798 1.004 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007235
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.004
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
| /----------------- C2 (2)
|-------------------------92-------------------------+
| \----------------- C3 (3)
|
+ /----------------- C4 (4)
| /----------------97----------------+
| | \----------------- C5 (5)
| |
| | /----------------- C6 (6)
| | /--------54-------+
\--------88-------+ | \----------------- C9 (9)
| |
| | /----------------- C7 (7)
| |--------84-------+
\-------100------+ \----------------- C8 (8)
|
|----------------------------------- C10 (10)
|
\----------------------------------- C11 (11)
Phylogram (based on average branch lengths):
/--- C1 (1)
|
| /- C2 (2)
|----+
| \----- C3 (3)
|
+ /- C4 (4)
| /-----+
| | \--- C5 (5)
| |
| | /------------- C6 (6)
| | /-------+
\-----+ | \---------------------------------------- C9 (9)
| |
| | /------------- C7 (7)
| |--------+
\-----------------+ \----------- C8 (8)
|
|---------------------------- C10 (10)
|
\------- C11 (11)
|-------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (563 trees sampled):
50 % credible set contains 20 trees
90 % credible set contains 263 trees
95 % credible set contains 413 trees
99 % credible set contains 533 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 495
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sequences read..
Counting site patterns.. 0:00
83 patterns at 165 / 165 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
81008 bytes for conP
11288 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
283528 bytes for conP, adjusted
0.009335 0.008985 0.000232 0.011936 0.008340 0.015699 0.000438 0.005659 0.035617 0.003585 0.040832 0.062058 0.023788 0.034738 0.028382 0.057020 0.016544 0.300000 1.300000
ntime & nrate & np: 17 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 19
lnL0 = -1112.277134
Iterating by ming2
Initial: fx= 1112.277134
x= 0.00933 0.00898 0.00023 0.01194 0.00834 0.01570 0.00044 0.00566 0.03562 0.00358 0.04083 0.06206 0.02379 0.03474 0.02838 0.05702 0.01654 0.30000 1.30000
1 h-m-p 0.0000 0.0000 680.9216 ++ 1111.693773 m 0.0000 24 | 1/19
2 h-m-p 0.0000 0.0000 237.7361 ++ 1111.635541 m 0.0000 46 | 2/19
3 h-m-p 0.0000 0.0002 280.4193 ++YCYCCC 1109.520174 5 0.0001 78 | 2/19
4 h-m-p 0.0000 0.0002 769.8985 YCCCC 1106.209522 4 0.0001 107 | 2/19
5 h-m-p 0.0000 0.0001 1042.5923 +YYYYCC 1102.520030 5 0.0001 136 | 2/19
6 h-m-p 0.0000 0.0000 1498.2907 YCYCCC 1101.206748 5 0.0000 166 | 2/19
7 h-m-p 0.0000 0.0001 1911.2511 +CYCCC 1095.112012 4 0.0001 196 | 2/19
8 h-m-p 0.0001 0.0005 643.0004 YCYCCC 1088.240589 5 0.0003 226 | 2/19
9 h-m-p 0.0001 0.0004 323.7882 YCCCCC 1086.091173 5 0.0002 257 | 2/19
10 h-m-p 0.0002 0.0008 216.1535 CCCCC 1084.585405 4 0.0002 287 | 2/19
11 h-m-p 0.0001 0.0006 108.4308 CCCC 1084.125113 3 0.0002 315 | 2/19
12 h-m-p 0.0002 0.0038 82.1775 +CYCCC 1081.539833 4 0.0017 345 | 2/19
13 h-m-p 0.0001 0.0005 859.4682 +YYYCYCCCC 1071.067932 8 0.0004 380 | 2/19
14 h-m-p 0.0000 0.0000 11380.4509 +YYCCCCC 1065.089619 6 0.0000 413 | 2/19
15 h-m-p 0.0000 0.0001 2770.3444 YCYCCC 1062.664312 5 0.0000 443 | 2/19
16 h-m-p 0.0001 0.0003 252.2100 CCCC 1062.323820 3 0.0001 471 | 2/19
17 h-m-p 0.0001 0.0006 81.2664 YCC 1062.248962 2 0.0001 496 | 2/19
18 h-m-p 0.0010 0.0231 5.3511 ++CYCCC 1058.728133 4 0.0185 528 | 2/19
19 h-m-p 0.0125 0.0626 2.0230 YCYCCCC 1055.237719 6 0.0306 560 | 2/19
20 h-m-p 0.1473 0.7367 0.3078 YCCC 1047.232123 3 0.2864 587 | 2/19
21 h-m-p 0.0988 0.4939 0.3341 +YYCCC 1038.607896 4 0.3363 633 | 2/19
22 h-m-p 0.2362 1.1808 0.1499 +YCCCC 1032.809395 4 0.6952 680 | 2/19
23 h-m-p 0.4359 2.1793 0.0814 YCC 1031.178780 2 0.7432 722 | 2/19
24 h-m-p 0.8668 4.3339 0.0488 YCYCCC 1027.782378 5 2.3278 769 | 2/19
25 h-m-p 0.5045 2.5226 0.0821 CCY 1027.152894 2 0.5086 812 | 2/19
26 h-m-p 0.6412 3.4023 0.0651 YCC 1026.044485 2 1.3088 854 | 2/19
27 h-m-p 0.9746 4.8731 0.0537 CYCCC 1025.168602 4 1.8676 900 | 2/19
28 h-m-p 1.4770 7.3848 0.0377 CCCC 1024.733964 3 1.7840 945 | 2/19
29 h-m-p 1.6000 8.0000 0.0099 YCCC 1024.379595 3 2.6322 989 | 2/19
30 h-m-p 1.3428 6.7142 0.0050 CCCCC 1024.055952 4 1.9151 1036 | 2/19
31 h-m-p 0.5503 8.0000 0.0174 +CYCCC 1023.715071 4 3.5805 1083 | 2/19
32 h-m-p 1.3193 8.0000 0.0473 +YCC 1022.778610 2 4.2472 1126 | 2/19
33 h-m-p 1.6000 8.0000 0.0154 CCC 1022.039801 2 2.4930 1169 | 2/19
34 h-m-p 1.6000 8.0000 0.0171 CCCC 1021.424344 3 2.2259 1214 | 2/19
35 h-m-p 0.8066 8.0000 0.0471 YC 1021.238339 1 1.8038 1254 | 2/19
36 h-m-p 1.6000 8.0000 0.0032 YCCC 1021.140789 3 2.7755 1298 | 2/19
37 h-m-p 1.6000 8.0000 0.0022 +YC 1020.836723 1 6.7913 1339 | 2/19
38 h-m-p 0.2764 8.0000 0.0529 +YCCC 1020.582564 3 2.0918 1384 | 2/19
39 h-m-p 1.6000 8.0000 0.0116 CYC 1020.435048 2 1.9329 1426 | 2/19
40 h-m-p 1.6000 8.0000 0.0123 CYC 1020.316377 2 1.7877 1468 | 2/19
41 h-m-p 1.6000 8.0000 0.0077 C 1020.281511 0 1.5091 1507 | 2/19
42 h-m-p 1.3539 8.0000 0.0086 +YC 1020.243659 1 3.5174 1548 | 2/19
43 h-m-p 1.6000 8.0000 0.0040 YC 1020.203440 1 2.9173 1588 | 2/19
44 h-m-p 1.6000 8.0000 0.0039 CC 1020.180365 1 2.2982 1629 | 2/19
45 h-m-p 1.6000 8.0000 0.0007 CC 1020.178980 1 1.3459 1670 | 2/19
46 h-m-p 0.6482 8.0000 0.0015 YC 1020.178905 1 1.4644 1710 | 2/19
47 h-m-p 1.6000 8.0000 0.0003 +Y 1020.178789 0 5.2607 1750 | 2/19
48 h-m-p 0.8117 8.0000 0.0016 +YC 1020.178672 1 2.3542 1791 | 2/19
49 h-m-p 1.6000 8.0000 0.0003 C 1020.178642 0 1.4830 1830 | 2/19
50 h-m-p 1.6000 8.0000 0.0000 C 1020.178637 0 1.7941 1869 | 2/19
51 h-m-p 0.4747 8.0000 0.0001 +C 1020.178635 0 2.0483 1909 | 2/19
52 h-m-p 1.6000 8.0000 0.0000 C 1020.178635 0 1.7209 1948 | 2/19
53 h-m-p 1.6000 8.0000 0.0000 Y 1020.178634 0 3.4754 1987 | 2/19
54 h-m-p 1.6000 8.0000 0.0000 +Y 1020.178634 0 4.3428 2027 | 2/19
55 h-m-p 1.6000 8.0000 0.0000 Y 1020.178634 0 1.0692 2066 | 2/19
56 h-m-p 1.6000 8.0000 0.0000 Y 1020.178634 0 1.0034 2105 | 2/19
57 h-m-p 1.6000 8.0000 0.0000 ++ 1020.178634 m 8.0000 2144 | 2/19
58 h-m-p 1.1561 8.0000 0.0000 -Y 1020.178634 0 0.0506 2184 | 2/19
59 h-m-p 0.0511 8.0000 0.0000 -Y 1020.178634 0 0.0032 2224
Out..
lnL = -1020.178634
2225 lfun, 2225 eigenQcodon, 37825 P(t)
Time used: 0:10
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
0.009335 0.008985 0.000232 0.011936 0.008340 0.015699 0.000438 0.005659 0.035617 0.003585 0.040832 0.062058 0.023788 0.034738 0.028382 0.057020 0.016544 1.388155 0.718247 0.265678
ntime & nrate & np: 17 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 8.509626
np = 20
lnL0 = -1042.097375
Iterating by ming2
Initial: fx= 1042.097375
x= 0.00933 0.00898 0.00023 0.01194 0.00834 0.01570 0.00044 0.00566 0.03562 0.00358 0.04083 0.06206 0.02379 0.03474 0.02838 0.05702 0.01654 1.38815 0.71825 0.26568
1 h-m-p 0.0000 0.0000 628.7460 ++ 1041.560356 m 0.0000 25 | 1/20
2 h-m-p 0.0000 0.0000 231.4068 ++ 1041.503582 m 0.0000 48 | 2/20
3 h-m-p 0.0000 0.0003 166.1651 ++YYYYC 1040.198660 4 0.0002 77 | 2/20
4 h-m-p 0.0001 0.0003 439.4609 YCCCC 1038.334931 4 0.0001 107 | 2/20
5 h-m-p 0.0000 0.0001 830.2629 +YYCCCC 1035.334898 5 0.0001 139 | 2/20
6 h-m-p 0.0000 0.0000 3535.3202 +YYCYC 1034.258164 4 0.0000 168 | 2/20
7 h-m-p 0.0000 0.0000 5309.8852 ++ 1022.546217 m 0.0000 191 | 2/20
8 h-m-p 0.0000 0.0000 104.9300
h-m-p: 3.10817450e-21 1.55408725e-20 1.04929959e+02 1022.546217
.. | 2/20
9 h-m-p 0.0000 0.0002 1202.1624 YCYCCC 1018.088597 5 0.0000 242 | 2/20
10 h-m-p 0.0000 0.0002 263.0715 +YYYYC 1012.858414 4 0.0002 270 | 2/20
11 h-m-p 0.0000 0.0002 149.1834 ++ 1010.332856 m 0.0002 293 | 3/20
12 h-m-p 0.0001 0.0003 376.9350 CCCCC 1008.677787 4 0.0001 324 | 3/20
13 h-m-p 0.0002 0.0009 108.1601 CYC 1008.142197 2 0.0002 350 | 3/20
14 h-m-p 0.0001 0.0005 46.6599 CCCC 1008.005652 3 0.0001 379 | 3/20
15 h-m-p 0.0001 0.0019 64.0081 CCC 1007.847976 2 0.0002 406 | 3/20
16 h-m-p 0.0003 0.0026 27.9323 CCC 1007.723998 2 0.0004 433 | 3/20
17 h-m-p 0.0003 0.0015 30.3696 YCC 1007.670634 2 0.0002 459 | 3/20
18 h-m-p 0.0004 0.0032 15.8199 YC 1007.649637 1 0.0002 483 | 3/20
19 h-m-p 0.0004 0.0050 9.1086 YC 1007.642408 1 0.0002 507 | 3/20
20 h-m-p 0.0011 0.0459 1.7899 CC 1007.641643 1 0.0004 532 | 3/20
21 h-m-p 0.0006 0.0365 1.2809 YC 1007.641353 1 0.0003 556 | 3/20
22 h-m-p 0.0005 0.1305 0.7984 +YC 1007.640528 1 0.0014 581 | 3/20
23 h-m-p 0.0003 0.0403 4.2238 +CC 1007.636706 1 0.0012 624 | 3/20
24 h-m-p 0.0004 0.0576 11.6471 ++YCC 1007.581569 2 0.0059 652 | 3/20
25 h-m-p 0.0005 0.0093 134.3499 CCC 1007.508187 2 0.0007 679 | 3/20
26 h-m-p 0.0009 0.0044 34.7279 CC 1007.502943 1 0.0002 704 | 3/20
27 h-m-p 0.0239 4.9051 0.2765 ++CCC 1007.357789 2 0.4500 733 | 3/20
28 h-m-p 0.7435 3.7175 0.0159 YCYCCC 1007.019096 5 1.8501 781 | 3/20
29 h-m-p 1.2495 6.2476 0.0109 YCCC 1006.979270 3 0.6695 826 | 3/20
30 h-m-p 0.5698 8.0000 0.0128 CC 1006.974629 1 0.7028 868 | 3/20
31 h-m-p 1.6000 8.0000 0.0026 YC 1006.974380 1 0.8262 909 | 3/20
32 h-m-p 1.6000 8.0000 0.0001 Y 1006.974363 0 1.0056 949 | 3/20
33 h-m-p 0.6229 8.0000 0.0001 C 1006.974363 0 0.9325 989 | 3/20
34 h-m-p 1.6000 8.0000 0.0000 Y 1006.974363 0 1.0054 1029 | 3/20
35 h-m-p 1.6000 8.0000 0.0000 C 1006.974363 0 0.4490 1069 | 3/20
36 h-m-p 0.6746 8.0000 0.0000 C 1006.974363 0 0.6159 1109 | 3/20
37 h-m-p 1.6000 8.0000 0.0000 ---C 1006.974363 0 0.0099 1152
Out..
lnL = -1006.974363
1153 lfun, 3459 eigenQcodon, 39202 P(t)
Time used: 0:21
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
initial w for M2:NSpselection reset.
0.009335 0.008985 0.000232 0.011936 0.008340 0.015699 0.000438 0.005659 0.035617 0.003585 0.040832 0.062058 0.023788 0.034738 0.028382 0.057020 0.016544 1.479890 1.659473 0.574115 0.238709 2.403915
ntime & nrate & np: 17 3 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.463271
np = 22
lnL0 = -1047.360477
Iterating by ming2
Initial: fx= 1047.360477
x= 0.00933 0.00898 0.00023 0.01194 0.00834 0.01570 0.00044 0.00566 0.03562 0.00358 0.04083 0.06206 0.02379 0.03474 0.02838 0.05702 0.01654 1.47989 1.65947 0.57412 0.23871 2.40392
1 h-m-p 0.0000 0.0000 624.6979 ++ 1046.787803 m 0.0000 27 | 1/22
2 h-m-p 0.0000 0.0000 228.2322 ++ 1046.727547 m 0.0000 52 | 2/22
3 h-m-p 0.0000 0.0004 136.5158 ++YYYYYC 1045.756603 5 0.0002 84 | 2/22
4 h-m-p 0.0000 0.0002 250.8104 CCC 1045.340853 2 0.0001 113 | 2/22
5 h-m-p 0.0001 0.0003 249.6749 +YYCCC 1044.115966 4 0.0002 145 | 2/22
6 h-m-p 0.0001 0.0003 287.0142 +YCYCCC 1042.500758 5 0.0002 179 | 2/22
7 h-m-p 0.0000 0.0001 1690.5040 ++ 1035.849185 m 0.0001 204 | 3/22
8 h-m-p 0.0005 0.0023 19.3793 CCC 1035.653971 2 0.0006 233 | 3/22
9 h-m-p 0.0001 0.0004 142.9293 YCCCC 1034.209528 4 0.0002 265 | 3/22
10 h-m-p 0.0002 0.0010 75.8451 CYCCC 1033.749790 4 0.0004 297 | 3/22
11 h-m-p 0.0004 0.0070 75.8845 ++YYCCCC 1029.669696 5 0.0046 332 | 3/22
12 h-m-p 0.0002 0.0008 1022.3254 YCCCC 1025.946721 4 0.0004 364 | 3/22
13 h-m-p 0.0003 0.0014 313.0041 YCYCCC 1023.816496 5 0.0006 397 | 3/22
14 h-m-p 0.0002 0.0011 241.2394 CYCCC 1022.877455 4 0.0004 429 | 3/22
15 h-m-p 0.0004 0.0019 79.9882 YCC 1022.672621 2 0.0003 457 | 3/22
16 h-m-p 0.0014 0.0135 15.7008 CCC 1022.497266 2 0.0015 486 | 3/22
17 h-m-p 0.0014 0.0074 16.3990 CYCCC 1022.069947 4 0.0027 518 | 3/22
18 h-m-p 0.0003 0.0073 163.2640 ++YCCCC 1017.869721 4 0.0030 552 | 3/22
19 h-m-p 0.1833 0.9165 1.2155 +YYCCC 1012.867721 4 0.5599 584 | 3/22
20 h-m-p 0.1290 0.6452 1.5449 +YCYCCC 1010.983112 5 0.3914 618 | 3/22
21 h-m-p 0.0945 0.4723 2.1011 YCCCCC 1009.944221 5 0.2004 652 | 3/22
22 h-m-p 0.1181 0.5907 2.5976 YYCC 1009.479512 3 0.0815 681 | 3/22
23 h-m-p 0.1502 0.7510 0.7444 CYCCC 1008.965614 4 0.2859 713 | 3/22
24 h-m-p 0.8351 5.7230 0.2548 CYCCC 1008.315413 4 0.7326 764 | 2/22
25 h-m-p 0.1501 1.1075 1.2439 ---YC 1008.315186 1 0.0004 812 | 2/22
26 h-m-p 0.0008 0.1215 0.6302 ++++ 1008.046691 m 0.1215 839 | 3/22
27 h-m-p 0.1376 7.2493 0.5568 +YCCC 1007.160272 3 1.3029 890 | 3/22
28 h-m-p 1.6000 8.0000 0.1192 YCC 1007.041766 2 1.0382 937 | 3/22
29 h-m-p 0.6061 8.0000 0.2042 +YC 1006.962759 1 1.8624 983 | 3/22
30 h-m-p 0.9555 8.0000 0.3980 YCCC 1006.853715 3 2.1075 1032 | 3/22
31 h-m-p 1.4129 8.0000 0.5937 CCCC 1006.683783 3 2.1062 1082 | 3/22
32 h-m-p 1.5162 7.5812 0.2629 YYC 1006.570184 2 1.3185 1128 | 3/22
33 h-m-p 1.6000 8.0000 0.1751 YC 1006.533335 1 0.9267 1173 | 3/22
34 h-m-p 0.6164 8.0000 0.2632 YC 1006.492620 1 1.3603 1218 | 3/22
35 h-m-p 1.6000 8.0000 0.1995 CC 1006.439071 1 2.4527 1264 | 3/22
36 h-m-p 1.6000 8.0000 0.2802 CCC 1006.396889 2 2.4304 1312 | 3/22
37 h-m-p 1.6000 8.0000 0.0972 CCC 1006.373540 2 1.6425 1360 | 3/22
38 h-m-p 0.8798 8.0000 0.1814 CC 1006.366650 1 1.1688 1406 | 3/22
39 h-m-p 1.6000 8.0000 0.0932 CC 1006.358493 1 2.2563 1452 | 3/22
40 h-m-p 1.6000 8.0000 0.0593 CC 1006.353805 1 1.9802 1498 | 3/22
41 h-m-p 1.6000 8.0000 0.0286 CC 1006.351387 1 2.5538 1544 | 3/22
42 h-m-p 1.6000 8.0000 0.0380 YC 1006.348973 1 2.7539 1589 | 3/22
43 h-m-p 1.6000 8.0000 0.0094 C 1006.348191 0 1.6332 1633 | 3/22
44 h-m-p 1.6000 8.0000 0.0062 C 1006.348048 0 2.0320 1677 | 3/22
45 h-m-p 1.6000 8.0000 0.0022 +YC 1006.347699 1 5.3682 1723 | 3/22
46 h-m-p 0.9304 8.0000 0.0129 YC 1006.347366 1 2.0411 1768 | 3/22
47 h-m-p 1.6000 8.0000 0.0046 C 1006.347330 0 1.3161 1812 | 3/22
48 h-m-p 1.6000 8.0000 0.0018 C 1006.347328 0 1.6905 1856 | 3/22
49 h-m-p 1.6000 8.0000 0.0005 ++ 1006.347322 m 8.0000 1900 | 3/22
50 h-m-p 1.5718 8.0000 0.0024 C 1006.347317 0 2.1864 1944 | 3/22
51 h-m-p 1.6000 8.0000 0.0007 Y 1006.347317 0 1.1110 1988 | 3/22
52 h-m-p 1.6000 8.0000 0.0001 Y 1006.347317 0 1.0648 2032 | 3/22
53 h-m-p 1.6000 8.0000 0.0000 ---Y 1006.347317 0 0.0063 2079
Out..
lnL = -1006.347317
2080 lfun, 8320 eigenQcodon, 106080 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1018.143048 S = -979.788111 -30.679427
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 83 patterns 0:51
did 20 / 83 patterns 0:51
did 30 / 83 patterns 0:51
did 40 / 83 patterns 0:51
did 50 / 83 patterns 0:51
did 60 / 83 patterns 0:51
did 70 / 83 patterns 0:51
did 80 / 83 patterns 0:51
did 83 / 83 patterns 0:52
Time used: 0:52
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
0.009335 0.008985 0.000232 0.011936 0.008340 0.015699 0.000438 0.005659 0.035617 0.003585 0.040832 0.062058 0.023788 0.034738 0.028382 0.057020 0.016544 1.555258 0.339697 0.499728 0.039772 0.083622 0.162725
ntime & nrate & np: 17 4 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 17.069986
np = 23
lnL0 = -1021.757333
Iterating by ming2
Initial: fx= 1021.757333
x= 0.00933 0.00898 0.00023 0.01194 0.00834 0.01570 0.00044 0.00566 0.03562 0.00358 0.04083 0.06206 0.02379 0.03474 0.02838 0.05702 0.01654 1.55526 0.33970 0.49973 0.03977 0.08362 0.16272
1 h-m-p 0.0000 0.0000 580.0916 ++ 1021.311156 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0000 229.5933 ++ 1021.259890 m 0.0000 54 | 2/23
3 h-m-p 0.0000 0.0003 117.5094 ++YYCCC 1020.702012 4 0.0001 88 | 2/23
4 h-m-p 0.0001 0.0003 170.0634 +YC 1019.870890 1 0.0002 116 | 2/23
5 h-m-p 0.0000 0.0001 343.8310 ++ 1019.073815 m 0.0001 142 | 3/23
6 h-m-p 0.0001 0.0003 256.2500 +CCC 1018.269043 2 0.0002 173 | 3/23
7 h-m-p 0.0000 0.0000 687.6492 ++ 1017.638316 m 0.0000 199 | 4/23
8 h-m-p 0.0002 0.0025 103.1827 YCCC 1017.351025 3 0.0003 230 | 4/23
9 h-m-p 0.0003 0.0016 26.5177 CCCC 1016.681133 3 0.0005 262 | 4/23
10 h-m-p 0.0002 0.0012 85.2312 YCCC 1015.743879 3 0.0004 293 | 4/23
11 h-m-p 0.0002 0.0008 167.7846 YCCC 1015.389905 3 0.0001 324 | 4/23
12 h-m-p 0.0002 0.0012 103.6345 CCCC 1014.878959 3 0.0003 356 | 4/23
13 h-m-p 0.0003 0.0018 98.0815 YYC 1014.527467 2 0.0003 384 | 4/23
14 h-m-p 0.0008 0.0042 24.5770 CCC 1014.494247 2 0.0002 414 | 4/23
15 h-m-p 0.0003 0.0070 13.3606 CC 1014.476854 1 0.0003 442 | 4/23
16 h-m-p 0.0007 0.0259 4.9838 CC 1014.457870 1 0.0011 470 | 4/23
17 h-m-p 0.0005 0.0695 9.8497 ++YCCC 1013.960580 3 0.0142 503 | 4/23
18 h-m-p 0.0005 0.0023 170.6456 CCCCC 1013.615896 4 0.0005 537 | 4/23
19 h-m-p 0.0150 0.8478 6.0235 ++YYYYC 1010.468524 4 0.2280 569 | 4/23
20 h-m-p 0.2723 1.3617 2.2476 YCCCC 1009.976777 4 0.1657 602 | 4/23
21 h-m-p 0.5830 2.9150 0.3326 YCCCC 1008.642087 4 1.1473 635 | 4/23
22 h-m-p 0.9774 8.0000 0.3904 CCCC 1007.772998 3 1.4280 686 | 4/23
23 h-m-p 1.6000 8.0000 0.1212 CYC 1007.297269 2 1.3578 734 | 4/23
24 h-m-p 0.5333 5.6793 0.3085 YCCC 1007.139962 3 0.9058 784 | 4/23
25 h-m-p 1.3331 6.6654 0.0748 CYC 1007.026836 2 1.2775 832 | 4/23
26 h-m-p 1.6000 8.0000 0.0280 CCC 1007.002116 2 1.4400 881 | 4/23
27 h-m-p 1.1186 8.0000 0.0360 C 1006.994754 0 1.0998 926 | 4/23
28 h-m-p 1.6000 8.0000 0.0241 CC 1006.988809 1 2.0513 973 | 4/23
29 h-m-p 1.6000 8.0000 0.0064 CC 1006.984704 1 2.5160 1020 | 4/23
30 h-m-p 1.0300 8.0000 0.0157 +YC 1006.979171 1 2.7392 1067 | 4/23
31 h-m-p 1.6000 8.0000 0.0074 CC 1006.975877 1 2.1287 1114 | 4/23
32 h-m-p 1.6000 8.0000 0.0096 C 1006.974378 0 1.7037 1159 | 4/23
33 h-m-p 1.6000 8.0000 0.0039 C 1006.974210 0 1.2926 1204 | 4/23
34 h-m-p 1.6000 8.0000 0.0016 Y 1006.974197 0 1.0904 1249 | 4/23
35 h-m-p 1.6000 8.0000 0.0002 Y 1006.974196 0 1.0186 1294 | 4/23
36 h-m-p 1.6000 8.0000 0.0000 Y 1006.974196 0 1.0754 1339 | 4/23
37 h-m-p 1.6000 8.0000 0.0000 Y 1006.974196 0 1.1123 1384 | 4/23
38 h-m-p 1.6000 8.0000 0.0000 ++ 1006.974196 m 8.0000 1429 | 4/23
39 h-m-p 1.1649 8.0000 0.0000 ---------------Y 1006.974196 0 0.0000 1489
Out..
lnL = -1006.974196
1490 lfun, 5960 eigenQcodon, 75990 P(t)
Time used: 1:12
Model 7: beta
TREE # 1
(1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
0.009335 0.008985 0.000232 0.011936 0.008340 0.015699 0.000438 0.005659 0.035617 0.003585 0.040832 0.062058 0.023788 0.034738 0.028382 0.057020 0.016544 1.482484 0.309823 1.349954
ntime & nrate & np: 17 1 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 13.710221
np = 20
lnL0 = -1020.726143
Iterating by ming2
Initial: fx= 1020.726143
x= 0.00933 0.00898 0.00023 0.01194 0.00834 0.01570 0.00044 0.00566 0.03562 0.00358 0.04083 0.06206 0.02379 0.03474 0.02838 0.05702 0.01654 1.48248 0.30982 1.34995
1 h-m-p 0.0000 0.0000 578.3549 ++ 1020.261974 m 0.0000 25 | 1/20
2 h-m-p 0.0000 0.0000 224.1899 ++ 1020.209937 m 0.0000 48 | 2/20
3 h-m-p 0.0000 0.0003 109.6449 ++YYCC 1019.674668 3 0.0001 77 | 2/20
4 h-m-p 0.0001 0.0006 140.9283 CYC 1019.252627 2 0.0001 103 | 2/20
5 h-m-p 0.0000 0.0002 190.3766 YCCCC 1018.813616 4 0.0001 133 | 2/20
6 h-m-p 0.0001 0.0007 228.1582 +YYYCCCCC 1017.101307 7 0.0003 168 | 2/20
7 h-m-p 0.0000 0.0002 763.0696 YCCCCC 1015.604736 5 0.0001 200 | 2/20
8 h-m-p 0.0000 0.0002 631.6117 CCCCC 1014.927442 4 0.0001 231 | 2/20
9 h-m-p 0.0001 0.0005 156.4844 CCCCC 1014.576844 4 0.0001 262 | 2/20
10 h-m-p 0.0007 0.0037 15.3063 YC 1014.544988 1 0.0003 286 | 2/20
11 h-m-p 0.0002 0.0068 20.3559 YC 1014.535947 1 0.0001 310 | 2/20
12 h-m-p 0.0003 0.0178 5.5906 CC 1014.528460 1 0.0005 335 | 2/20
13 h-m-p 0.0005 0.0741 5.2492 ++C 1014.421201 0 0.0076 360 | 2/20
14 h-m-p 0.0004 0.0061 113.9327 +CCCCC 1013.933039 4 0.0015 392 | 2/20
15 h-m-p 0.0004 0.0021 236.8137 CCCC 1013.640487 3 0.0004 421 | 2/20
16 h-m-p 0.0007 0.0033 153.0502 YYC 1013.415372 2 0.0005 446 | 2/20
17 h-m-p 0.0319 0.1597 1.2570 YCCC 1013.362853 3 0.0174 474 | 2/20
18 h-m-p 0.0003 0.0192 79.3749 ++YCCCCC 1012.264339 5 0.0053 508 | 2/20
19 h-m-p 0.2262 1.1310 1.3309 +YCCC 1010.438232 3 0.6322 537 | 2/20
20 h-m-p 0.2219 1.1094 0.9580 +YYYCYC 1008.477001 5 0.8237 567 | 2/20
21 h-m-p 0.0253 0.1264 1.8597 +YCYC 1008.121629 3 0.1085 613 | 2/20
22 h-m-p 0.7195 4.4257 0.2803 YCYC 1007.774748 3 0.4119 640 | 2/20
23 h-m-p 0.1826 0.9129 0.5035 YCCC 1007.340614 3 0.2133 686 | 2/20
24 h-m-p 0.7205 3.6023 0.0762 CCCC 1007.206088 3 0.9496 733 | 2/20
25 h-m-p 1.3261 6.6303 0.0256 YYYC 1007.167524 3 1.1021 777 | 2/20
26 h-m-p 0.5149 2.5746 0.0394 CYCCC 1007.149148 4 0.7590 825 | 2/20
27 h-m-p 0.5469 2.7344 0.0269 YC 1007.136663 1 1.2540 867 | 2/20
28 h-m-p 0.1782 0.8909 0.0283 +YYCYC 1007.125372 4 0.5874 914 | 2/20
29 h-m-p 1.3479 8.0000 0.0123 CCC 1007.118216 2 1.2549 959 | 2/20
30 h-m-p 0.2170 1.0849 0.0138 +CC 1007.113205 1 0.8611 1003 | 2/20
31 h-m-p 1.1693 8.0000 0.0102 YC 1007.112819 1 0.5990 1045 | 2/20
32 h-m-p 1.5274 8.0000 0.0040 YC 1007.112469 1 1.2018 1087 | 2/20
33 h-m-p 0.8866 8.0000 0.0054 C 1007.112417 0 0.8866 1128 | 2/20
34 h-m-p 0.7223 8.0000 0.0067 C 1007.112412 0 0.2520 1169 | 2/20
35 h-m-p 0.2313 8.0000 0.0072 C 1007.112409 0 0.1915 1210 | 2/20
36 h-m-p 0.1798 8.0000 0.0077 C 1007.112408 0 0.1519 1251 | 2/20
37 h-m-p 0.1458 8.0000 0.0080 C 1007.112407 0 0.1382 1292 | 2/20
38 h-m-p 0.1359 8.0000 0.0082 C 1007.112406 0 0.1310 1333 | 2/20
39 h-m-p 0.1306 8.0000 0.0082 C 1007.112406 0 0.1251 1374 | 2/20
40 h-m-p 0.1257 8.0000 0.0082 C 1007.112405 0 0.1179 1415 | 2/20
41 h-m-p 0.1190 8.0000 0.0081 C 1007.112405 0 0.1084 1456 | 2/20
42 h-m-p 0.1096 8.0000 0.0080 C 1007.112404 0 0.0965 1497 | 2/20
43 h-m-p 0.0977 8.0000 0.0079 C 1007.112404 0 0.0828 1538 | 2/20
44 h-m-p 0.0839 8.0000 0.0078 C 1007.112404 0 0.0686 1579 | 2/20
45 h-m-p 0.0694 8.0000 0.0077 Y 1007.112404 0 0.0549 1620 | 2/20
46 h-m-p 0.0555 8.0000 0.0076 Y 1007.112404 0 0.0427 1661 | 2/20
47 h-m-p 0.0432 8.0000 0.0075 Y 1007.112404 0 0.0325 1702 | 2/20
48 h-m-p 0.0328 8.0000 0.0075 Y 1007.112404 0 0.0243 1743 | 2/20
49 h-m-p 0.0245 8.0000 0.0074 Y 1007.112404 0 0.0179 1784 | 2/20
50 h-m-p 0.0180 8.0000 0.0074 Y 1007.112404 0 0.0131 1825 | 2/20
51 h-m-p 0.0160 8.0000 0.0074 Y 1007.112404 0 0.0095 1866 | 2/20
52 h-m-p 0.0160 8.0000 0.0073 Y 1007.112404 0 0.0068 1907 | 2/20
53 h-m-p 0.0160 8.0000 0.0073 C 1007.112404 0 0.0050 1948 | 2/20
54 h-m-p 0.0160 8.0000 0.0073 C 1007.112404 0 0.0035 1989 | 2/20
55 h-m-p 0.0160 8.0000 0.0073 Y 1007.112404 0 0.0026 2030 | 2/20
56 h-m-p 0.0160 8.0000 0.0073 -Y 1007.112404 0 0.0018 2072 | 2/20
57 h-m-p 0.0160 8.0000 0.0073 -C 1007.112404 0 0.0011 2114 | 2/20
58 h-m-p 0.0160 8.0000 0.0073 -C 1007.112404 0 0.0010 2156 | 2/20
59 h-m-p 0.0160 8.0000 0.0073 -C 1007.112404 0 0.0010 2198 | 2/20
60 h-m-p 0.0160 8.0000 0.0073 ----Y 1007.112404 0 0.0000 2243 | 2/20
61 h-m-p 0.0160 8.0000 0.0069 C 1007.112404 0 0.0172 2284 | 2/20
62 h-m-p 0.0164 8.0000 0.0072 ------C 1007.112404 0 0.0000 2331 | 2/20
63 h-m-p 0.0160 8.0000 0.0681 -----------N 1007.112404 0 0.0000 2383 | 2/20
64 h-m-p 0.0160 8.0000 0.0005 +++C 1007.112398 0 1.0240 2427 | 2/20
65 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.05, 0.00766, 0.11124) = 1.191776e-161 2000 rounds
Y 1007.112397 0 0.9204 2468 | 2/20
66 h-m-p 0.4585 8.0000 0.0003 Y 1007.112397 0 0.3068 2509 | 2/20
67 h-m-p 0.2022 8.0000 0.0005 -Y 1007.112397 0 0.0232 2551 | 2/20
68 h-m-p 0.0160 8.0000 0.0008 -------------.. | 2/20
69 h-m-p 0.0004 0.1885 0.0718 C 1007.112396 0 0.0001 2644 | 2/20
70 h-m-p 0.0024 1.1919 0.0803
QuantileBeta(0.05, 0.00768, 0.11067) = 2.538439e-161 2000 rounds
----------C 1007.112396 0 0.0000 2695 | 2/20
71 h-m-p 0.0008 0.4143 0.0787 -C 1007.112396 0 0.0001 2737 | 2/20
72 h-m-p 0.0025 1.2251 0.0425 -C 1007.112396 0 0.0002 2779 | 2/20
73 h-m-p 0.0054 2.7068 0.0305 --C 1007.112396 0 0.0001 2822 | 2/20
74 h-m-p 0.0015 0.7425 0.0509 --C 1007.112396 0 0.0000 2865 | 2/20
75 h-m-p 0.0026 1.3206 0.1582 ----------Y 1007.112396 0 0.0000 2916 | 2/20
76 h-m-p 0.0007 0.3322 2.2360
QuantileBeta(0.05, 0.00770, 0.11208) = 8.975605e-161 2000 rounds
-----------.. | 2/20
77 h-m-p 0.0001 0.0270 0.0975 Y 1007.112396 0 0.0000 2989 | 2/20
78 h-m-p 0.0021 1.0358 0.0159 -Y 1007.112396 0 0.0001 3031 | 2/20
79 h-m-p 0.0104 5.1874 0.0104 ---Y 1007.112396 0 0.0001 3075 | 2/20
80 h-m-p 0.0160 8.0000 0.0070 --Y 1007.112396 0 0.0002 3118 | 2/20
81 h-m-p 0.0160 8.0000 0.0082 --Y 1007.112396 0 0.0002 3161 | 2/20
82 h-m-p 0.0030 1.5080 0.0211 ---Y 1007.112396 0 0.0000 3205 | 2/20
83 h-m-p 0.0102 5.0889 0.0278 ---C 1007.112396 0 0.0001 3249 | 2/20
84 h-m-p 0.0148 7.3881 0.0234 ---Y 1007.112396 0 0.0001 3293 | 2/20
85 h-m-p 0.0107 5.3310 0.0268 --Y 1007.112396 0 0.0001 3336 | 2/20
86 h-m-p 0.0160 8.0000 0.0231 --C 1007.112396 0 0.0003 3379 | 2/20
87 h-m-p 0.0160 8.0000 0.0211 -C 1007.112396 0 0.0012 3421 | 2/20
88 h-m-p 0.0118 5.8999 0.1914 -C 1007.112396 0 0.0008 3463 | 2/20
89 h-m-p 0.0039 1.9541 0.4796 -C 1007.112396 0 0.0003 3505 | 2/20
90 h-m-p 0.0101 5.0564 0.1989 -C 1007.112396 0 0.0005 3547 | 2/20
91 h-m-p 0.0160 8.0000 0.0186 --C 1007.112396 0 0.0002 3590 | 2/20
92 h-m-p 0.0126 6.2929 0.0102 --C 1007.112396 0 0.0002 3633 | 2/20
93 h-m-p 0.0160 8.0000 0.0005 --Y 1007.112396 0 0.0004 3676 | 2/20
94 h-m-p 0.0160 8.0000 0.0002 --C 1007.112396 0 0.0003 3719 | 2/20
95 h-m-p 0.0160 8.0000 0.0003 ------Y 1007.112396 0 0.0000 3766
Out..
lnL = -1007.112396
3767 lfun, 41437 eigenQcodon, 640390 P(t)
Time used: 4:32
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
initial w for M8:NSbetaw>1 reset.
0.009335 0.008985 0.000232 0.011936 0.008340 0.015699 0.000438 0.005659 0.035617 0.003585 0.040832 0.062058 0.023788 0.034738 0.028382 0.057020 0.016544 1.470393 0.900000 0.966220 1.075304 2.140227
ntime & nrate & np: 17 2 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.747190
np = 22
lnL0 = -1047.697256
Iterating by ming2
Initial: fx= 1047.697256
x= 0.00933 0.00898 0.00023 0.01194 0.00834 0.01570 0.00044 0.00566 0.03562 0.00358 0.04083 0.06206 0.02379 0.03474 0.02838 0.05702 0.01654 1.47039 0.90000 0.96622 1.07530 2.14023
1 h-m-p 0.0000 0.0000 623.8514 ++ 1047.146956 m 0.0000 27 | 1/22
2 h-m-p 0.0000 0.0000 232.3421 ++ 1047.087596 m 0.0000 52 | 2/22
3 h-m-p 0.0000 0.0003 162.9016 ++YYYYYC 1045.771714 5 0.0002 84 | 2/22
4 h-m-p 0.0000 0.0002 362.9148 YCCC 1044.886561 3 0.0001 114 | 2/22
5 h-m-p 0.0000 0.0002 396.2304 +YCYCCC 1043.495870 5 0.0001 148 | 2/22
6 h-m-p 0.0000 0.0001 309.6675 +CYC 1042.510906 2 0.0001 177 | 2/22
7 h-m-p 0.0000 0.0000 485.5890 ++ 1042.221303 m 0.0000 202 | 2/22
8 h-m-p 0.0000 0.0000 43.0407
h-m-p: 0.00000000e+00 0.00000000e+00 4.30407207e+01 1042.221303
.. | 2/22
9 h-m-p 0.0000 0.0002 558.3582 +CYYCC 1038.465903 4 0.0000 256 | 2/22
10 h-m-p 0.0000 0.0002 83.7695 YCYCCC 1038.132947 5 0.0001 289 | 2/22
11 h-m-p 0.0001 0.0013 74.7091 YC 1037.709405 1 0.0002 315 | 2/22
12 h-m-p 0.0002 0.0011 81.3048 YYC 1037.443239 2 0.0002 342 | 2/22
13 h-m-p 0.0001 0.0006 64.3493 YCCC 1037.192666 3 0.0003 372 | 2/22
14 h-m-p 0.0000 0.0001 174.7417 ++ 1036.882706 m 0.0001 397 | 2/22
15 h-m-p 0.0000 0.0000 304.7433
h-m-p: 0.00000000e+00 0.00000000e+00 3.04743281e+02 1036.882706
.. | 2/22
16 h-m-p 0.0000 0.0003 79.1054 +YC 1036.594871 1 0.0001 446 | 2/22
17 h-m-p 0.0001 0.0005 68.7320 CCC 1036.399019 2 0.0001 475 | 2/22
18 h-m-p 0.0001 0.0010 70.4915 YCCC 1036.065440 3 0.0003 505 | 2/22
19 h-m-p 0.0002 0.0010 105.7971 CCC 1035.864411 2 0.0001 534 | 2/22
20 h-m-p 0.0001 0.0008 137.6231 YCCC 1035.397486 3 0.0003 564 | 2/22
21 h-m-p 0.0000 0.0002 330.8670 ++ 1033.752918 m 0.0002 589 | 2/22
22 h-m-p 0.0000 0.0002 3908.1171 +YCYYCCCC 1014.356142 7 0.0002 627 | 2/22
23 h-m-p 0.0000 0.0001 1910.4286 CYCCCC 1013.803331 5 0.0000 661 | 2/22
24 h-m-p 0.0001 0.0004 88.4876 YYYC 1013.727048 3 0.0001 689 | 2/22
25 h-m-p 0.0003 0.0036 20.7483 YCCC 1013.609752 3 0.0008 719 | 2/22
26 h-m-p 0.0001 0.0019 109.4250 YCCC 1013.396569 3 0.0003 749 | 2/22
27 h-m-p 0.0001 0.0009 280.6153 +YYCCC 1012.704904 4 0.0004 781 | 2/22
28 h-m-p 0.0002 0.0018 642.5543 YCCC 1011.539725 3 0.0003 811 | 2/22
29 h-m-p 0.0002 0.0012 114.2943 YCC 1011.421704 2 0.0002 839 | 2/22
30 h-m-p 0.0003 0.0016 17.3472 YCC 1011.411367 2 0.0001 867 | 2/22
31 h-m-p 0.0006 0.0560 3.8938 +CC 1011.392625 1 0.0021 895 | 2/22
32 h-m-p 0.0013 0.0300 6.2344 YC 1011.361650 1 0.0022 921 | 2/22
33 h-m-p 0.0002 0.0098 56.5191 +YCCC 1011.085504 3 0.0021 952 | 2/22
34 h-m-p 0.0002 0.0026 638.0836 +YCYCCC 1008.300153 5 0.0016 986 | 2/22
35 h-m-p 1.0258 5.1289 0.1999 YYC 1007.739126 2 0.8833 1013 | 2/22
36 h-m-p 0.7397 6.3723 0.2387 YCCC 1007.685094 3 0.4984 1063 | 2/22
37 h-m-p 0.6668 3.3340 0.1372 YYC 1007.635933 2 0.4724 1110 | 2/22
38 h-m-p 0.6733 7.5714 0.0962 YCCC 1007.579892 3 1.5004 1160 | 2/22
39 h-m-p 1.1934 8.0000 0.1210 +CCC 1007.449921 2 4.9556 1210 | 2/22
40 h-m-p 0.8712 4.5755 0.6883 CYYCCC 1007.061451 5 2.1369 1264 | 2/22
41 h-m-p 0.1509 0.7543 2.2955 CYCYC 1006.849869 4 0.2949 1316 | 2/22
42 h-m-p 0.0723 0.3613 2.8562 +YYYYYYYYYC 1006.217847 10 0.2892 1352 | 2/22
43 h-m-p 0.0420 0.2100 0.7095 YYCC 1006.197918 3 0.0342 1381 | 2/22
44 h-m-p 0.0732 0.4249 0.3312 +YYCYC 1006.094717 4 0.2367 1432 | 2/22
45 h-m-p 0.0564 0.4895 1.3892 CYC 1006.031129 2 0.0589 1480 | 2/22
46 h-m-p 1.2736 8.0000 0.0643 YCC 1006.002813 2 0.8777 1508 | 2/22
47 h-m-p 1.6000 8.0000 0.0152 YC 1005.998938 1 1.1146 1554 | 2/22
48 h-m-p 1.2810 8.0000 0.0132 YC 1005.998021 1 0.9780 1600 | 2/22
49 h-m-p 1.6000 8.0000 0.0017 CC 1005.997676 1 1.3066 1647 | 2/22
50 h-m-p 1.3678 8.0000 0.0016 C 1005.997607 0 1.9232 1692 | 2/22
51 h-m-p 1.6000 8.0000 0.0007 Y 1005.997582 0 2.7241 1737 | 2/22
52 h-m-p 1.6000 8.0000 0.0008 +YC 1005.997547 1 4.1653 1784 | 2/22
53 h-m-p 1.6000 8.0000 0.0014 YC 1005.997495 1 3.1061 1830 | 2/22
54 h-m-p 1.6000 8.0000 0.0015 C 1005.997460 0 2.0250 1875 | 2/22
55 h-m-p 1.6000 8.0000 0.0010 C 1005.997442 0 2.0199 1920 | 2/22
56 h-m-p 1.6000 8.0000 0.0005 Y 1005.997439 0 1.0104 1965 | 2/22
57 h-m-p 0.5099 8.0000 0.0009 ++ 1005.997426 m 8.0000 2010 | 2/22
58 h-m-p 1.6000 8.0000 0.0016 -----------Y 1005.997426 0 0.0000 2066 | 2/22
59 h-m-p 0.0160 8.0000 0.1725 -------------.. | 2/22
60 h-m-p 0.0001 0.0671 0.1793 Y 1005.997425 0 0.0000 2167 | 2/22
61 h-m-p 0.0000 0.0177 0.7368 C 1005.997425 0 0.0000 2212 | 2/22
62 h-m-p 0.0004 0.2027 0.1730 C 1005.997424 0 0.0001 2257 | 2/22
63 h-m-p 0.0017 0.8745 0.0580 -C 1005.997424 0 0.0002 2303 | 2/22
64 h-m-p 0.0005 0.2536 0.0778 Y 1005.997424 0 0.0001 2348 | 2/22
65 h-m-p 0.0026 1.3137 0.0458 -Y 1005.997424 0 0.0001 2394 | 2/22
66 h-m-p 0.0160 8.0000 0.0162 --Y 1005.997424 0 0.0002 2441 | 2/22
67 h-m-p 0.0022 1.0926 0.0134 -Y 1005.997423 0 0.0001 2487 | 2/22
68 h-m-p 0.0126 6.2793 0.0101 ---C 1005.997423 0 0.0000 2535 | 2/22
69 h-m-p 0.0160 8.0000 0.0034 -------------.. | 2/22
70 h-m-p 0.0155 7.7481 0.1905 ------------- | 2/22
71 h-m-p 0.0155 7.7481 0.1905 -------------
Out..
lnL = -1005.997423
2704 lfun, 32448 eigenQcodon, 505648 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1019.960803 S = -980.315932 -32.406001
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 83 patterns 6:52
did 20 / 83 patterns 6:53
did 30 / 83 patterns 6:53
did 40 / 83 patterns 6:53
did 50 / 83 patterns 6:53
did 60 / 83 patterns 6:53
did 70 / 83 patterns 6:54
did 80 / 83 patterns 6:54
did 83 / 83 patterns 6:54
Time used: 6:54
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=165
D_melanogaster_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_sechellia_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_simulans_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_yakuba_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_erecta_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_biarmipes_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_suzukii_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS
D_eugracilis_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_ficusphila_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_elegans_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
D_takahashii_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES
************************************************:*
D_melanogaster_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_sechellia_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_simulans_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_yakuba_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_erecta_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_biarmipes_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_suzukii_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_eugracilis_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_ficusphila_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF
D_elegans_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
D_takahashii_Zasp66-PG YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF
**************************************:***********
D_melanogaster_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
D_sechellia_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKDQLAEQQR
D_simulans_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKEQLAEQQR
D_yakuba_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
D_erecta_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR
D_biarmipes_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
D_suzukii_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
D_eugracilis_Zasp66-PG NSPIGLYSNSNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
D_ficusphila_Zasp66-PG NSPIGLYSNHNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR
D_elegans_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLERKRVILEQQKQKDQLAEQQR
D_takahashii_Zasp66-PG NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR
********* ********************:** ********:*******
D_melanogaster_Zasp66-PG QQRQHQLQILYQQNK
D_sechellia_Zasp66-PG QQRQQQLQILYQQNK
D_simulans_Zasp66-PG QQRQQQLQILYQQNK
D_yakuba_Zasp66-PG QQRQHQLQILYQQNK
D_erecta_Zasp66-PG QQRQHQLQILYQQNK
D_biarmipes_Zasp66-PG LQRQQQLQLLYQQNK
D_suzukii_Zasp66-PG QQRQQQLQLLYQQNK
D_eugracilis_Zasp66-PG QQRQQQLQLLYQQNK
D_ficusphila_Zasp66-PG QQRQQQLQILYQQNK
D_elegans_Zasp66-PG QQRQQQLQLLYQQNK
D_takahashii_Zasp66-PG QQRQQQLQLLYQQNK
***:***:******
>D_melanogaster_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATTGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA TTATTCTGGAGCAACAAAAGCAAAAAGACCAACTGGCAGAGCAACAACGT CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA >D_sechellia_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTG TTATTCTGGAGCAACAAAAGCAAAAAGACCAACTGGCAGAGCAACAACGT CAACAACGCCAGCAACAACTGCAAATACTCTATCAACAAAACAAA >D_simulans_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCTATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTG TTATTCTGGAGCAACAAAAGCAAAAAGAGCAACTGGCAGAGCAACAACGT CAACAACGCCAGCAACAACTGCAAATACTCTATCAACAAAACAAA >D_yakuba_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA TTATTCTGGAGCAACAAAAGCAAAAAGAACAACTTGCAGAGCAACAACGT CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA >D_erecta_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATTCAATACCAACCCTACCGTACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGTGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAAGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA TTATTCTGGAGCAACAAAAGCAAAAAGAACAACTTGCAGAGCAACAACGT CAACAACGCCAGCATCAACTGCAAATACTCTATCAACAAAACAAA >D_biarmipes_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAGTGCATCCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA AGGTTGTCGGTTCTGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCTACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT CTACAGCGCCAGCAGCAACTGCAACTACTCTATCAACAAAACAAA >D_suzukii_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGAACAACTCCTC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGATTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGATACCATGCTGCACA AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT CAGCAACGCCAACAGCAACTGCAACTACTTTATCAACAAAACAAA >D_eugracilis_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATACCAACCTTACCGAACAACTCCTC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCATCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTTGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAGCAACATCGAGGACACCATCAG ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA AAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGC CAACAACGCCAACAGCAACTGCAACTACTCTATCAACAAAACAAA >D_ficusphila_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCTGTCTACTACAAGGAGCA GCCAGACCTTAATGAGTGCATTCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGACGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCCGATGCCGACACTGGCCGTGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACCACAACATCGAGGACACCATCAG ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA AAATCCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGA CAGCAACGCCAGCAGCAACTGCAAATACTCTATCAACAAAACAAA >D_elegans_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAACA GCCAGACCTCAATGAATGCATTCAATATCAACCCTACCGGACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTATCCCAACCCGGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTGGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTATACTCCAACAACAACATCGAGGACACCATCAG ATCAACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACGAAAACGTG TAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT CAACAGCGCCAGCAGCAACTGCAACTACTGTATCAACAAAACAAA >D_takahashii_Zasp66-PG ATGGAGTACGTTCAGTTCAAAAACGGATCCCCAGTCTACTACAAGGAGCA GCCAGACCTCAATGAATGCATTCAATACCAACCCTACCGAACAACTCCGC TGGTCCTGCCCGGCGCCAAAGTGAAGAAGGATGCGCCCACGACAGAGTCC TACTTGAGGCACTACCCCAACCCAGCTGTGCGCGCCCACCCAGGACACGA CTACCATGACAGTATCATGAAGCAGCGCGTGGCCGACACCATGCTGCACA AGGTCGTCGGTTCGGAGGCCGACACTGGCCGCGTCTTCCACAAGCAATTC AACTCGCCCATCGGCCTGTACTCCAACAACAACATCGAGGACACCATCAG ATCCACAGTTCCAATTTTCATCGATCTATCTTTCCTGGAACAAAAACGTA TAATTCTGGAGCAACAAAAGCAAAAAGACCAACTTGCAGAGCAACAACGT CAACAACGCCAGCAGCAACTGCAACTACTCTATCAACAAAACAAA
>D_melanogaster_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR QQRQHQLQILYQQNK >D_sechellia_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKDQLAEQQR QQRQQQLQILYQQNK >D_simulans_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRVILEQQKQKEQLAEQQR QQRQQQLQILYQQNK >D_yakuba_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR QQRQHQLQILYQQNK >D_erecta_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKEQLAEQQR QQRQHQLQILYQQNK >D_biarmipes_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR LQRQQQLQLLYQQNK >D_suzukii_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTDS YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR QQRQQQLQLLYQQNK >D_eugracilis_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNSNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR QQRQQQLQLLYQQNK >D_ficusphila_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSDADTGRVFHKQF NSPIGLYSNHNIEDTIRSTVPIFIDLSFLEQKRKILEQQKQKDQLAEQQR QQRQQQLQILYQQNK >D_elegans_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLERKRVILEQQKQKDQLAEQQR QQRQQQLQLLYQQNK >D_takahashii_Zasp66-PG MEYVQFKNGSPVYYKEQPDLNECIQYQPYRTTPLVLPGAKVKKDAPTTES YLRHYPNPAVRAHPGHDYHDSIMKQRVADTMLHKVVGSEADTGRVFHKQF NSPIGLYSNNNIEDTIRSTVPIFIDLSFLEQKRIILEQQKQKDQLAEQQR QQRQQQLQLLYQQNK
#NEXUS
[ID: 3814299304]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_Zasp66-PG
D_sechellia_Zasp66-PG
D_simulans_Zasp66-PG
D_yakuba_Zasp66-PG
D_erecta_Zasp66-PG
D_biarmipes_Zasp66-PG
D_suzukii_Zasp66-PG
D_eugracilis_Zasp66-PG
D_ficusphila_Zasp66-PG
D_elegans_Zasp66-PG
D_takahashii_Zasp66-PG
;
end;
begin trees;
translate
1 D_melanogaster_Zasp66-PG,
2 D_sechellia_Zasp66-PG,
3 D_simulans_Zasp66-PG,
4 D_yakuba_Zasp66-PG,
5 D_erecta_Zasp66-PG,
6 D_biarmipes_Zasp66-PG,
7 D_suzukii_Zasp66-PG,
8 D_eugracilis_Zasp66-PG,
9 D_ficusphila_Zasp66-PG,
10 D_elegans_Zasp66-PG,
11 D_takahashii_Zasp66-PG
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.008057548,(2:0.003326946,3:0.01267906)0.916:0.01179286,((4:0.00303731,5:0.006786982)0.967:0.01470622,((6:0.03203464,9:0.09552893)0.538:0.01928258,(7:0.03263159,8:0.02796288)0.841:0.02146919,10:0.06761987,11:0.01732943)0.999:0.04285751)0.883:0.01315023);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.008057548,(2:0.003326946,3:0.01267906):0.01179286,((4:0.00303731,5:0.006786982):0.01470622,((6:0.03203464,9:0.09552893):0.01928258,(7:0.03263159,8:0.02796288):0.02146919,10:0.06761987,11:0.01732943):0.04285751):0.01315023);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1036.13 -1056.01
2 -1035.57 -1055.58
--------------------------------------
TOTAL -1035.81 -1055.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Zasp66-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.502454 0.013206 0.303897 0.738691 0.485575 847.82 1111.12 1.000
r(A<->C){all} 0.014359 0.000152 0.000001 0.038374 0.011240 829.56 918.44 1.001
r(A<->G){all} 0.184487 0.004569 0.064227 0.319684 0.176656 451.92 533.18 1.003
r(A<->T){all} 0.127286 0.003022 0.032680 0.233709 0.121646 607.80 625.99 1.000
r(C<->G){all} 0.024685 0.000401 0.000011 0.064211 0.019767 586.56 802.94 1.000
r(C<->T){all} 0.388413 0.010098 0.200378 0.592322 0.383256 374.90 452.64 1.000
r(G<->T){all} 0.260770 0.007080 0.105653 0.426002 0.254728 299.09 447.91 1.001
pi(A){all} 0.319319 0.000441 0.279689 0.361674 0.318818 1205.52 1282.45 1.001
pi(C){all} 0.311586 0.000411 0.268930 0.348686 0.311460 1185.69 1236.05 1.000
pi(G){all} 0.198203 0.000311 0.164557 0.233611 0.197957 1267.51 1295.72 1.000
pi(T){all} 0.170891 0.000255 0.140903 0.202530 0.170256 1220.31 1273.88 1.000
alpha{1,2} 0.052587 0.001249 0.000105 0.116000 0.049012 1092.54 1116.91 1.000
alpha{3} 1.514823 0.435671 0.516429 2.875891 1.394310 1435.42 1468.21 1.000
pinvar{all} 0.698038 0.002125 0.604684 0.782088 0.700952 1264.02 1341.76 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/442/Zasp66-PG/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 165
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 0 | Ser TCT 1 1 1 1 1 3 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 5 5 5 5 5 5 | TCC 4 4 4 4 4 3 | TAC 9 9 9 9 9 9 | TGC 1 1 1 1 1 1
Leu TTA 0 0 0 0 0 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 1 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 1 1 1 | Pro CCT 0 0 1 0 0 0 | His CAT 2 1 1 2 2 1 | Arg CGT 3 3 3 4 4 2
CTC 2 2 2 2 2 2 | CCC 5 5 4 5 5 5 | CAC 5 5 5 5 5 5 | CGC 4 4 4 3 3 4
CTA 1 1 1 1 2 3 | CCA 4 4 4 4 4 4 | Gln CAA 16 17 17 16 16 14 | CGA 0 0 0 0 0 1
CTG 8 8 8 7 6 7 | CCG 2 2 2 2 2 2 | CAG 4 4 4 4 4 6 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 5 3 3 4 4 1 | Thr ACT 2 2 2 2 2 2 | Asn AAT 1 1 1 1 1 1 | Ser AGT 1 1 1 1 1 1
ATC 4 5 5 5 5 7 | ACC 2 2 2 2 2 2 | AAC 7 7 7 7 7 7 | AGC 0 0 0 0 0 0
ATA 1 1 1 1 1 0 | ACA 3 3 3 3 3 3 | Lys AAA 5 5 5 5 5 6 | Arg AGA 1 1 1 1 1 1
Met ATG 3 3 3 3 3 3 | ACG 1 1 1 1 1 1 | AAG 7 7 7 7 7 7 | AGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 3 3 3 3 3 | Ala GCT 1 1 1 1 1 1 | Asp GAT 2 2 2 2 2 3 | Gly GGT 1 1 1 1 1 1
GTC 4 4 4 4 4 4 | GCC 4 4 4 4 4 4 | GAC 7 7 6 6 6 6 | GGC 3 3 3 3 3 3
GTA 0 0 0 0 0 0 | GCA 1 1 1 1 1 1 | Glu GAA 2 2 2 3 3 1 | GGA 2 2 2 2 2 2
GTG 4 4 4 3 3 3 | GCG 1 1 1 1 1 1 | GAG 7 7 8 7 7 8 | GGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 0 0 0 0 0 | Ser TCT 1 1 1 1 1 | Tyr TAT 2 1 1 3 1 | Cys TGT 0 0 0 0 0
TTC 5 5 5 5 5 | TCC 3 3 4 3 4 | TAC 8 9 9 7 9 | TGC 1 1 1 1 1
Leu TTA 0 0 0 0 0 | TCA 1 1 1 1 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 1 1 1 1 | TCG 2 2 1 2 2 | TAG 0 0 0 0 0 | Trp TGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Leu CTT 2 1 2 1 1 | Pro CCT 1 2 1 0 0 | His CAT 1 2 1 1 1 | Arg CGT 2 1 2 2 2
CTC 1 2 1 1 2 | CCC 5 4 5 5 5 | CAC 5 4 6 5 5 | CGC 4 5 3 4 4
CTA 2 2 1 3 2 | CCA 4 4 3 4 5 | Gln CAA 16 17 15 14 16 | CGA 1 1 2 1 1
CTG 7 7 7 7 7 | CCG 1 1 2 2 1 | CAG 5 4 6 6 5 | CGG 0 0 0 1 0
----------------------------------------------------------------------------------------------------------------------
Ile ATT 2 3 2 3 3 | Thr ACT 2 2 2 2 2 | Asn AAT 1 1 1 1 1 | Ser AGT 1 1 1 1 1
ATC 6 5 6 5 5 | ACC 2 2 2 2 2 | AAC 7 6 6 7 7 | AGC 0 1 0 0 0
ATA 0 0 1 0 1 | ACA 3 3 3 3 3 | Lys AAA 6 6 6 5 5 | Arg AGA 1 1 1 1 1
Met ATG 3 3 3 3 3 | ACG 1 1 1 1 1 | AAG 7 7 7 7 7 | AGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Val GTT 3 3 2 2 2 | Ala GCT 1 1 1 1 1 | Asp GAT 4 2 2 2 2 | Gly GGT 1 1 1 1 1
GTC 4 4 4 4 5 | GCC 4 4 4 4 4 | GAC 6 7 8 7 7 | GGC 3 3 3 3 3
GTA 0 0 0 1 0 | GCA 1 1 1 1 1 | Glu GAA 2 2 1 3 2 | GGA 2 2 2 2 2
GTG 3 3 4 4 3 | GCG 1 1 1 1 1 | GAG 6 7 7 6 7 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Zasp66-PG
position 1: T:0.14545 C:0.33939 A:0.26667 G:0.24848
position 2: T:0.24242 C:0.20000 A:0.45455 G:0.10303
position 3: T:0.13333 C:0.40000 A:0.21818 G:0.24848
Average T:0.17374 C:0.31313 A:0.31313 G:0.20000
#2: D_sechellia_Zasp66-PG
position 1: T:0.14545 C:0.33939 A:0.26061 G:0.25455
position 2: T:0.24242 C:0.20000 A:0.45455 G:0.10303
position 3: T:0.12121 C:0.40606 A:0.22424 G:0.24848
Average T:0.16970 C:0.31515 A:0.31313 G:0.20202
#3: D_simulans_Zasp66-PG
position 1: T:0.14545 C:0.33939 A:0.26061 G:0.25455
position 2: T:0.24242 C:0.20000 A:0.45455 G:0.10303
position 3: T:0.12727 C:0.39394 A:0.22424 G:0.25455
Average T:0.17172 C:0.31111 A:0.31313 G:0.20404
#4: D_yakuba_Zasp66-PG
position 1: T:0.14545 C:0.33939 A:0.26667 G:0.24848
position 2: T:0.24242 C:0.20000 A:0.45455 G:0.10303
position 3: T:0.14545 C:0.39394 A:0.22424 G:0.23636
Average T:0.17778 C:0.31111 A:0.31515 G:0.19596
#5: D_erecta_Zasp66-PG
position 1: T:0.14545 C:0.33939 A:0.26667 G:0.24848
position 2: T:0.24242 C:0.20000 A:0.45455 G:0.10303
position 3: T:0.14545 C:0.39394 A:0.23030 G:0.23030
Average T:0.17778 C:0.31111 A:0.31717 G:0.19394
#6: D_biarmipes_Zasp66-PG
position 1: T:0.14545 C:0.34545 A:0.26061 G:0.24848
position 2: T:0.24242 C:0.20000 A:0.45455 G:0.10303
position 3: T:0.12727 C:0.40606 A:0.21818 G:0.24848
Average T:0.17172 C:0.31717 A:0.31111 G:0.20000
#7: D_suzukii_Zasp66-PG
position 1: T:0.14545 C:0.34545 A:0.26061 G:0.24848
position 2: T:0.23636 C:0.20000 A:0.46061 G:0.10303
position 3: T:0.14545 C:0.38788 A:0.23636 G:0.23030
Average T:0.17576 C:0.31111 A:0.31919 G:0.19394
#8: D_eugracilis_Zasp66-PG
position 1: T:0.14545 C:0.34545 A:0.26061 G:0.24848
position 2: T:0.23636 C:0.20000 A:0.45455 G:0.10909
position 3: T:0.13333 C:0.39394 A:0.24242 G:0.23030
Average T:0.17172 C:0.31313 A:0.31919 G:0.19596
#9: D_ficusphila_Zasp66-PG
position 1: T:0.14545 C:0.34545 A:0.26061 G:0.24848
position 2: T:0.23636 C:0.20000 A:0.46061 G:0.10303
position 3: T:0.12121 C:0.40606 A:0.22424 G:0.24848
Average T:0.16768 C:0.31717 A:0.31515 G:0.20000
#10: D_elegans_Zasp66-PG
position 1: T:0.14545 C:0.34545 A:0.25455 G:0.25455
position 2: T:0.24242 C:0.20000 A:0.44848 G:0.10909
position 3: T:0.12727 C:0.38182 A:0.23636 G:0.25455
Average T:0.17172 C:0.30909 A:0.31313 G:0.20606
#11: D_takahashii_Zasp66-PG
position 1: T:0.14545 C:0.34545 A:0.26061 G:0.24848
position 2: T:0.24242 C:0.20000 A:0.45455 G:0.10303
position 3: T:0.11515 C:0.41212 A:0.23636 G:0.23636
Average T:0.16768 C:0.31919 A:0.31717 G:0.19596
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 0 | Ser S TCT 13 | Tyr Y TAT 14 | Cys C TGT 0
TTC 55 | TCC 40 | TAC 96 | TGC 11
Leu L TTA 0 | TCA 4 | *** * TAA 0 | *** * TGA 0
TTG 11 | TCG 20 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 10 | Pro P CCT 5 | His H CAT 15 | Arg R CGT 28
CTC 19 | CCC 53 | CAC 55 | CGC 42
CTA 19 | CCA 44 | Gln Q CAA 174 | CGA 7
CTG 79 | CCG 19 | CAG 52 | CGG 1
------------------------------------------------------------------------------
Ile I ATT 33 | Thr T ACT 22 | Asn N AAT 11 | Ser S AGT 11
ATC 58 | ACC 22 | AAC 75 | AGC 1
ATA 7 | ACA 33 | Lys K AAA 59 | Arg R AGA 11
Met M ATG 33 | ACG 11 | AAG 77 | AGG 11
------------------------------------------------------------------------------
Val V GTT 29 | Ala A GCT 11 | Asp D GAT 25 | Gly G GGT 11
GTC 45 | GCC 44 | GAC 73 | GGC 33
GTA 1 | GCA 11 | Glu E GAA 23 | GGA 22
GTG 38 | GCG 11 | GAG 77 | GGG 0
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14545 C:0.34270 A:0.26171 G:0.25014
position 2: T:0.24077 C:0.20000 A:0.45510 G:0.10413
position 3: T:0.13113 C:0.39780 A:0.22865 G:0.24242
Average T:0.17245 C:0.31350 A:0.31515 G:0.19890
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Zasp66-PG
D_sechellia_Zasp66-PG 0.5787 (0.0052 0.0090)
D_simulans_Zasp66-PG 0.4323 (0.0079 0.0182) 0.2897 (0.0026 0.0090)
D_yakuba_Zasp66-PG 0.0706 (0.0026 0.0369) 0.2859 (0.0079 0.0275) 0.1128 (0.0052 0.0464)
D_erecta_Zasp66-PG 0.0561 (0.0026 0.0465) 0.2131 (0.0079 0.0369) 0.0934 (0.0052 0.0560)-1.0000 (0.0000 0.0091)
D_biarmipes_Zasp66-PG 0.1070 (0.0118 0.1106) 0.1073 (0.0118 0.1104) 0.1201 (0.0145 0.1207) 0.1605 (0.0145 0.0903) 0.1442 (0.0145 0.1004)
D_suzukii_Zasp66-PG 0.0827 (0.0118 0.1429) 0.0829 (0.0118 0.1426) 0.0944 (0.0145 0.1535) 0.1189 (0.0145 0.1217) 0.1094 (0.0145 0.1323) 0.0552 (0.0052 0.0949)
D_eugracilis_Zasp66-PG 0.0973 (0.0118 0.1215) 0.0976 (0.0118 0.1212) 0.1100 (0.0145 0.1318) 0.1436 (0.0145 0.1008) 0.1302 (0.0145 0.1111) 0.0454 (0.0052 0.1154) 0.0696 (0.0052 0.0752)
D_ficusphila_Zasp66-PG 0.0971 (0.0118 0.1217) 0.0973 (0.0118 0.1215) 0.1097 (0.0145 0.1321) 0.1187 (0.0145 0.1219) 0.1091 (0.0145 0.1326) 0.0910 (0.0105 0.1156) 0.0830 (0.0105 0.1266) 0.0765 (0.0105 0.1373)
D_elegans_Zasp66-PG 0.0838 (0.0105 0.1256) 0.0419 (0.0052 0.1253) 0.0581 (0.0079 0.1358) 0.1048 (0.0132 0.1257) 0.1143 (0.0132 0.1153) 0.0846 (0.0105 0.1247) 0.0918 (0.0105 0.1148) 0.0842 (0.0105 0.1251) 0.1006 (0.0159 0.1576)
D_takahashii_Zasp66-PG 0.0694 (0.0052 0.0754) 0.0696 (0.0052 0.0753) 0.0924 (0.0079 0.0852) 0.1198 (0.0079 0.0656) 0.1041 (0.0079 0.0755) 0.0618 (0.0052 0.0848) 0.0550 (0.0052 0.0952) 0.0697 (0.0052 0.0751) 0.0906 (0.0105 0.1160) 0.0557 (0.0053 0.0943)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
lnL(ntime: 17 np: 19): -1020.178634 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..6 17..9 16..18 18..7 18..8 16..10 16..11
0.006166 0.012695 0.000004 0.012536 0.012509 0.012769 0.000004 0.006211 0.044830 0.022185 0.036158 0.072074 0.019629 0.038334 0.025201 0.064137 0.018788 1.388155 0.079543
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40423
(1: 0.006166, (2: 0.000004, 3: 0.012536): 0.012695, ((4: 0.000004, 5: 0.006211): 0.012769, ((6: 0.036158, 9: 0.072074): 0.022185, (7: 0.038334, 8: 0.025201): 0.019629, 10: 0.064137, 11: 0.018788): 0.044830): 0.012509);
(D_melanogaster_Zasp66-PG: 0.006166, (D_sechellia_Zasp66-PG: 0.000004, D_simulans_Zasp66-PG: 0.012536): 0.012695, ((D_yakuba_Zasp66-PG: 0.000004, D_erecta_Zasp66-PG: 0.006211): 0.012769, ((D_biarmipes_Zasp66-PG: 0.036158, D_ficusphila_Zasp66-PG: 0.072074): 0.022185, (D_suzukii_Zasp66-PG: 0.038334, D_eugracilis_Zasp66-PG: 0.025201): 0.019629, D_elegans_Zasp66-PG: 0.064137, D_takahashii_Zasp66-PG: 0.018788): 0.044830): 0.012509);
Detailed output identifying parameters
kappa (ts/tv) = 1.38815
omega (dN/dS) = 0.07954
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.006 396.5 98.5 0.0795 0.0006 0.0078 0.2 0.8
12..13 0.013 396.5 98.5 0.0795 0.0013 0.0161 0.5 1.6
13..2 0.000 396.5 98.5 0.0795 0.0000 0.0000 0.0 0.0
13..3 0.013 396.5 98.5 0.0795 0.0013 0.0159 0.5 1.6
12..14 0.013 396.5 98.5 0.0795 0.0013 0.0159 0.5 1.6
14..15 0.013 396.5 98.5 0.0795 0.0013 0.0162 0.5 1.6
15..4 0.000 396.5 98.5 0.0795 0.0000 0.0000 0.0 0.0
15..5 0.006 396.5 98.5 0.0795 0.0006 0.0079 0.2 0.8
14..16 0.045 396.5 98.5 0.0795 0.0045 0.0569 1.8 5.6
16..17 0.022 396.5 98.5 0.0795 0.0022 0.0281 0.9 2.8
17..6 0.036 396.5 98.5 0.0795 0.0036 0.0459 1.4 4.5
17..9 0.072 396.5 98.5 0.0795 0.0073 0.0914 2.9 9.0
16..18 0.020 396.5 98.5 0.0795 0.0020 0.0249 0.8 2.5
18..7 0.038 396.5 98.5 0.0795 0.0039 0.0486 1.5 4.8
18..8 0.025 396.5 98.5 0.0795 0.0025 0.0320 1.0 3.1
16..10 0.064 396.5 98.5 0.0795 0.0065 0.0814 2.6 8.0
16..11 0.019 396.5 98.5 0.0795 0.0019 0.0238 0.8 2.3
tree length for dN: 0.0408
tree length for dS: 0.5128
Time used: 0:10
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
lnL(ntime: 17 np: 20): -1006.974363 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..6 17..9 16..18 18..7 18..8 16..10 16..11
0.006157 0.012631 0.000004 0.012527 0.012791 0.012530 0.000004 0.006243 0.045343 0.021741 0.036303 0.072877 0.019397 0.038376 0.024934 0.064617 0.018738 1.479890 0.917312 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40521
(1: 0.006157, (2: 0.000004, 3: 0.012527): 0.012631, ((4: 0.000004, 5: 0.006243): 0.012530, ((6: 0.036303, 9: 0.072877): 0.021741, (7: 0.038376, 8: 0.024934): 0.019397, 10: 0.064617, 11: 0.018738): 0.045343): 0.012791);
(D_melanogaster_Zasp66-PG: 0.006157, (D_sechellia_Zasp66-PG: 0.000004, D_simulans_Zasp66-PG: 0.012527): 0.012631, ((D_yakuba_Zasp66-PG: 0.000004, D_erecta_Zasp66-PG: 0.006243): 0.012530, ((D_biarmipes_Zasp66-PG: 0.036303, D_ficusphila_Zasp66-PG: 0.072877): 0.021741, (D_suzukii_Zasp66-PG: 0.038376, D_eugracilis_Zasp66-PG: 0.024934): 0.019397, D_elegans_Zasp66-PG: 0.064617, D_takahashii_Zasp66-PG: 0.018738): 0.045343): 0.012791);
Detailed output identifying parameters
kappa (ts/tv) = 1.47989
dN/dS (w) for site classes (K=2)
p: 0.91731 0.08269
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.006 394.6 100.4 0.0827 0.0006 0.0076 0.2 0.8
12..13 0.013 394.6 100.4 0.0827 0.0013 0.0157 0.5 1.6
13..2 0.000 394.6 100.4 0.0827 0.0000 0.0000 0.0 0.0
13..3 0.013 394.6 100.4 0.0827 0.0013 0.0155 0.5 1.6
12..14 0.013 394.6 100.4 0.0827 0.0013 0.0159 0.5 1.6
14..15 0.013 394.6 100.4 0.0827 0.0013 0.0155 0.5 1.6
15..4 0.000 394.6 100.4 0.0827 0.0000 0.0000 0.0 0.0
15..5 0.006 394.6 100.4 0.0827 0.0006 0.0077 0.3 0.8
14..16 0.045 394.6 100.4 0.0827 0.0047 0.0562 1.8 5.6
16..17 0.022 394.6 100.4 0.0827 0.0022 0.0270 0.9 2.7
17..6 0.036 394.6 100.4 0.0827 0.0037 0.0450 1.5 4.5
17..9 0.073 394.6 100.4 0.0827 0.0075 0.0904 3.0 9.1
16..18 0.019 394.6 100.4 0.0827 0.0020 0.0241 0.8 2.4
18..7 0.038 394.6 100.4 0.0827 0.0039 0.0476 1.6 4.8
18..8 0.025 394.6 100.4 0.0827 0.0026 0.0309 1.0 3.1
16..10 0.065 394.6 100.4 0.0827 0.0066 0.0802 2.6 8.0
16..11 0.019 394.6 100.4 0.0827 0.0019 0.0232 0.8 2.3
Time used: 0:21
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
lnL(ntime: 17 np: 22): -1006.347317 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..6 17..9 16..18 18..7 18..8 16..10 16..11
0.006462 0.013197 0.000004 0.013154 0.013407 0.013044 0.000004 0.006502 0.048818 0.019425 0.038708 0.076229 0.018073 0.039400 0.025820 0.067529 0.019957 1.555258 0.917630 0.076943 0.000001 6.551157
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41973
(1: 0.006462, (2: 0.000004, 3: 0.013154): 0.013197, ((4: 0.000004, 5: 0.006502): 0.013044, ((6: 0.038708, 9: 0.076229): 0.019425, (7: 0.039400, 8: 0.025820): 0.018073, 10: 0.067529, 11: 0.019957): 0.048818): 0.013407);
(D_melanogaster_Zasp66-PG: 0.006462, (D_sechellia_Zasp66-PG: 0.000004, D_simulans_Zasp66-PG: 0.013154): 0.013197, ((D_yakuba_Zasp66-PG: 0.000004, D_erecta_Zasp66-PG: 0.006502): 0.013044, ((D_biarmipes_Zasp66-PG: 0.038708, D_ficusphila_Zasp66-PG: 0.076229): 0.019425, (D_suzukii_Zasp66-PG: 0.039400, D_eugracilis_Zasp66-PG: 0.025820): 0.018073, D_elegans_Zasp66-PG: 0.067529, D_takahashii_Zasp66-PG: 0.019957): 0.048818): 0.013407);
Detailed output identifying parameters
kappa (ts/tv) = 1.55526
dN/dS (w) for site classes (K=3)
p: 0.91763 0.07694 0.00543
w: 0.00000 1.00000 6.55116
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.006 393.2 101.8 0.1125 0.0008 0.0073 0.3 0.7
12..13 0.013 393.2 101.8 0.1125 0.0017 0.0149 0.7 1.5
13..2 0.000 393.2 101.8 0.1125 0.0000 0.0000 0.0 0.0
13..3 0.013 393.2 101.8 0.1125 0.0017 0.0149 0.7 1.5
12..14 0.013 393.2 101.8 0.1125 0.0017 0.0151 0.7 1.5
14..15 0.013 393.2 101.8 0.1125 0.0017 0.0147 0.7 1.5
15..4 0.000 393.2 101.8 0.1125 0.0000 0.0000 0.0 0.0
15..5 0.007 393.2 101.8 0.1125 0.0008 0.0073 0.3 0.7
14..16 0.049 393.2 101.8 0.1125 0.0062 0.0551 2.4 5.6
16..17 0.019 393.2 101.8 0.1125 0.0025 0.0219 1.0 2.2
17..6 0.039 393.2 101.8 0.1125 0.0049 0.0437 1.9 4.5
17..9 0.076 393.2 101.8 0.1125 0.0097 0.0861 3.8 8.8
16..18 0.018 393.2 101.8 0.1125 0.0023 0.0204 0.9 2.1
18..7 0.039 393.2 101.8 0.1125 0.0050 0.0445 2.0 4.5
18..8 0.026 393.2 101.8 0.1125 0.0033 0.0292 1.3 3.0
16..10 0.068 393.2 101.8 0.1125 0.0086 0.0763 3.4 7.8
16..11 0.020 393.2 101.8 0.1125 0.0025 0.0225 1.0 2.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PG)
Pr(w>1) post mean +- SE for w
134 I 0.798 5.430
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PG)
Pr(w>1) post mean +- SE for w
134 I 0.923 4.101 +- 2.594
159 I 0.563 2.483 +- 2.124
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.222 0.203 0.146 0.109 0.085 0.068 0.055 0.045 0.036 0.030
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.010 0.983
sum of density on p0-p1 = 1.000000
Time used: 0:52
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
lnL(ntime: 17 np: 23): -1006.974196 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..6 17..9 16..18 18..7 18..8 16..10 16..11
0.006156 0.012630 0.000004 0.012526 0.012792 0.012527 0.000004 0.006243 0.045345 0.021740 0.036299 0.072877 0.019395 0.038375 0.024930 0.064616 0.018737 1.482484 0.300922 0.616634 0.000001 0.000001 1.007534
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40520
(1: 0.006156, (2: 0.000004, 3: 0.012526): 0.012630, ((4: 0.000004, 5: 0.006243): 0.012527, ((6: 0.036299, 9: 0.072877): 0.021740, (7: 0.038375, 8: 0.024930): 0.019395, 10: 0.064616, 11: 0.018737): 0.045345): 0.012792);
(D_melanogaster_Zasp66-PG: 0.006156, (D_sechellia_Zasp66-PG: 0.000004, D_simulans_Zasp66-PG: 0.012526): 0.012630, ((D_yakuba_Zasp66-PG: 0.000004, D_erecta_Zasp66-PG: 0.006243): 0.012527, ((D_biarmipes_Zasp66-PG: 0.036299, D_ficusphila_Zasp66-PG: 0.072877): 0.021740, (D_suzukii_Zasp66-PG: 0.038375, D_eugracilis_Zasp66-PG: 0.024930): 0.019395, D_elegans_Zasp66-PG: 0.064616, D_takahashii_Zasp66-PG: 0.018737): 0.045345): 0.012792);
Detailed output identifying parameters
kappa (ts/tv) = 1.48248
dN/dS (w) for site classes (K=3)
p: 0.30092 0.61663 0.08244
w: 0.00000 0.00000 1.00753
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.006 394.6 100.4 0.0831 0.0006 0.0076 0.2 0.8
12..13 0.013 394.6 100.4 0.0831 0.0013 0.0156 0.5 1.6
13..2 0.000 394.6 100.4 0.0831 0.0000 0.0000 0.0 0.0
13..3 0.013 394.6 100.4 0.0831 0.0013 0.0155 0.5 1.6
12..14 0.013 394.6 100.4 0.0831 0.0013 0.0158 0.5 1.6
14..15 0.013 394.6 100.4 0.0831 0.0013 0.0155 0.5 1.6
15..4 0.000 394.6 100.4 0.0831 0.0000 0.0000 0.0 0.0
15..5 0.006 394.6 100.4 0.0831 0.0006 0.0077 0.3 0.8
14..16 0.045 394.6 100.4 0.0831 0.0047 0.0562 1.8 5.6
16..17 0.022 394.6 100.4 0.0831 0.0022 0.0269 0.9 2.7
17..6 0.036 394.6 100.4 0.0831 0.0037 0.0450 1.5 4.5
17..9 0.073 394.6 100.4 0.0831 0.0075 0.0903 3.0 9.1
16..18 0.019 394.6 100.4 0.0831 0.0020 0.0240 0.8 2.4
18..7 0.038 394.6 100.4 0.0831 0.0039 0.0475 1.6 4.8
18..8 0.025 394.6 100.4 0.0831 0.0026 0.0309 1.0 3.1
16..10 0.065 394.6 100.4 0.0831 0.0066 0.0800 2.6 8.0
16..11 0.019 394.6 100.4 0.0831 0.0019 0.0232 0.8 2.3
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PG)
Pr(w>1) post mean +- SE for w
49 E 1.000** 1.007
89 E 1.000** 1.007
110 N 1.000** 1.008
131 Q 1.000** 1.007
134 I 1.000** 1.008
143 D 1.000** 1.008
151 Q 1.000** 1.007
155 H 1.000** 1.008
159 I 1.000** 1.008
Time used: 1:12
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
lnL(ntime: 17 np: 20): -1007.112396 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..6 17..9 16..18 18..7 18..8 16..10 16..11
0.006302 0.012935 0.000004 0.012823 0.013062 0.012852 0.000004 0.006387 0.046336 0.022303 0.037134 0.074463 0.019879 0.039259 0.025550 0.066076 0.019180 1.470393 0.007579 0.110617
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41455
(1: 0.006302, (2: 0.000004, 3: 0.012823): 0.012935, ((4: 0.000004, 5: 0.006387): 0.012852, ((6: 0.037134, 9: 0.074463): 0.022303, (7: 0.039259, 8: 0.025550): 0.019879, 10: 0.066076, 11: 0.019180): 0.046336): 0.013062);
(D_melanogaster_Zasp66-PG: 0.006302, (D_sechellia_Zasp66-PG: 0.000004, D_simulans_Zasp66-PG: 0.012823): 0.012935, ((D_yakuba_Zasp66-PG: 0.000004, D_erecta_Zasp66-PG: 0.006387): 0.012852, ((D_biarmipes_Zasp66-PG: 0.037134, D_ficusphila_Zasp66-PG: 0.074463): 0.022303, (D_suzukii_Zasp66-PG: 0.039259, D_eugracilis_Zasp66-PG: 0.025550): 0.019879, D_elegans_Zasp66-PG: 0.066076, D_takahashii_Zasp66-PG: 0.019180): 0.046336): 0.013062);
Detailed output identifying parameters
kappa (ts/tv) = 1.47039
Parameters in M7 (beta):
p = 0.00758 q = 0.11062
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.90461
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.006 394.8 100.2 0.0905 0.0007 0.0077 0.3 0.8
12..13 0.013 394.8 100.2 0.0905 0.0014 0.0157 0.6 1.6
13..2 0.000 394.8 100.2 0.0905 0.0000 0.0000 0.0 0.0
13..3 0.013 394.8 100.2 0.0905 0.0014 0.0156 0.6 1.6
12..14 0.013 394.8 100.2 0.0905 0.0014 0.0159 0.6 1.6
14..15 0.013 394.8 100.2 0.0905 0.0014 0.0156 0.6 1.6
15..4 0.000 394.8 100.2 0.0905 0.0000 0.0000 0.0 0.0
15..5 0.006 394.8 100.2 0.0905 0.0007 0.0078 0.3 0.8
14..16 0.046 394.8 100.2 0.0905 0.0051 0.0563 2.0 5.6
16..17 0.022 394.8 100.2 0.0905 0.0024 0.0271 1.0 2.7
17..6 0.037 394.8 100.2 0.0905 0.0041 0.0451 1.6 4.5
17..9 0.074 394.8 100.2 0.0905 0.0082 0.0904 3.2 9.1
16..18 0.020 394.8 100.2 0.0905 0.0022 0.0241 0.9 2.4
18..7 0.039 394.8 100.2 0.0905 0.0043 0.0477 1.7 4.8
18..8 0.026 394.8 100.2 0.0905 0.0028 0.0310 1.1 3.1
16..10 0.066 394.8 100.2 0.0905 0.0073 0.0802 2.9 8.0
16..11 0.019 394.8 100.2 0.0905 0.0021 0.0233 0.8 2.3
Time used: 4:32
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, 5), ((6, 9), (7, 8), 10, 11))); MP score: 62
check convergence..
lnL(ntime: 17 np: 22): -1005.997423 +0.000000
12..1 12..13 13..2 13..3 12..14 14..15 15..4 15..5 14..16 16..17 17..6 17..9 16..18 18..7 18..8 16..10 16..11
0.006566 0.013440 0.000004 0.013376 0.013503 0.013344 0.000004 0.006585 0.049553 0.018883 0.039625 0.077204 0.017935 0.039812 0.026281 0.068548 0.020401 1.441321 0.993316 0.010529 0.180938 5.924509
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.42506
(1: 0.006566, (2: 0.000004, 3: 0.013376): 0.013440, ((4: 0.000004, 5: 0.006585): 0.013344, ((6: 0.039625, 9: 0.077204): 0.018883, (7: 0.039812, 8: 0.026281): 0.017935, 10: 0.068548, 11: 0.020401): 0.049553): 0.013503);
(D_melanogaster_Zasp66-PG: 0.006566, (D_sechellia_Zasp66-PG: 0.000004, D_simulans_Zasp66-PG: 0.013376): 0.013440, ((D_yakuba_Zasp66-PG: 0.000004, D_erecta_Zasp66-PG: 0.006585): 0.013344, ((D_biarmipes_Zasp66-PG: 0.039625, D_ficusphila_Zasp66-PG: 0.077204): 0.018883, (D_suzukii_Zasp66-PG: 0.039812, D_eugracilis_Zasp66-PG: 0.026281): 0.017935, D_elegans_Zasp66-PG: 0.068548, D_takahashii_Zasp66-PG: 0.020401): 0.049553): 0.013503);
Detailed output identifying parameters
kappa (ts/tv) = 1.44132
Parameters in M8 (beta&w>1):
p0 = 0.99332 p = 0.01053 q = 0.18094
(p1 = 0.00668) w = 5.92451
dN/dS (w) for site classes (K=11)
p: 0.09933 0.09933 0.09933 0.09933 0.09933 0.09933 0.09933 0.09933 0.09933 0.09933 0.00668
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00003 0.61145 5.92451
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.007 395.4 99.6 0.1003 0.0008 0.0078 0.3 0.8
12..13 0.013 395.4 99.6 0.1003 0.0016 0.0159 0.6 1.6
13..2 0.000 395.4 99.6 0.1003 0.0000 0.0000 0.0 0.0
13..3 0.013 395.4 99.6 0.1003 0.0016 0.0158 0.6 1.6
12..14 0.014 395.4 99.6 0.1003 0.0016 0.0160 0.6 1.6
14..15 0.013 395.4 99.6 0.1003 0.0016 0.0158 0.6 1.6
15..4 0.000 395.4 99.6 0.1003 0.0000 0.0000 0.0 0.0
15..5 0.007 395.4 99.6 0.1003 0.0008 0.0078 0.3 0.8
14..16 0.050 395.4 99.6 0.1003 0.0059 0.0587 2.3 5.8
16..17 0.019 395.4 99.6 0.1003 0.0022 0.0224 0.9 2.2
17..6 0.040 395.4 99.6 0.1003 0.0047 0.0469 1.9 4.7
17..9 0.077 395.4 99.6 0.1003 0.0092 0.0915 3.6 9.1
16..18 0.018 395.4 99.6 0.1003 0.0021 0.0212 0.8 2.1
18..7 0.040 395.4 99.6 0.1003 0.0047 0.0472 1.9 4.7
18..8 0.026 395.4 99.6 0.1003 0.0031 0.0311 1.2 3.1
16..10 0.069 395.4 99.6 0.1003 0.0081 0.0812 3.2 8.1
16..11 0.020 395.4 99.6 0.1003 0.0024 0.0242 1.0 2.4
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PG)
Pr(w>1) post mean +- SE for w
134 I 0.942 5.614
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Zasp66-PG)
Pr(w>1) post mean +- SE for w
134 I 0.973* 3.404 +- 2.299
159 I 0.668 2.226 +- 1.967
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 0.999 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.002 0.016 0.051 0.108 0.184 0.272 0.366
ws: 0.353 0.223 0.130 0.086 0.062 0.046 0.035 0.027 0.021 0.017
Time used: 6:54
Model 1: NearlyNeutral -1006.974363 Model 2: PositiveSelection -1006.347317 Model 0: one-ratio -1020.178634 Model 3: discrete -1006.974196 Model 7: beta -1007.112396 Model 8: beta&w>1 -1005.997423 Model 0 vs 1 26.408541999999898 Model 2 vs 1 1.2540920000001279 Model 8 vs 7 2.229945999999927
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
