--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Fri Dec 09 11:09:58 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/442/Z600-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -745.66 -756.02
2 -745.85 -756.44
--------------------------------------
TOTAL -745.75 -756.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.670063 0.019780 0.435403 0.965635 0.649173 1220.36 1280.36 1.000
r(A<->C){all} 0.055204 0.000708 0.008642 0.106611 0.051794 611.20 719.11 1.001
r(A<->G){all} 0.218578 0.004070 0.106325 0.347110 0.213521 404.58 481.49 1.001
r(A<->T){all} 0.080711 0.001986 0.005823 0.167304 0.074263 560.44 631.89 1.002
r(C<->G){all} 0.054583 0.001207 0.000007 0.117678 0.050115 562.32 809.92 1.003
r(C<->T){all} 0.394690 0.006668 0.240479 0.556010 0.391208 589.93 603.89 1.000
r(G<->T){all} 0.196234 0.004703 0.061776 0.322174 0.189339 591.04 612.68 1.004
pi(A){all} 0.323383 0.000702 0.270951 0.374311 0.323386 995.24 1074.20 1.000
pi(C){all} 0.280706 0.000610 0.231817 0.327500 0.280038 1032.84 1105.53 1.001
pi(G){all} 0.233521 0.000545 0.186129 0.276670 0.232525 931.81 1052.08 1.000
pi(T){all} 0.162390 0.000416 0.124464 0.202944 0.161538 1185.79 1192.52 1.000
alpha{1,2} 0.123088 0.006711 0.000268 0.250459 0.116768 1158.95 1235.82 1.000
alpha{3} 1.388007 0.444204 0.355061 2.670950 1.258338 1401.24 1437.42 1.000
pinvar{all} 0.241802 0.017815 0.000050 0.465975 0.235945 1253.32 1290.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -702.723747
Model 2: PositiveSelection -702.723747
Model 0: one-ratio -714.333061
Model 3: discrete -701.456628
Model 7: beta -701.839866
Model 8: beta&w>1 -701.823059
Model 0 vs 1 23.21862800000008
Model 2 vs 1 0.0
Model 8 vs 7 0.03361400000017056
>C1
MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF
>C2
MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
>C3
MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
>C4
MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
>C5
MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
>C6
MSSTNETNQVLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGHGKFQTELKKRRKNKLNRMCTYEADKLFIKARKSLNF
>C7
MSMINETNQMLQRLNSLKIVETPKEQRELGSRECYSLDSKKYALVPATPS
TGGPGKFQTELKKRRKNKLNRMYTYEADKHFIKARKSLNF
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=90
C1 MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS
C2 MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
C3 MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
C4 MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
C5 MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
C6 MSSTNETNQVLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
C7 MSMINETNQMLQRLNSLKIVETPKEQRELGSRECYSLDSKKYALVPATPS
** *****:****************:*:*.***********:*******
C1 SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF
C2 SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
C3 SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
C4 SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
C5 SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
C6 SGGHGKFQTELKKRRKNKLNRMCTYEADKLFIKARKSLNF
C7 TGGPGKFQTELKKRRKNKLNRMYTYEADKHFIKARKSLNF
:.* **************:**: ****** **********
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
gins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 7 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 90 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 90 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [3780]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [3780]--->[3780]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/442/Z600-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.330 Mb, Max= 30.506 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF
>C2
MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
>C3
MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
>C4
MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
>C5
MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
>C6
MSSTNETNQVLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGHGKFQTELKKRRKNKLNRMCTYEADKLFIKARKSLNF
>C7
MSMINETNQMLQRLNSLKIVETPKEQRELGSRECYSLDSKKYALVPATPS
TGGPGKFQTELKKRRKNKLNRMYTYEADKHFIKARKSLNF
FORMAT of file /tmp/tmp4590794560532045829aln Not Supported[FATAL:T-COFFEE]
>C1
MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF
>C2
MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
>C3
MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
>C4
MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
>C5
MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
>C6
MSSTNETNQVLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGHGKFQTELKKRRKNKLNRMCTYEADKLFIKARKSLNF
>C7
MSMINETNQMLQRLNSLKIVETPKEQRELGSRECYSLDSKKYALVPATPS
TGGPGKFQTELKKRRKNKLNRMYTYEADKHFIKARKSLNF
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:90 S:100 BS:90
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# PW_SEQ_DISTANCES
BOT 0 1 97.78 C1 C2 97.78
TOP 1 0 97.78 C2 C1 97.78
BOT 0 2 97.78 C1 C3 97.78
TOP 2 0 97.78 C3 C1 97.78
BOT 0 3 91.11 C1 C4 91.11
TOP 3 0 91.11 C4 C1 91.11
BOT 0 4 91.11 C1 C5 91.11
TOP 4 0 91.11 C5 C1 91.11
BOT 0 5 94.44 C1 C6 94.44
TOP 5 0 94.44 C6 C1 94.44
BOT 0 6 87.78 C1 C7 87.78
TOP 6 0 87.78 C7 C1 87.78
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 90.00 C2 C4 90.00
TOP 3 1 90.00 C4 C2 90.00
BOT 1 4 90.00 C2 C5 90.00
TOP 4 1 90.00 C5 C2 90.00
BOT 1 5 93.33 C2 C6 93.33
TOP 5 1 93.33 C6 C2 93.33
BOT 1 6 86.67 C2 C7 86.67
TOP 6 1 86.67 C7 C2 86.67
BOT 2 3 90.00 C3 C4 90.00
TOP 3 2 90.00 C4 C3 90.00
BOT 2 4 90.00 C3 C5 90.00
TOP 4 2 90.00 C5 C3 90.00
BOT 2 5 93.33 C3 C6 93.33
TOP 5 2 93.33 C6 C3 93.33
BOT 2 6 86.67 C3 C7 86.67
TOP 6 2 86.67 C7 C3 86.67
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 95.56 C4 C6 95.56
TOP 5 3 95.56 C6 C4 95.56
BOT 3 6 88.89 C4 C7 88.89
TOP 6 3 88.89 C7 C4 88.89
BOT 4 5 95.56 C5 C6 95.56
TOP 5 4 95.56 C6 C5 95.56
BOT 4 6 88.89 C5 C7 88.89
TOP 6 4 88.89 C7 C5 88.89
BOT 5 6 90.00 C6 C7 90.00
TOP 6 5 90.00 C7 C6 90.00
AVG 0 C1 * 93.33
AVG 1 C2 * 92.96
AVG 2 C3 * 92.96
AVG 3 C4 * 92.59
AVG 4 C5 * 92.59
AVG 5 C6 * 93.70
AVG 6 C7 * 88.15
TOT TOT * 92.33
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGTCGTCGACAAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT
C2 ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT
C3 ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT
C4 ATGTCGTCGACCAATGAAACCAACCAACTGCTGCAGCGCTTGAACAGCTT
C5 ATGTCGTCGACCAATGAAACCAACCAACTGCTGCAGCGCCTGAACAGCTT
C6 ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTAAACAGCTT
C7 ATGTCGATGATCAACGAAACCAACCAAATGTTGCAGCGCCTGAACAGCCT
******: ** .** ************ ** ******** *.****** *
C1 GAAAATCGTGGAAACCCCAAAGGAGCAGCATGAGTTCGGAAAACGCGAGT
C2 GAAAATCGTGGAAACCCCAAAGGAGCAGAAGGAATTTGGAAAACGCGAGT
C3 GAAAATCGTGGAAACCCCAAAGGAGCAGAAGGAATTTGGAAAACGCGAGT
C4 GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT
C5 GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT
C6 GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT
C7 GAAAATTGTGGAAACCCCCAAGGAGCAACGCGAATTGGGCAGTCGGGAGT
****** ***********.********... **.** ** *.:** ****
C1 GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC
C2 GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC
C3 GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC
C4 GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCAACCCCTAGC
C5 GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCGAGC
C6 GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCTAGC
C7 GTTACTCTCTGGACAGCAAGAAGTATGCCCTGGTACCAGCCACCCCGAGC
* ***** ****************** *************.***** ***
C1 AGCTCAGGACACGGAAAGTTCCAAACCGAACTCAAAAAGCGCCGCAAAAA
C2 AGCTCAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAACGTCGCAAGAA
C3 AGCTCAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAACGCCGCAAGAA
C4 AGCGGAGGACTTGGAAAGTTCCAAACCGAACTCAAGAAACGTCGCAAAAA
C5 AGCGGAGGGCTCGGAAAGTTCCAAACTGAACTCAAAAAACGTCGCAAAAA
C6 AGCGGAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAGCGTCGCAAAAA
C7 ACCGGAGGACCCGGAAAGTTCCAAACCGAACTGAAGAAACGTCGCAAAAA
* * ***.* ************** **.** **.**.** *****.**
C1 CAAACTGAATCGCATGTACACTTACGAGGCTGATAAGAATTTCATCAAGG
C2 CAAACTGAATCGCCTTTACACTTACGAGGCTGACAAGAATTTCATCAAGG
C3 CAAACTGAATCGCCTTTACACTTACGAGGCTGACAAGAATTTCATCAAGG
C4 CAAAGTGAATCGCATGTGCACTTACGAGGCTGACAAGCAATTCATCAAGG
C5 CAAAGTGAATCGCATGTGCACTTACGAGGCTGACAAGCAATTCATCAAGG
C6 CAAACTGAATCGCATGTGCACTTACGAGGCTGACAAGCTTTTTATCAAGG
C7 CAAACTCAACCGAATGTACACCTACGAGGCGGACAAACACTTTATCAAGG
**** * ** **..* *.*** ******** ** **..: ** *******
C1 CTCGCAAATCTTTGAACTTC
C2 CGCGCAAGTCTTTAAACTTC
C3 CGCGCAAGTCTTTAAACTTC
C4 CACGCAAATCATTGAATTTC
C5 CACGCAAATCATTGAATTTC
C6 CGCGCAAATCCTTGAATTTC
C7 CTCGCAAGTCTTTGAATTTC
* *****.** **.** ***
>C1
ATGTCGTCGACAAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT
GAAAATCGTGGAAACCCCAAAGGAGCAGCATGAGTTCGGAAAACGCGAGT
GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC
AGCTCAGGACACGGAAAGTTCCAAACCGAACTCAAAAAGCGCCGCAAAAA
CAAACTGAATCGCATGTACACTTACGAGGCTGATAAGAATTTCATCAAGG
CTCGCAAATCTTTGAACTTC
>C2
ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT
GAAAATCGTGGAAACCCCAAAGGAGCAGAAGGAATTTGGAAAACGCGAGT
GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC
AGCTCAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAACGTCGCAAGAA
CAAACTGAATCGCCTTTACACTTACGAGGCTGACAAGAATTTCATCAAGG
CGCGCAAGTCTTTAAACTTC
>C3
ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT
GAAAATCGTGGAAACCCCAAAGGAGCAGAAGGAATTTGGAAAACGCGAGT
GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC
AGCTCAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAACGCCGCAAGAA
CAAACTGAATCGCCTTTACACTTACGAGGCTGACAAGAATTTCATCAAGG
CGCGCAAGTCTTTAAACTTC
>C4
ATGTCGTCGACCAATGAAACCAACCAACTGCTGCAGCGCTTGAACAGCTT
GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT
GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCAACCCCTAGC
AGCGGAGGACTTGGAAAGTTCCAAACCGAACTCAAGAAACGTCGCAAAAA
CAAAGTGAATCGCATGTGCACTTACGAGGCTGACAAGCAATTCATCAAGG
CACGCAAATCATTGAATTTC
>C5
ATGTCGTCGACCAATGAAACCAACCAACTGCTGCAGCGCCTGAACAGCTT
GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT
GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCGAGC
AGCGGAGGGCTCGGAAAGTTCCAAACTGAACTCAAAAAACGTCGCAAAAA
CAAAGTGAATCGCATGTGCACTTACGAGGCTGACAAGCAATTCATCAAGG
CACGCAAATCATTGAATTTC
>C6
ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTAAACAGCTT
GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT
GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCTAGC
AGCGGAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAGCGTCGCAAAAA
CAAACTGAATCGCATGTGCACTTACGAGGCTGACAAGCTTTTTATCAAGG
CGCGCAAATCCTTGAATTTC
>C7
ATGTCGATGATCAACGAAACCAACCAAATGTTGCAGCGCCTGAACAGCCT
GAAAATTGTGGAAACCCCCAAGGAGCAACGCGAATTGGGCAGTCGGGAGT
GTTACTCTCTGGACAGCAAGAAGTATGCCCTGGTACCAGCCACCCCGAGC
ACCGGAGGACCCGGAAAGTTCCAAACCGAACTGAAGAAACGTCGCAAAAA
CAAACTCAACCGAATGTACACCTACGAGGCGGACAAACACTTTATCAAGG
CTCGCAAGTCTTTGAATTTC
>C1
MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF
>C2
MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
>C3
MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
>C4
MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
>C5
MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
>C6
MSSTNETNQVLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
SGGHGKFQTELKKRRKNKLNRMCTYEADKLFIKARKSLNF
>C7
MSMINETNQMLQRLNSLKIVETPKEQRELGSRECYSLDSKKYALVPATPS
TGGPGKFQTELKKRRKNKLNRMYTYEADKHFIKARKSLNF
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 7 taxa and 270 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1481281519
Setting output file names to "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 8831804
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 0641715986
Seed = 701167743
Swapseed = 1481281519
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 15 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 38 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1005.264594 -- -24.557203
Chain 2 -- -1004.800993 -- -24.557203
Chain 3 -- -964.556117 -- -24.557203
Chain 4 -- -1006.096554 -- -24.557203
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -949.570246 -- -24.557203
Chain 2 -- -1012.329106 -- -24.557203
Chain 3 -- -983.572168 -- -24.557203
Chain 4 -- -956.479304 -- -24.557203
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1005.265] (-1004.801) (-964.556) (-1006.097) * [-949.570] (-1012.329) (-983.572) (-956.479)
500 -- (-776.966) (-768.918) [-773.799] (-770.982) * (-769.876) (-773.724) [-778.803] (-777.726) -- 0:00:00
1000 -- [-769.576] (-757.805) (-771.949) (-780.038) * [-750.735] (-766.156) (-769.168) (-774.436) -- 0:00:00
1500 -- (-769.431) [-757.505] (-766.573) (-764.716) * (-750.950) [-763.837] (-765.830) (-774.680) -- 0:00:00
2000 -- [-760.030] (-758.411) (-756.420) (-760.365) * (-752.930) (-751.913) (-757.414) [-767.631] -- 0:00:00
2500 -- (-758.763) (-749.862) [-756.269] (-759.401) * (-745.177) [-749.704] (-754.607) (-765.823) -- 0:06:39
3000 -- (-762.069) (-751.775) (-755.384) [-756.472] * [-749.396] (-756.094) (-752.632) (-764.201) -- 0:05:32
3500 -- (-758.401) [-743.933] (-758.975) (-752.108) * (-748.958) [-757.532] (-754.027) (-768.125) -- 0:04:44
4000 -- (-751.671) [-749.747] (-746.330) (-746.767) * [-746.057] (-748.296) (-751.138) (-752.148) -- 0:04:09
4500 -- (-755.709) [-749.651] (-753.164) (-747.307) * [-756.405] (-750.864) (-751.031) (-762.844) -- 0:03:41
5000 -- (-759.393) (-756.061) (-754.114) [-751.674] * [-755.250] (-755.556) (-751.344) (-757.614) -- 0:03:19
Average standard deviation of split frequencies: 0.052378
5500 -- (-761.829) (-748.649) [-749.455] (-749.285) * (-745.931) (-750.429) [-747.884] (-753.596) -- 0:03:00
6000 -- (-756.357) (-749.736) [-748.546] (-746.348) * (-752.315) [-749.100] (-749.157) (-748.979) -- 0:02:45
6500 -- (-758.032) (-750.421) [-745.888] (-752.654) * (-756.094) (-746.693) [-748.141] (-747.989) -- 0:02:32
7000 -- (-754.495) (-756.011) (-747.335) [-750.683] * [-749.504] (-749.853) (-753.707) (-748.101) -- 0:02:21
7500 -- [-745.431] (-752.062) (-751.338) (-744.057) * (-750.811) (-749.713) (-746.542) [-754.210] -- 0:04:24
8000 -- (-751.714) (-750.499) [-745.003] (-754.028) * (-751.797) (-748.319) [-744.915] (-757.561) -- 0:04:08
8500 -- (-762.041) [-744.881] (-751.491) (-745.817) * (-761.131) (-744.675) [-746.912] (-757.962) -- 0:03:53
9000 -- (-757.298) (-746.199) [-748.550] (-751.900) * [-753.898] (-748.180) (-745.324) (-751.221) -- 0:03:40
9500 -- [-754.606] (-750.746) (-746.886) (-757.445) * [-750.818] (-750.000) (-750.138) (-752.124) -- 0:03:28
10000 -- (-766.153) [-751.873] (-747.413) (-748.407) * (-753.689) [-747.491] (-749.715) (-756.177) -- 0:03:18
Average standard deviation of split frequencies: 0.007366
10500 -- [-760.043] (-748.930) (-756.038) (-749.408) * (-745.646) (-748.507) [-747.914] (-751.144) -- 0:03:08
11000 -- (-751.689) (-750.242) (-747.325) [-741.966] * (-749.416) [-752.632] (-753.618) (-752.767) -- 0:02:59
11500 -- (-747.569) (-752.773) (-749.014) [-747.272] * (-744.471) (-755.623) [-744.172] (-748.001) -- 0:02:51
12000 -- (-752.546) [-753.606] (-756.774) (-744.182) * (-751.579) [-752.479] (-757.496) (-744.274) -- 0:02:44
12500 -- (-754.131) (-749.158) (-749.329) [-752.656] * (-749.888) (-750.665) (-747.536) [-751.307] -- 0:02:38
13000 -- (-756.064) (-751.409) [-749.675] (-748.578) * (-759.998) (-748.862) [-745.470] (-750.767) -- 0:03:47
13500 -- (-750.431) [-751.362] (-745.138) (-745.211) * (-759.708) [-752.214] (-750.231) (-745.674) -- 0:03:39
14000 -- [-743.379] (-755.289) (-748.093) (-754.023) * [-746.693] (-751.533) (-749.008) (-761.236) -- 0:03:31
14500 -- (-746.254) (-753.433) [-747.574] (-751.391) * [-751.329] (-754.795) (-748.670) (-760.370) -- 0:03:23
15000 -- (-746.740) (-754.560) (-751.425) [-747.500] * (-750.308) [-751.087] (-753.106) (-747.582) -- 0:03:17
Average standard deviation of split frequencies: 0.034373
15500 -- [-742.787] (-752.016) (-748.431) (-747.920) * [-753.141] (-749.130) (-756.415) (-750.455) -- 0:03:10
16000 -- (-750.734) (-751.355) [-748.566] (-754.261) * (-754.059) (-751.900) [-753.473] (-746.880) -- 0:03:04
16500 -- (-748.278) (-756.901) [-747.236] (-750.885) * (-751.133) [-746.467] (-751.336) (-750.940) -- 0:02:58
17000 -- (-750.662) (-759.341) [-753.376] (-752.180) * (-746.936) (-746.614) (-752.589) [-753.629] -- 0:02:53
17500 -- [-746.833] (-749.090) (-751.079) (-752.616) * (-748.345) [-746.489] (-750.912) (-751.430) -- 0:03:44
18000 -- (-754.277) (-747.443) [-747.091] (-746.993) * [-748.596] (-752.210) (-755.503) (-748.534) -- 0:03:38
18500 -- (-751.917) [-745.226] (-752.657) (-750.203) * [-748.464] (-745.499) (-758.086) (-755.322) -- 0:03:32
19000 -- (-746.049) (-751.410) (-750.388) [-745.030] * (-747.503) [-747.511] (-754.579) (-754.950) -- 0:03:26
19500 -- (-752.958) (-748.975) (-756.269) [-746.884] * (-750.962) [-749.742] (-746.743) (-755.752) -- 0:03:21
20000 -- (-753.504) (-753.572) (-753.814) [-742.702] * (-749.476) (-751.101) [-749.725] (-752.870) -- 0:03:16
Average standard deviation of split frequencies: 0.011405
20500 -- [-748.422] (-755.346) (-750.559) (-757.703) * (-745.438) (-746.989) [-752.038] (-753.118) -- 0:03:11
21000 -- (-745.264) (-756.304) (-745.781) [-743.604] * [-750.790] (-754.962) (-751.739) (-751.558) -- 0:03:06
21500 -- (-753.003) [-752.241] (-746.868) (-751.027) * (-750.108) (-746.907) [-744.749] (-748.298) -- 0:03:02
22000 -- (-750.307) (-753.500) [-748.278] (-755.508) * (-748.308) (-750.854) (-748.226) [-747.273] -- 0:03:42
22500 -- (-747.436) (-757.401) [-748.815] (-750.038) * (-748.151) (-749.651) (-749.915) [-750.718] -- 0:03:37
23000 -- (-752.004) (-752.520) [-747.978] (-747.418) * [-747.269] (-751.006) (-748.826) (-752.122) -- 0:03:32
23500 -- (-752.037) (-753.265) [-746.299] (-755.376) * (-746.222) (-752.735) (-757.576) [-751.200] -- 0:03:27
24000 -- (-749.488) (-747.301) [-752.764] (-744.353) * [-747.347] (-748.463) (-748.830) (-748.740) -- 0:03:23
24500 -- (-747.735) (-758.252) [-744.908] (-749.172) * [-746.968] (-752.166) (-750.295) (-750.777) -- 0:03:19
25000 -- (-748.651) (-750.257) [-745.626] (-749.963) * (-751.727) [-746.123] (-755.702) (-749.910) -- 0:03:15
Average standard deviation of split frequencies: 0.024175
25500 -- (-746.159) [-746.542] (-748.745) (-750.269) * (-747.095) (-747.296) (-750.847) [-749.321] -- 0:03:11
26000 -- (-747.135) [-749.325] (-749.474) (-744.335) * (-749.545) [-747.148] (-749.995) (-748.817) -- 0:03:07
26500 -- [-745.820] (-750.772) (-746.685) (-746.366) * (-747.991) (-748.630) [-746.821] (-753.089) -- 0:03:03
27000 -- [-752.516] (-754.197) (-748.930) (-746.355) * (-752.120) (-747.844) (-749.599) [-746.936] -- 0:03:36
27500 -- (-749.330) [-748.998] (-747.368) (-753.078) * [-752.430] (-756.670) (-747.170) (-751.566) -- 0:03:32
28000 -- [-744.279] (-756.932) (-753.564) (-753.018) * (-757.683) (-748.064) [-750.342] (-753.783) -- 0:03:28
28500 -- (-744.648) (-753.067) [-743.003] (-746.495) * [-748.683] (-752.296) (-747.683) (-759.401) -- 0:03:24
29000 -- (-756.826) (-754.392) (-751.601) [-746.096] * (-745.650) [-747.155] (-751.842) (-752.463) -- 0:03:20
29500 -- [-747.878] (-752.411) (-743.244) (-746.495) * (-754.277) (-753.745) (-744.383) [-745.739] -- 0:03:17
30000 -- (-749.664) [-747.772] (-749.341) (-747.501) * (-758.987) (-746.040) [-744.802] (-757.074) -- 0:03:14
Average standard deviation of split frequencies: 0.038430
30500 -- (-757.155) [-753.708] (-744.946) (-752.251) * (-748.101) [-754.923] (-750.534) (-748.697) -- 0:03:10
31000 -- (-750.974) (-746.580) (-750.894) [-748.761] * (-752.086) (-748.599) (-752.813) [-750.341] -- 0:03:07
31500 -- (-751.871) (-747.789) (-746.716) [-747.272] * (-747.138) [-751.003] (-752.341) (-755.959) -- 0:03:04
32000 -- (-750.548) (-763.232) (-748.492) [-748.871] * (-754.214) [-748.614] (-749.265) (-751.068) -- 0:03:31
32500 -- (-749.645) (-748.539) [-756.834] (-745.228) * (-764.882) [-746.923] (-749.531) (-747.781) -- 0:03:28
33000 -- (-747.100) (-753.236) [-748.802] (-753.335) * [-755.699] (-752.100) (-749.186) (-750.921) -- 0:03:25
33500 -- (-750.473) [-750.299] (-746.906) (-752.366) * (-754.153) [-752.007] (-753.878) (-746.524) -- 0:03:21
34000 -- (-755.814) [-753.916] (-743.974) (-753.320) * (-747.784) (-754.120) [-744.553] (-746.285) -- 0:03:18
34500 -- [-761.059] (-751.179) (-746.926) (-759.113) * (-757.689) (-751.258) (-744.365) [-746.909] -- 0:03:15
35000 -- (-748.633) [-752.532] (-754.488) (-753.511) * (-759.467) [-749.196] (-748.156) (-749.440) -- 0:03:13
Average standard deviation of split frequencies: 0.026189
35500 -- (-756.433) (-751.737) [-751.934] (-760.216) * (-751.294) [-752.113] (-747.683) (-745.666) -- 0:03:10
36000 -- (-754.605) [-755.459] (-758.757) (-755.172) * [-746.296] (-751.927) (-753.577) (-751.868) -- 0:03:07
36500 -- (-752.496) [-750.028] (-759.305) (-746.312) * [-750.238] (-755.693) (-748.884) (-744.741) -- 0:03:04
37000 -- [-753.046] (-748.316) (-755.651) (-746.886) * [-745.986] (-746.095) (-757.211) (-756.071) -- 0:03:28
37500 -- (-747.242) (-757.067) (-758.997) [-751.149] * (-749.636) (-750.788) (-752.435) [-748.376] -- 0:03:25
38000 -- [-757.172] (-747.928) (-754.497) (-766.318) * [-745.251] (-749.787) (-747.828) (-755.134) -- 0:03:22
38500 -- (-761.419) [-747.963] (-750.153) (-761.275) * (-744.739) (-746.231) (-744.315) [-745.545] -- 0:03:19
39000 -- (-755.470) [-749.021] (-750.983) (-762.536) * [-747.998] (-750.019) (-749.464) (-755.573) -- 0:03:17
39500 -- (-749.790) [-744.027] (-751.965) (-762.788) * (-748.852) (-748.445) [-745.719] (-754.674) -- 0:03:14
40000 -- (-751.565) (-755.889) (-753.861) [-758.531] * (-745.305) (-758.237) (-752.540) [-748.290] -- 0:03:12
Average standard deviation of split frequencies: 0.021252
40500 -- [-747.208] (-751.127) (-758.363) (-755.178) * (-748.945) [-746.634] (-745.940) (-747.931) -- 0:03:09
41000 -- (-754.598) (-752.565) (-759.876) [-752.944] * (-749.744) (-754.439) [-745.786] (-745.997) -- 0:03:07
41500 -- (-752.608) (-761.029) (-748.422) [-753.176] * [-748.548] (-746.653) (-747.774) (-750.198) -- 0:03:04
42000 -- (-748.437) (-748.673) (-744.679) [-749.802] * (-758.186) (-749.106) [-751.317] (-746.823) -- 0:03:02
42500 -- (-755.902) [-750.223] (-756.754) (-744.337) * (-748.392) [-747.234] (-749.130) (-747.811) -- 0:03:22
43000 -- [-745.160] (-754.990) (-759.529) (-748.421) * (-749.569) (-747.268) [-747.799] (-748.154) -- 0:03:20
43500 -- (-756.930) (-751.108) (-751.415) [-750.360] * (-751.263) (-743.911) (-750.914) [-749.021] -- 0:03:17
44000 -- [-743.835] (-751.373) (-752.440) (-756.148) * [-752.936] (-749.700) (-749.770) (-751.580) -- 0:03:15
44500 -- (-745.712) [-749.407] (-751.079) (-751.668) * (-750.852) (-751.063) (-747.109) [-754.231] -- 0:03:13
45000 -- (-752.471) [-745.036] (-748.781) (-753.804) * (-754.678) [-748.348] (-757.014) (-748.484) -- 0:03:11
Average standard deviation of split frequencies: 0.017080
45500 -- (-756.313) [-746.946] (-751.406) (-751.306) * (-746.314) (-746.257) [-751.578] (-757.825) -- 0:03:08
46000 -- [-755.214] (-749.923) (-750.393) (-753.312) * (-751.771) (-749.085) [-747.665] (-748.032) -- 0:03:06
46500 -- (-757.344) [-746.053] (-751.003) (-748.707) * (-758.217) [-744.634] (-755.309) (-746.525) -- 0:03:25
47000 -- [-752.418] (-750.153) (-745.958) (-751.730) * (-744.112) (-752.694) (-752.881) [-749.170] -- 0:03:22
47500 -- (-760.638) (-746.927) [-747.447] (-752.365) * (-746.991) (-755.233) [-750.132] (-757.710) -- 0:03:20
48000 -- [-746.781] (-753.757) (-750.265) (-757.166) * (-751.293) (-747.873) [-751.744] (-753.713) -- 0:03:18
48500 -- (-747.260) [-754.022] (-745.287) (-751.435) * (-746.650) (-751.915) [-747.925] (-754.745) -- 0:03:16
49000 -- [-748.833] (-749.967) (-748.913) (-749.049) * [-747.075] (-750.703) (-750.824) (-753.487) -- 0:03:14
49500 -- [-750.905] (-748.592) (-754.989) (-750.422) * (-751.164) [-747.883] (-748.522) (-755.539) -- 0:03:12
50000 -- (-746.007) (-749.762) [-742.415] (-753.344) * (-747.438) (-748.365) (-749.342) [-751.650] -- 0:03:10
Average standard deviation of split frequencies: 0.013956
50500 -- (-746.306) (-749.881) (-742.885) [-748.408] * [-747.084] (-748.701) (-748.334) (-753.574) -- 0:03:08
51000 -- [-751.436] (-748.823) (-751.651) (-749.776) * (-748.029) (-750.252) (-746.953) [-757.065] -- 0:03:06
51500 -- [-749.235] (-749.083) (-746.056) (-749.682) * [-756.155] (-750.143) (-749.323) (-751.432) -- 0:03:04
52000 -- (-748.360) [-749.659] (-748.639) (-747.344) * [-748.877] (-754.032) (-751.353) (-761.121) -- 0:03:20
52500 -- [-750.192] (-758.383) (-747.275) (-751.120) * (-750.340) [-746.646] (-744.858) (-760.106) -- 0:03:18
53000 -- [-744.328] (-752.758) (-746.857) (-750.388) * (-746.671) (-749.156) (-748.995) [-750.195] -- 0:03:16
53500 -- (-753.996) (-748.775) (-750.690) [-750.845] * (-755.336) [-745.630] (-744.189) (-744.639) -- 0:03:14
54000 -- [-752.528] (-753.360) (-751.778) (-754.776) * [-748.801] (-751.493) (-750.217) (-744.533) -- 0:03:12
54500 -- [-753.652] (-753.673) (-746.790) (-754.484) * (-748.241) (-749.528) (-758.746) [-743.892] -- 0:03:10
55000 -- [-753.784] (-752.700) (-754.186) (-749.985) * [-745.683] (-750.017) (-749.954) (-755.982) -- 0:03:09
Average standard deviation of split frequencies: 0.014030
55500 -- (-751.017) (-760.565) [-745.256] (-750.225) * (-751.335) (-744.450) [-754.561] (-750.810) -- 0:03:07
56000 -- (-748.067) (-759.669) (-751.559) [-746.546] * (-746.555) [-742.795] (-748.806) (-755.588) -- 0:03:05
56500 -- (-751.892) (-756.745) (-751.558) [-751.988] * (-747.797) (-750.340) [-748.949] (-750.221) -- 0:03:03
57000 -- (-744.974) (-752.276) (-749.758) [-743.467] * (-752.818) [-747.153] (-744.663) (-751.332) -- 0:03:18
57500 -- (-751.725) (-760.299) [-746.202] (-750.724) * (-751.087) [-750.026] (-747.690) (-749.187) -- 0:03:16
58000 -- (-751.053) (-755.074) (-749.937) [-746.207] * (-749.490) [-746.763] (-745.450) (-746.160) -- 0:03:14
58500 -- (-750.623) (-758.222) [-754.147] (-749.592) * [-747.163] (-750.617) (-744.424) (-746.773) -- 0:03:13
59000 -- (-751.797) (-755.058) (-744.490) [-751.070] * (-750.289) [-750.054] (-747.949) (-743.709) -- 0:03:11
59500 -- (-761.698) (-752.015) (-748.819) [-745.521] * (-752.522) (-748.254) [-746.925] (-746.441) -- 0:03:09
60000 -- (-749.699) [-747.959] (-742.686) (-741.967) * (-748.007) (-752.370) (-753.930) [-743.598] -- 0:03:08
Average standard deviation of split frequencies: 0.016836
60500 -- (-752.832) [-752.170] (-744.615) (-746.767) * (-751.929) (-758.464) (-744.969) [-751.786] -- 0:03:06
61000 -- (-749.356) (-749.913) (-748.727) [-749.654] * (-747.327) (-750.003) (-749.044) [-751.969] -- 0:03:04
61500 -- (-757.083) (-747.720) (-750.899) [-744.574] * (-747.055) (-746.621) [-754.283] (-750.898) -- 0:03:18
62000 -- (-754.585) (-754.254) [-747.565] (-756.887) * [-747.795] (-754.885) (-749.935) (-752.501) -- 0:03:16
62500 -- [-745.671] (-746.614) (-745.630) (-751.898) * [-743.455] (-747.537) (-750.223) (-753.719) -- 0:03:15
63000 -- (-749.766) (-754.091) [-747.510] (-746.123) * (-747.416) (-757.396) [-746.358] (-750.547) -- 0:03:13
63500 -- (-750.716) [-742.775] (-749.760) (-750.456) * (-750.317) (-748.166) (-750.633) [-747.050] -- 0:03:11
64000 -- (-746.870) (-751.088) (-755.255) [-746.006] * (-756.758) [-744.161] (-753.158) (-752.696) -- 0:03:10
64500 -- (-755.898) (-746.701) [-747.961] (-750.423) * (-751.588) [-746.836] (-747.615) (-747.758) -- 0:03:08
65000 -- (-753.439) (-753.058) (-752.593) [-746.785] * (-747.551) [-748.622] (-747.783) (-752.703) -- 0:03:07
Average standard deviation of split frequencies: 0.015475
65500 -- (-761.113) (-750.095) [-744.660] (-750.399) * (-749.144) (-751.780) (-750.498) [-746.268] -- 0:03:05
66000 -- (-750.780) [-744.853] (-753.885) (-751.604) * (-749.015) [-744.793] (-746.222) (-757.119) -- 0:03:03
66500 -- (-746.223) [-745.217] (-753.502) (-744.044) * (-748.439) [-751.838] (-749.219) (-747.701) -- 0:03:16
67000 -- (-758.510) (-747.857) (-746.474) [-749.881] * (-749.551) (-748.818) (-748.320) [-752.092] -- 0:03:14
67500 -- [-749.396] (-749.065) (-748.644) (-756.424) * (-755.229) (-745.540) (-752.867) [-751.317] -- 0:03:13
68000 -- [-752.314] (-746.914) (-744.719) (-757.587) * (-750.718) [-747.246] (-749.665) (-750.016) -- 0:03:11
68500 -- (-746.323) (-754.783) [-748.072] (-750.087) * [-746.186] (-753.722) (-751.572) (-755.811) -- 0:03:10
69000 -- (-752.646) (-752.649) (-747.332) [-747.337] * (-759.774) (-752.840) (-753.905) [-753.956] -- 0:03:08
69500 -- (-750.993) [-747.771] (-754.489) (-747.669) * (-747.221) (-750.594) (-750.218) [-743.908] -- 0:03:07
70000 -- [-748.156] (-749.375) (-751.299) (-751.179) * (-750.719) (-756.074) (-754.888) [-747.891] -- 0:03:06
Average standard deviation of split frequencies: 0.013342
70500 -- (-758.816) (-745.972) [-751.139] (-746.017) * [-752.638] (-750.789) (-746.611) (-751.480) -- 0:03:04
71000 -- (-753.963) (-746.866) (-753.638) [-751.219] * (-757.261) (-758.439) [-750.035] (-744.834) -- 0:03:03
71500 -- [-744.460] (-749.028) (-749.776) (-744.129) * (-757.027) [-754.576] (-748.329) (-748.725) -- 0:03:14
72000 -- (-749.752) (-748.753) (-744.325) [-746.931] * (-749.712) (-752.440) (-750.213) [-744.863] -- 0:03:13
72500 -- (-747.497) (-755.680) [-752.008] (-755.607) * (-753.024) [-748.050] (-751.634) (-748.783) -- 0:03:11
73000 -- (-751.163) (-748.457) [-751.632] (-754.641) * [-743.265] (-752.030) (-746.319) (-755.896) -- 0:03:10
73500 -- [-750.906] (-745.988) (-750.959) (-748.211) * [-751.058] (-752.852) (-752.841) (-748.603) -- 0:03:09
74000 -- (-752.555) (-751.155) [-744.221] (-750.911) * [-751.692] (-749.430) (-754.005) (-750.190) -- 0:03:07
74500 -- [-746.497] (-759.453) (-750.478) (-752.322) * [-749.403] (-750.366) (-749.479) (-744.550) -- 0:03:06
75000 -- (-750.537) (-754.405) [-745.966] (-754.261) * (-752.106) [-750.053] (-752.169) (-748.003) -- 0:03:05
Average standard deviation of split frequencies: 0.017574
75500 -- (-750.947) (-747.632) (-754.374) [-751.228] * [-747.385] (-758.085) (-757.493) (-749.088) -- 0:03:03
76000 -- (-755.606) (-752.017) [-749.432] (-745.944) * [-745.494] (-753.830) (-754.285) (-758.385) -- 0:03:02
76500 -- [-750.435] (-749.038) (-749.878) (-748.839) * [-745.120] (-758.332) (-760.767) (-744.201) -- 0:03:13
77000 -- (-753.007) (-750.271) (-750.352) [-744.644] * (-744.724) (-758.390) (-760.491) [-741.853] -- 0:03:11
77500 -- (-752.424) [-750.526] (-748.459) (-752.517) * [-755.086] (-752.245) (-755.289) (-746.654) -- 0:03:10
78000 -- [-751.292] (-753.677) (-744.409) (-746.849) * [-744.290] (-750.809) (-754.422) (-752.487) -- 0:03:09
78500 -- (-750.317) [-745.672] (-754.930) (-751.674) * (-752.839) (-752.265) (-757.874) [-751.847] -- 0:03:07
79000 -- (-748.566) [-749.137] (-751.093) (-757.624) * (-762.360) [-746.533] (-752.854) (-750.386) -- 0:03:06
79500 -- (-745.837) (-753.491) (-748.113) [-746.416] * (-747.040) [-748.046] (-750.639) (-744.965) -- 0:03:05
80000 -- (-755.151) (-749.342) [-752.592] (-749.645) * (-753.378) (-746.779) [-747.518] (-755.062) -- 0:03:04
Average standard deviation of split frequencies: 0.016558
80500 -- (-747.123) (-748.034) (-753.325) [-749.074] * (-752.275) [-744.510] (-753.916) (-743.206) -- 0:03:02
81000 -- (-744.325) (-745.998) [-748.843] (-752.063) * (-746.495) (-746.131) [-747.440] (-749.749) -- 0:03:01
81500 -- (-754.049) [-752.283] (-749.391) (-754.989) * (-758.614) [-749.734] (-745.671) (-754.524) -- 0:03:11
82000 -- [-754.494] (-750.897) (-749.765) (-753.674) * (-757.704) [-752.997] (-749.958) (-754.510) -- 0:03:10
82500 -- [-747.749] (-752.866) (-754.982) (-749.170) * (-746.411) [-753.055] (-754.310) (-752.936) -- 0:03:09
83000 -- (-749.847) [-752.933] (-751.601) (-744.625) * (-750.595) (-752.213) (-748.501) [-750.411] -- 0:03:07
83500 -- (-755.135) [-752.082] (-749.060) (-751.587) * (-758.320) (-747.158) (-754.779) [-746.712] -- 0:03:06
84000 -- (-757.157) [-751.038] (-748.839) (-747.797) * (-755.549) [-752.220] (-746.623) (-755.519) -- 0:03:05
84500 -- (-744.109) (-752.755) (-746.893) [-751.227] * (-750.594) (-751.012) [-748.259] (-750.771) -- 0:03:04
85000 -- (-755.024) (-745.290) [-754.175] (-745.953) * [-747.209] (-744.228) (-749.748) (-745.946) -- 0:03:03
Average standard deviation of split frequencies: 0.021926
85500 -- (-760.109) [-746.306] (-752.080) (-754.264) * (-752.295) (-749.899) (-753.852) [-752.285] -- 0:03:01
86000 -- (-760.321) (-761.021) (-754.505) [-746.421] * (-755.001) [-747.095] (-746.798) (-746.922) -- 0:03:00
86500 -- (-762.736) (-752.790) (-751.527) [-748.836] * (-754.176) (-749.661) (-747.717) [-745.161] -- 0:03:10
87000 -- (-770.937) [-751.104] (-747.548) (-747.565) * (-751.669) (-748.482) [-748.563] (-755.458) -- 0:03:08
87500 -- (-763.523) (-758.178) [-747.200] (-755.691) * (-757.113) (-753.243) (-745.411) [-743.506] -- 0:03:07
88000 -- [-753.324] (-753.310) (-752.086) (-749.031) * (-751.395) (-744.569) [-744.097] (-756.703) -- 0:03:06
88500 -- (-746.736) [-754.154] (-746.250) (-751.626) * (-761.869) (-744.696) [-751.124] (-754.625) -- 0:03:05
89000 -- (-749.104) (-748.331) [-747.171] (-746.387) * (-755.470) (-747.497) [-745.132] (-752.329) -- 0:03:04
89500 -- (-743.446) (-755.637) [-753.648] (-744.836) * (-752.757) [-747.270] (-757.751) (-753.473) -- 0:03:03
90000 -- (-745.275) [-755.408] (-744.982) (-745.648) * (-747.909) [-755.142] (-751.181) (-750.254) -- 0:03:02
Average standard deviation of split frequencies: 0.024263
90500 -- (-748.218) (-746.758) (-747.640) [-752.125] * [-750.529] (-754.579) (-745.896) (-751.460) -- 0:03:00
91000 -- (-748.998) (-749.086) [-749.411] (-748.345) * (-744.521) (-751.039) [-748.620] (-748.389) -- 0:02:59
91500 -- [-751.239] (-746.833) (-748.086) (-743.331) * (-743.569) [-747.274] (-746.657) (-752.753) -- 0:03:08
92000 -- (-747.660) (-747.830) (-748.040) [-749.038] * [-742.799] (-755.382) (-748.877) (-750.837) -- 0:03:07
92500 -- [-745.528] (-749.852) (-757.015) (-751.127) * [-748.364] (-748.211) (-748.645) (-748.622) -- 0:03:06
93000 -- (-755.271) [-748.222] (-749.843) (-746.912) * (-744.645) (-754.140) (-750.224) [-751.463] -- 0:03:05
93500 -- (-760.187) (-756.378) (-749.428) [-742.502] * (-749.896) [-749.231] (-753.844) (-753.458) -- 0:03:04
94000 -- (-757.511) (-749.989) (-753.477) [-752.581] * [-754.179] (-753.257) (-746.459) (-746.757) -- 0:03:03
94500 -- (-754.673) (-754.589) (-750.983) [-746.336] * [-744.925] (-755.146) (-750.593) (-746.333) -- 0:03:02
95000 -- (-747.861) [-749.303] (-748.701) (-754.799) * [-747.618] (-747.546) (-761.235) (-749.190) -- 0:03:01
Average standard deviation of split frequencies: 0.028644
95500 -- (-757.960) (-751.558) [-747.591] (-752.052) * [-749.417] (-756.871) (-751.016) (-743.224) -- 0:02:59
96000 -- (-752.961) (-756.471) (-749.993) [-750.000] * (-745.404) (-761.059) [-748.221] (-749.544) -- 0:02:58
96500 -- (-756.794) (-746.328) [-746.135] (-748.801) * (-747.680) [-749.264] (-755.495) (-747.512) -- 0:02:57
97000 -- (-750.575) (-743.927) [-754.731] (-747.964) * (-747.642) (-750.969) (-751.771) [-747.443] -- 0:03:06
97500 -- (-753.244) (-748.606) [-745.893] (-748.775) * (-748.456) [-752.865] (-756.350) (-748.705) -- 0:03:05
98000 -- [-747.663] (-746.859) (-753.528) (-753.805) * (-750.387) (-759.174) [-749.111] (-752.120) -- 0:03:04
98500 -- [-749.279] (-748.012) (-748.562) (-750.398) * [-749.378] (-758.943) (-752.183) (-748.959) -- 0:03:03
99000 -- (-755.342) [-750.430] (-750.235) (-750.199) * (-751.245) [-752.888] (-747.679) (-757.206) -- 0:03:02
99500 -- (-750.609) [-745.866] (-751.046) (-753.112) * (-755.598) (-750.842) [-749.504] (-748.101) -- 0:03:01
100000 -- [-758.009] (-755.199) (-745.059) (-752.209) * (-761.349) (-748.539) [-747.647] (-750.706) -- 0:03:00
Average standard deviation of split frequencies: 0.025756
100500 -- (-749.546) (-752.271) [-746.064] (-748.237) * (-760.807) (-757.245) [-749.536] (-749.506) -- 0:02:59
101000 -- [-748.479] (-749.265) (-749.224) (-753.597) * (-758.387) (-751.429) (-748.745) [-749.052] -- 0:02:58
101500 -- (-752.052) (-756.583) [-752.369] (-755.937) * (-756.403) (-753.938) [-749.825] (-756.208) -- 0:02:57
102000 -- [-746.651] (-755.046) (-747.117) (-751.746) * [-748.816] (-763.470) (-749.015) (-750.956) -- 0:03:04
102500 -- (-751.683) (-749.560) (-749.680) [-755.538] * [-748.086] (-763.207) (-747.713) (-748.947) -- 0:03:03
103000 -- (-750.085) (-751.888) (-752.416) [-747.786] * [-744.945] (-758.819) (-756.053) (-744.162) -- 0:03:02
103500 -- (-751.693) (-748.717) (-750.539) [-744.529] * (-745.918) (-760.097) (-756.476) [-743.453] -- 0:03:01
104000 -- (-747.921) (-753.050) [-743.544] (-746.646) * (-751.204) (-759.559) [-749.089] (-754.771) -- 0:03:00
104500 -- (-755.734) (-748.742) [-748.915] (-754.669) * (-749.043) (-755.851) [-747.232] (-752.908) -- 0:02:59
105000 -- [-749.223] (-749.731) (-746.928) (-744.848) * (-751.528) [-755.725] (-745.329) (-758.193) -- 0:02:59
Average standard deviation of split frequencies: 0.025942
105500 -- (-748.888) [-753.748] (-747.192) (-753.972) * [-745.812] (-757.942) (-752.409) (-747.739) -- 0:02:58
106000 -- [-750.825] (-750.626) (-749.821) (-751.117) * (-748.660) [-754.313] (-748.227) (-753.730) -- 0:02:57
106500 -- (-745.152) [-745.712] (-761.145) (-752.547) * [-748.097] (-755.005) (-749.742) (-749.551) -- 0:03:04
107000 -- [-745.211] (-750.961) (-755.230) (-748.999) * (-749.566) (-755.632) [-746.414] (-750.678) -- 0:03:03
107500 -- (-748.369) (-751.609) (-751.286) [-742.764] * (-746.096) (-748.367) [-743.812] (-754.905) -- 0:03:02
108000 -- (-760.136) [-745.403] (-751.894) (-749.181) * [-749.485] (-752.604) (-745.335) (-750.003) -- 0:03:01
108500 -- [-747.639] (-763.354) (-744.488) (-745.251) * (-752.378) [-750.519] (-750.071) (-746.745) -- 0:03:00
109000 -- [-749.166] (-767.476) (-747.257) (-753.281) * (-752.960) (-756.911) [-743.615] (-752.713) -- 0:02:59
109500 -- [-750.024] (-774.254) (-751.856) (-748.882) * (-753.220) (-748.518) [-745.567] (-749.721) -- 0:02:58
110000 -- (-748.793) (-754.202) [-752.057] (-750.478) * [-747.982] (-752.123) (-753.120) (-750.531) -- 0:02:58
Average standard deviation of split frequencies: 0.024138
110500 -- (-746.493) [-747.552] (-752.938) (-751.526) * (-750.199) [-747.014] (-747.471) (-749.560) -- 0:03:05
111000 -- [-746.524] (-751.527) (-760.747) (-746.279) * (-753.368) (-750.945) (-749.273) [-749.178] -- 0:03:04
111500 -- [-745.653] (-751.587) (-747.114) (-754.089) * (-754.752) (-750.199) (-752.878) [-747.480] -- 0:03:03
112000 -- (-751.513) (-748.380) (-745.189) [-749.395] * (-754.002) (-762.021) (-748.834) [-745.840] -- 0:03:02
112500 -- (-753.350) (-756.690) (-747.404) [-750.297] * (-758.888) (-757.733) (-751.740) [-746.145] -- 0:03:01
113000 -- [-747.642] (-750.480) (-745.069) (-749.055) * (-753.325) (-751.114) [-748.252] (-750.167) -- 0:03:00
113500 -- [-744.533] (-751.011) (-751.683) (-748.008) * (-756.546) (-749.543) (-748.202) [-745.922] -- 0:02:59
114000 -- (-752.593) [-751.354] (-753.911) (-748.652) * (-746.888) [-748.946] (-747.226) (-746.908) -- 0:02:58
114500 -- (-747.239) [-747.623] (-756.473) (-747.247) * [-743.372] (-751.071) (-749.303) (-750.872) -- 0:02:57
115000 -- [-747.897] (-756.829) (-753.039) (-757.759) * (-752.893) (-750.741) (-745.877) [-752.087] -- 0:02:57
Average standard deviation of split frequencies: 0.021674
115500 -- (-744.787) [-751.230] (-749.133) (-745.379) * [-748.889] (-748.332) (-749.409) (-753.921) -- 0:02:56
116000 -- (-742.054) (-744.944) [-750.808] (-746.795) * (-752.257) [-747.438] (-748.860) (-754.155) -- 0:03:02
116500 -- (-743.576) [-748.223] (-758.529) (-750.387) * (-757.854) (-748.476) [-748.319] (-750.419) -- 0:03:02
117000 -- (-754.772) (-761.856) (-752.861) [-749.804] * [-751.669] (-749.792) (-749.725) (-749.177) -- 0:03:01
117500 -- (-753.512) (-749.142) [-750.171] (-749.052) * [-744.586] (-748.451) (-751.241) (-751.348) -- 0:03:00
118000 -- (-748.699) (-754.449) (-748.587) [-747.424] * (-745.329) (-749.090) (-755.890) [-756.670] -- 0:02:59
118500 -- [-743.167] (-748.778) (-756.064) (-750.063) * (-755.539) (-756.522) [-749.638] (-754.550) -- 0:02:58
119000 -- [-746.239] (-750.634) (-751.551) (-746.803) * [-748.468] (-747.894) (-747.710) (-753.200) -- 0:02:57
119500 -- (-744.675) [-750.792] (-749.193) (-752.486) * (-747.922) (-753.955) (-759.857) [-746.140] -- 0:02:56
120000 -- (-746.061) [-744.547] (-753.121) (-755.755) * (-746.379) (-750.317) (-751.189) [-751.425] -- 0:02:56
Average standard deviation of split frequencies: 0.022789
120500 -- (-758.047) [-749.030] (-755.553) (-752.081) * [-747.438] (-747.281) (-752.003) (-754.629) -- 0:02:55
121000 -- [-744.638] (-756.308) (-753.390) (-747.237) * (-748.833) [-750.120] (-749.278) (-749.863) -- 0:03:01
121500 -- (-757.957) [-747.880] (-754.102) (-752.890) * (-748.365) [-752.761] (-750.005) (-760.717) -- 0:03:00
122000 -- (-752.958) (-757.330) (-750.493) [-753.040] * (-750.519) [-750.063] (-751.052) (-749.718) -- 0:02:59
122500 -- (-746.581) (-747.803) [-748.610] (-754.638) * [-751.200] (-749.380) (-746.701) (-749.987) -- 0:02:59
123000 -- (-749.498) (-756.982) [-749.859] (-749.950) * [-748.693] (-751.847) (-750.719) (-750.193) -- 0:02:58
123500 -- (-750.673) [-748.070] (-753.336) (-750.462) * (-750.071) (-750.284) (-754.530) [-751.621] -- 0:02:57
124000 -- (-748.010) (-758.348) (-744.303) [-744.017] * (-754.098) [-746.819] (-754.943) (-751.045) -- 0:02:56
124500 -- (-755.857) (-751.806) [-749.324] (-751.665) * [-748.753] (-751.839) (-747.895) (-750.991) -- 0:02:55
125000 -- (-755.847) (-750.930) (-760.596) [-745.437] * [-749.041] (-749.831) (-746.729) (-748.661) -- 0:02:55
Average standard deviation of split frequencies: 0.023695
125500 -- (-753.490) (-747.131) (-755.504) [-749.142] * (-753.302) (-746.873) (-746.666) [-753.320] -- 0:02:54
126000 -- (-750.816) (-743.503) (-755.384) [-746.065] * (-753.450) (-753.990) [-745.266] (-752.112) -- 0:03:00
126500 -- (-751.656) (-743.080) [-747.492] (-764.400) * (-756.288) (-754.704) (-748.623) [-750.111] -- 0:02:59
127000 -- (-745.189) [-750.954] (-747.230) (-747.359) * [-751.478] (-754.877) (-750.863) (-749.485) -- 0:02:58
127500 -- (-746.868) (-748.048) (-754.076) [-749.889] * (-747.507) (-753.113) [-750.812] (-746.994) -- 0:02:57
128000 -- (-752.082) (-744.378) (-749.961) [-747.187] * (-755.869) (-749.638) (-748.497) [-752.817] -- 0:02:57
128500 -- (-753.516) [-742.337] (-755.795) (-751.959) * (-753.989) [-751.736] (-746.450) (-758.687) -- 0:02:56
129000 -- (-750.151) (-749.706) (-756.728) [-751.637] * (-754.719) (-751.353) [-747.355] (-745.495) -- 0:02:55
129500 -- [-748.417] (-745.839) (-761.188) (-753.928) * (-759.629) [-747.749] (-748.257) (-754.926) -- 0:02:54
130000 -- (-763.655) (-749.880) (-750.320) [-746.868] * (-755.812) (-757.490) [-749.591] (-755.468) -- 0:02:54
Average standard deviation of split frequencies: 0.028862
130500 -- [-752.817] (-752.563) (-747.994) (-746.626) * [-750.135] (-748.531) (-750.904) (-755.623) -- 0:02:53
131000 -- (-763.435) (-759.598) (-748.233) [-748.588] * (-752.367) (-752.503) [-749.892] (-748.607) -- 0:02:52
131500 -- (-755.034) (-756.547) (-751.634) [-752.888] * (-748.889) (-749.501) [-750.985] (-752.528) -- 0:02:58
132000 -- (-754.842) (-751.577) [-746.010] (-759.522) * (-756.891) (-748.528) [-748.595] (-751.441) -- 0:02:57
132500 -- (-751.068) (-758.318) (-748.189) [-758.010] * (-748.958) (-747.168) [-747.347] (-748.830) -- 0:02:56
133000 -- (-758.640) [-747.802] (-750.684) (-750.349) * (-758.885) (-753.810) (-748.619) [-750.028] -- 0:02:56
133500 -- (-748.648) [-747.499] (-754.931) (-750.252) * [-750.222] (-752.272) (-751.009) (-752.215) -- 0:02:55
134000 -- (-753.319) (-749.018) [-751.777] (-752.858) * (-755.320) (-750.947) (-748.079) [-745.937] -- 0:02:54
134500 -- (-752.596) (-744.856) (-748.721) [-745.327] * [-747.285] (-758.961) (-744.764) (-748.977) -- 0:02:53
135000 -- (-755.121) [-752.003] (-746.253) (-752.965) * [-754.705] (-754.913) (-749.908) (-747.114) -- 0:02:53
Average standard deviation of split frequencies: 0.025997
135500 -- (-748.747) [-752.372] (-749.707) (-751.081) * (-748.313) [-746.960] (-747.754) (-754.428) -- 0:02:52
136000 -- (-752.860) [-753.471] (-747.023) (-747.504) * (-751.852) (-749.007) [-750.925] (-745.669) -- 0:02:51
136500 -- (-749.511) [-747.734] (-753.335) (-749.206) * (-754.718) [-753.141] (-746.526) (-751.624) -- 0:02:57
137000 -- (-748.813) (-754.810) (-755.536) [-745.363] * (-759.197) [-749.562] (-748.751) (-750.548) -- 0:02:56
137500 -- (-745.923) [-750.480] (-754.564) (-749.630) * (-748.565) (-744.207) (-751.801) [-750.141] -- 0:02:55
138000 -- (-755.688) (-751.274) [-751.009] (-746.732) * (-750.763) (-748.844) [-752.157] (-750.978) -- 0:02:54
138500 -- (-745.272) [-747.378] (-751.951) (-749.174) * (-759.252) [-745.630] (-753.222) (-756.938) -- 0:02:54
139000 -- [-752.463] (-752.457) (-749.016) (-753.943) * (-751.918) [-750.966] (-760.243) (-748.603) -- 0:02:53
139500 -- (-749.562) (-750.951) [-746.104] (-748.341) * [-748.190] (-746.274) (-754.869) (-749.499) -- 0:02:52
140000 -- (-751.603) [-747.798] (-752.699) (-752.129) * [-749.171] (-747.779) (-746.932) (-750.051) -- 0:02:52
Average standard deviation of split frequencies: 0.023459
140500 -- (-748.589) (-751.513) [-758.280] (-752.896) * (-753.053) (-749.673) [-750.986] (-746.186) -- 0:02:51
141000 -- (-746.160) (-745.055) [-755.009] (-745.883) * (-754.881) (-751.477) (-747.874) [-745.132] -- 0:02:50
141500 -- (-743.938) (-750.164) [-751.950] (-748.590) * [-752.175] (-748.690) (-751.380) (-747.319) -- 0:02:55
142000 -- [-752.049] (-751.187) (-747.869) (-755.686) * [-752.262] (-747.571) (-751.392) (-746.881) -- 0:02:55
142500 -- (-749.810) (-753.978) (-748.922) [-752.163] * (-749.232) [-747.028] (-749.363) (-752.928) -- 0:02:54
143000 -- [-747.192] (-746.935) (-749.217) (-749.472) * (-751.669) [-746.329] (-747.505) (-754.640) -- 0:02:53
143500 -- (-750.092) [-743.605] (-752.798) (-755.582) * (-747.819) (-742.364) [-747.459] (-752.087) -- 0:02:53
144000 -- [-749.835] (-749.952) (-755.330) (-747.453) * (-748.738) [-749.696] (-749.805) (-753.453) -- 0:02:52
144500 -- [-747.532] (-749.606) (-758.893) (-747.927) * (-753.973) (-749.841) [-745.879] (-750.576) -- 0:02:51
145000 -- (-746.046) (-748.525) [-747.369] (-747.979) * (-753.826) (-754.876) [-758.778] (-754.270) -- 0:02:51
Average standard deviation of split frequencies: 0.022602
145500 -- (-750.156) [-750.708] (-752.050) (-746.782) * [-750.319] (-752.372) (-752.863) (-752.061) -- 0:02:50
146000 -- (-747.113) (-747.865) (-759.036) [-752.250] * (-753.850) (-750.403) [-748.067] (-750.760) -- 0:02:49
146500 -- (-745.577) [-747.617] (-748.863) (-751.557) * (-752.148) (-752.114) (-750.353) [-749.740] -- 0:02:48
147000 -- (-752.474) (-746.702) (-750.969) [-751.656] * (-756.014) [-746.664] (-749.983) (-754.127) -- 0:02:54
147500 -- (-748.472) [-745.135] (-758.171) (-750.183) * [-750.816] (-751.165) (-755.151) (-752.098) -- 0:02:53
148000 -- (-752.167) (-753.526) [-745.765] (-752.001) * (-745.215) (-749.372) (-759.897) [-744.792] -- 0:02:52
148500 -- (-748.717) (-749.295) [-747.707] (-751.163) * (-752.088) [-745.506] (-750.375) (-751.708) -- 0:02:52
149000 -- [-744.774] (-751.468) (-747.176) (-753.810) * (-759.065) (-746.960) [-754.044] (-747.932) -- 0:02:51
149500 -- (-742.552) (-751.262) (-747.534) [-744.653] * [-745.928] (-752.662) (-753.524) (-759.840) -- 0:02:50
150000 -- [-747.981] (-759.989) (-744.426) (-750.045) * [-751.792] (-757.086) (-750.807) (-752.003) -- 0:02:50
Average standard deviation of split frequencies: 0.017208
150500 -- (-750.249) (-754.739) (-752.147) [-750.147] * [-752.301] (-753.350) (-753.042) (-752.417) -- 0:02:49
151000 -- (-747.894) (-754.584) [-744.853] (-746.580) * [-750.186] (-754.050) (-746.047) (-756.977) -- 0:02:48
151500 -- (-744.900) (-757.372) [-749.761] (-758.937) * [-752.466] (-762.773) (-751.477) (-751.855) -- 0:02:48
152000 -- [-754.879] (-752.257) (-747.341) (-756.032) * (-747.449) [-745.732] (-756.938) (-753.349) -- 0:02:52
152500 -- [-750.713] (-754.259) (-751.165) (-754.926) * (-758.718) [-755.446] (-754.960) (-750.567) -- 0:02:52
153000 -- (-747.717) (-750.130) (-760.974) [-744.391] * (-756.954) (-753.791) [-751.837] (-755.489) -- 0:02:51
153500 -- (-747.420) (-749.982) (-748.212) [-750.963] * [-755.021] (-748.285) (-744.700) (-748.129) -- 0:02:50
154000 -- (-749.742) (-754.948) (-753.392) [-748.197] * (-754.113) (-749.328) (-753.121) [-749.400] -- 0:02:50
154500 -- (-749.114) [-746.468] (-754.775) (-747.095) * (-759.231) (-753.253) (-747.010) [-750.253] -- 0:02:49
155000 -- (-746.005) (-758.517) (-762.591) [-746.267] * [-752.867] (-749.981) (-753.973) (-751.365) -- 0:02:49
Average standard deviation of split frequencies: 0.017124
155500 -- [-746.949] (-750.326) (-748.001) (-741.733) * (-752.008) [-746.411] (-757.047) (-752.324) -- 0:02:48
156000 -- (-750.368) (-755.014) (-745.855) [-743.630] * (-750.392) (-745.633) [-745.695] (-759.350) -- 0:02:47
156500 -- [-744.386] (-743.482) (-745.477) (-744.999) * (-749.669) [-749.740] (-748.884) (-752.002) -- 0:02:47
157000 -- (-766.840) (-763.166) (-750.678) [-743.153] * (-751.989) (-756.087) [-747.383] (-758.060) -- 0:02:46
157500 -- (-753.521) [-753.594] (-750.174) (-749.042) * [-747.726] (-745.456) (-744.488) (-748.543) -- 0:02:51
158000 -- (-750.368) (-755.904) [-748.688] (-749.429) * (-748.704) [-747.430] (-747.899) (-755.063) -- 0:02:50
158500 -- (-754.795) (-749.807) [-745.313] (-750.912) * (-749.605) [-747.367] (-747.877) (-749.729) -- 0:02:49
159000 -- (-756.847) (-751.065) [-747.645] (-746.677) * (-750.480) [-747.794] (-748.303) (-750.461) -- 0:02:49
159500 -- (-751.116) (-754.935) [-749.606] (-752.705) * (-754.861) [-746.442] (-751.191) (-754.286) -- 0:02:48
160000 -- (-755.915) (-746.463) (-747.465) [-753.137] * (-758.863) (-747.613) [-751.642] (-745.612) -- 0:02:48
Average standard deviation of split frequencies: 0.016626
160500 -- (-753.376) (-754.023) [-745.176] (-749.073) * (-752.982) (-747.194) (-746.747) [-747.670] -- 0:02:47
161000 -- (-752.327) (-753.177) [-745.811] (-754.600) * (-746.773) (-746.984) [-749.130] (-745.012) -- 0:02:46
161500 -- (-750.842) (-745.498) [-753.137] (-749.043) * [-746.723] (-750.659) (-755.414) (-745.248) -- 0:02:46
162000 -- (-750.520) (-746.292) (-748.758) [-753.170] * [-751.060] (-750.446) (-752.835) (-750.220) -- 0:02:45
162500 -- (-765.767) (-750.037) [-750.424] (-757.604) * (-751.437) (-746.630) (-760.569) [-747.349] -- 0:02:50
163000 -- (-751.230) [-746.027] (-749.334) (-755.685) * [-746.933] (-748.109) (-754.066) (-746.048) -- 0:02:49
163500 -- (-755.995) (-747.664) (-756.337) [-748.874] * (-752.482) [-745.617] (-754.957) (-747.013) -- 0:02:48
164000 -- (-755.869) [-754.751] (-751.161) (-750.444) * [-745.460] (-755.455) (-756.199) (-749.754) -- 0:02:48
164500 -- [-747.456] (-750.606) (-744.203) (-753.776) * [-746.022] (-748.832) (-751.848) (-752.847) -- 0:02:47
165000 -- (-744.289) [-747.978] (-748.629) (-754.075) * (-749.027) (-760.081) (-750.494) [-746.488] -- 0:02:47
Average standard deviation of split frequencies: 0.014672
165500 -- (-748.861) (-753.640) (-754.300) [-745.710] * [-747.124] (-747.314) (-752.164) (-746.558) -- 0:02:46
166000 -- (-751.607) (-748.767) [-756.714] (-745.944) * (-750.301) (-751.884) (-759.790) [-756.809] -- 0:02:45
166500 -- [-753.601] (-751.823) (-757.428) (-744.635) * (-757.132) (-751.200) (-755.467) [-747.529] -- 0:02:45
167000 -- [-745.620] (-748.447) (-760.676) (-742.623) * (-759.207) [-745.895] (-750.533) (-750.874) -- 0:02:44
167500 -- [-749.997] (-743.358) (-748.388) (-758.710) * (-751.915) [-743.358] (-749.598) (-759.296) -- 0:02:48
168000 -- (-750.420) [-744.996] (-752.409) (-748.888) * [-752.642] (-752.809) (-753.446) (-749.805) -- 0:02:48
168500 -- (-754.793) [-746.580] (-759.889) (-746.992) * (-752.681) (-746.537) (-762.638) [-753.559] -- 0:02:47
169000 -- [-758.562] (-751.302) (-754.229) (-752.669) * (-748.032) [-748.573] (-757.227) (-754.533) -- 0:02:47
169500 -- (-763.306) (-747.813) [-749.740] (-748.931) * (-753.302) (-751.178) [-755.415] (-760.760) -- 0:02:46
170000 -- (-748.189) (-745.086) [-751.895] (-757.931) * (-748.080) [-750.318] (-753.090) (-756.109) -- 0:02:46
Average standard deviation of split frequencies: 0.013811
170500 -- (-755.376) [-746.607] (-751.627) (-748.120) * [-749.755] (-749.914) (-750.195) (-748.695) -- 0:02:45
171000 -- (-753.056) (-746.635) [-745.571] (-748.001) * (-748.886) (-753.096) [-746.486] (-761.856) -- 0:02:44
171500 -- (-751.740) (-750.876) (-746.794) [-745.131] * (-749.339) (-752.342) [-744.359] (-753.227) -- 0:02:44
172000 -- (-746.260) (-753.352) [-746.714] (-747.516) * [-745.316] (-751.481) (-747.713) (-756.202) -- 0:02:43
172500 -- [-750.620] (-753.700) (-748.957) (-745.870) * (-751.668) [-749.106] (-758.623) (-749.542) -- 0:02:43
173000 -- (-754.609) [-748.803] (-751.788) (-751.357) * (-748.232) (-758.469) (-746.424) [-747.959] -- 0:02:47
173500 -- (-758.432) (-749.205) [-745.537] (-748.615) * (-745.307) (-747.527) (-746.759) [-751.938] -- 0:02:46
174000 -- (-756.404) (-752.732) (-753.445) [-744.613] * [-744.520] (-751.177) (-749.736) (-755.311) -- 0:02:46
174500 -- [-751.785] (-749.271) (-751.505) (-755.900) * [-746.606] (-752.766) (-753.420) (-756.969) -- 0:02:45
175000 -- [-748.412] (-754.938) (-756.272) (-753.331) * (-752.131) [-753.805] (-748.841) (-750.636) -- 0:02:45
Average standard deviation of split frequencies: 0.013839
175500 -- (-749.562) [-749.554] (-757.296) (-747.867) * [-750.538] (-753.245) (-758.400) (-752.348) -- 0:02:44
176000 -- (-756.147) [-748.151] (-750.874) (-751.694) * (-748.191) [-753.127] (-751.534) (-751.790) -- 0:02:43
176500 -- (-759.351) [-751.901] (-750.985) (-746.199) * (-747.600) (-761.299) (-748.060) [-746.553] -- 0:02:43
177000 -- [-750.474] (-748.968) (-746.588) (-745.641) * (-742.961) (-753.362) [-752.419] (-746.923) -- 0:02:42
177500 -- (-752.405) (-751.632) [-743.280] (-752.957) * [-749.568] (-756.960) (-750.676) (-747.577) -- 0:02:42
178000 -- (-751.505) (-760.150) [-744.823] (-754.036) * [-752.861] (-758.966) (-749.956) (-756.789) -- 0:02:46
178500 -- (-760.557) (-761.868) [-749.917] (-751.014) * [-749.601] (-757.175) (-744.492) (-753.389) -- 0:02:45
179000 -- (-746.672) (-750.222) [-747.183] (-748.366) * (-746.842) (-753.266) (-750.997) [-748.678] -- 0:02:45
179500 -- (-747.090) (-754.486) [-750.415] (-751.233) * [-746.598] (-758.580) (-746.787) (-751.048) -- 0:02:44
180000 -- [-751.614] (-758.755) (-749.927) (-748.750) * (-756.353) (-755.899) [-749.473] (-748.172) -- 0:02:44
Average standard deviation of split frequencies: 0.013481
180500 -- (-749.289) [-755.359] (-750.415) (-754.173) * (-750.204) [-750.891] (-747.816) (-750.186) -- 0:02:43
181000 -- (-747.678) (-756.643) [-750.766] (-745.526) * (-746.595) [-753.037] (-744.546) (-748.652) -- 0:02:42
181500 -- [-751.958] (-749.819) (-755.130) (-757.195) * [-742.796] (-753.922) (-749.990) (-752.706) -- 0:02:42
182000 -- (-746.805) (-758.571) [-752.414] (-749.980) * (-747.281) (-769.581) [-747.289] (-747.251) -- 0:02:41
182500 -- (-749.335) (-762.334) [-751.372] (-743.003) * [-747.668] (-752.408) (-745.651) (-748.332) -- 0:02:41
183000 -- [-745.501] (-747.981) (-753.551) (-748.590) * (-748.362) (-751.602) [-751.923] (-752.264) -- 0:02:45
183500 -- [-746.001] (-744.678) (-750.559) (-751.792) * (-751.468) [-748.675] (-747.930) (-743.948) -- 0:02:44
184000 -- [-744.736] (-749.251) (-752.504) (-753.120) * (-749.032) (-749.319) (-751.336) [-748.754] -- 0:02:44
184500 -- (-751.072) [-748.068] (-751.078) (-750.273) * [-751.725] (-753.085) (-754.035) (-749.766) -- 0:02:43
185000 -- [-752.543] (-750.463) (-752.104) (-750.177) * (-755.276) (-750.045) [-750.026] (-752.421) -- 0:02:43
Average standard deviation of split frequencies: 0.010560
185500 -- (-750.915) (-751.043) [-747.535] (-747.535) * (-744.852) [-747.125] (-752.560) (-750.849) -- 0:02:42
186000 -- (-750.563) (-763.805) (-753.040) [-747.578] * [-745.362] (-747.451) (-748.076) (-760.344) -- 0:02:41
186500 -- (-748.480) (-766.596) (-744.319) [-746.375] * (-745.416) (-747.783) [-745.840] (-748.414) -- 0:02:41
187000 -- (-748.421) (-757.559) [-748.393] (-751.914) * (-746.025) (-751.071) [-746.306] (-750.946) -- 0:02:40
187500 -- [-749.987] (-764.077) (-750.217) (-743.084) * [-745.983] (-754.977) (-745.170) (-746.607) -- 0:02:40
188000 -- (-751.849) (-758.760) (-744.798) [-746.879] * [-747.898] (-748.950) (-751.394) (-745.846) -- 0:02:39
188500 -- (-751.092) (-749.622) (-760.284) [-748.400] * (-747.705) (-745.757) [-748.079] (-747.463) -- 0:02:43
189000 -- (-746.082) (-748.720) (-750.663) [-746.654] * [-750.239] (-752.334) (-747.141) (-743.761) -- 0:02:43
189500 -- (-747.098) (-759.456) (-752.142) [-747.099] * (-749.906) (-755.417) [-747.490] (-748.931) -- 0:02:42
190000 -- (-747.584) (-751.660) (-767.885) [-748.370] * (-746.682) (-749.174) (-750.721) [-746.488] -- 0:02:42
Average standard deviation of split frequencies: 0.013598
190500 -- (-750.652) [-747.671] (-755.144) (-749.961) * [-744.823] (-749.249) (-757.034) (-746.324) -- 0:02:41
191000 -- (-745.540) (-753.343) (-748.458) [-744.315] * (-752.486) (-750.148) (-760.341) [-744.662] -- 0:02:40
191500 -- (-752.929) (-754.989) [-747.997] (-751.069) * (-747.193) (-748.084) (-754.637) [-745.877] -- 0:02:40
192000 -- (-751.577) [-750.639] (-754.488) (-746.622) * (-749.142) (-759.120) [-752.311] (-748.555) -- 0:02:39
192500 -- [-749.455] (-762.467) (-746.971) (-749.541) * (-755.435) (-749.594) (-747.657) [-742.684] -- 0:02:39
193000 -- (-750.744) (-765.789) (-745.723) [-745.404] * [-746.370] (-758.227) (-752.298) (-752.626) -- 0:02:38
193500 -- [-746.624] (-756.850) (-752.501) (-748.922) * (-749.274) (-751.815) [-747.277] (-751.104) -- 0:02:42
194000 -- [-754.083] (-755.231) (-746.621) (-743.979) * [-750.994] (-754.421) (-745.531) (-751.117) -- 0:02:42
194500 -- (-749.341) (-749.383) (-752.561) [-746.574] * (-751.552) (-746.753) [-753.178] (-748.622) -- 0:02:41
195000 -- (-752.449) (-750.537) (-745.403) [-748.804] * (-751.006) (-750.294) [-744.863] (-748.861) -- 0:02:41
Average standard deviation of split frequencies: 0.012026
195500 -- [-747.659] (-751.103) (-753.208) (-756.966) * (-746.609) (-755.629) [-753.361] (-754.466) -- 0:02:40
196000 -- (-750.278) [-754.269] (-749.879) (-749.866) * (-749.395) [-750.697] (-745.273) (-749.108) -- 0:02:39
196500 -- (-749.142) [-746.280] (-754.169) (-751.027) * (-755.011) (-755.177) (-749.479) [-749.606] -- 0:02:39
197000 -- (-752.066) (-747.747) (-754.651) [-747.270] * [-752.102] (-745.961) (-753.626) (-752.713) -- 0:02:38
197500 -- (-745.614) (-750.407) [-751.576] (-747.426) * (-751.390) (-752.780) [-748.656] (-747.639) -- 0:02:38
198000 -- (-751.403) (-744.624) (-751.565) [-751.129] * (-754.173) [-747.129] (-747.893) (-747.299) -- 0:02:37
198500 -- (-749.496) (-753.548) (-755.179) [-754.271] * (-754.992) (-748.419) (-749.937) [-751.162] -- 0:02:41
199000 -- (-754.187) (-752.906) [-752.431] (-749.952) * (-749.168) (-748.635) (-758.116) [-746.961] -- 0:02:41
199500 -- (-750.048) (-762.875) [-752.994] (-753.970) * (-750.066) [-753.185] (-752.146) (-760.911) -- 0:02:40
200000 -- (-744.981) (-751.526) (-751.598) [-755.660] * (-755.262) [-744.224] (-751.869) (-750.245) -- 0:02:40
Average standard deviation of split frequencies: 0.013704
200500 -- (-745.848) (-751.362) [-758.002] (-751.598) * [-746.249] (-746.159) (-761.445) (-745.916) -- 0:02:39
201000 -- (-749.247) [-756.108] (-762.427) (-748.130) * (-740.786) (-747.885) [-753.118] (-747.854) -- 0:02:39
201500 -- (-749.440) (-754.780) (-761.406) [-747.352] * (-746.302) [-751.116] (-746.957) (-748.367) -- 0:02:38
202000 -- [-759.216] (-752.485) (-751.607) (-754.812) * (-751.752) (-750.683) (-742.988) [-746.967] -- 0:02:38
202500 -- [-743.526] (-753.854) (-752.783) (-749.331) * (-748.452) (-754.737) [-745.834] (-755.528) -- 0:02:37
203000 -- (-748.691) [-753.140] (-753.455) (-754.687) * [-749.980] (-747.943) (-750.461) (-753.492) -- 0:02:37
203500 -- (-746.390) (-759.059) (-750.339) [-753.075] * (-746.757) (-752.662) [-748.635] (-752.908) -- 0:02:36
204000 -- (-745.040) (-749.919) [-753.651] (-756.283) * [-743.311] (-746.610) (-751.079) (-751.319) -- 0:02:39
204500 -- (-754.418) (-757.658) [-750.841] (-746.593) * (-746.491) (-749.336) (-749.744) [-749.391] -- 0:02:39
205000 -- [-754.873] (-745.878) (-748.437) (-755.281) * (-754.851) (-746.012) [-746.972] (-743.635) -- 0:02:39
Average standard deviation of split frequencies: 0.014112
205500 -- (-750.733) (-746.345) (-753.553) [-748.489] * (-751.978) (-750.457) (-748.589) [-749.180] -- 0:02:38
206000 -- (-754.430) [-748.219] (-757.864) (-750.473) * [-749.837] (-751.531) (-748.124) (-748.347) -- 0:02:38
206500 -- [-752.076] (-757.975) (-752.709) (-751.186) * (-750.366) [-754.392] (-744.224) (-751.309) -- 0:02:37
207000 -- [-753.167] (-753.364) (-751.771) (-751.104) * (-757.778) [-753.018] (-743.946) (-748.580) -- 0:02:37
207500 -- [-750.976] (-744.822) (-753.103) (-755.085) * (-747.199) (-757.192) [-751.729] (-748.286) -- 0:02:36
208000 -- (-748.661) [-748.682] (-761.743) (-755.778) * (-751.759) (-753.115) [-748.118] (-748.804) -- 0:02:36
208500 -- (-753.023) (-753.224) [-748.122] (-748.364) * (-745.038) (-750.621) (-751.410) [-750.469] -- 0:02:35
209000 -- (-756.670) (-751.943) (-749.304) [-749.223] * (-745.827) [-744.726] (-749.923) (-754.419) -- 0:02:38
209500 -- (-750.220) (-749.371) (-752.960) [-746.348] * [-745.407] (-749.452) (-752.230) (-755.249) -- 0:02:38
210000 -- (-749.224) (-751.589) (-759.016) [-753.739] * (-742.696) (-751.400) [-750.367] (-759.156) -- 0:02:38
Average standard deviation of split frequencies: 0.014172
210500 -- (-748.568) (-752.569) [-753.384] (-747.925) * (-749.257) (-747.182) (-751.209) [-746.068] -- 0:02:37
211000 -- [-743.528] (-750.381) (-753.484) (-750.853) * (-767.200) (-751.003) [-749.440] (-753.108) -- 0:02:37
211500 -- (-751.268) [-748.441] (-762.174) (-749.417) * (-747.400) (-749.701) (-755.606) [-742.831] -- 0:02:36
212000 -- (-752.311) (-751.131) (-751.274) [-746.439] * (-754.987) [-754.807] (-752.314) (-756.747) -- 0:02:36
212500 -- (-756.320) (-750.977) (-748.060) [-750.929] * (-748.068) (-745.105) [-749.058] (-752.946) -- 0:02:35
213000 -- (-754.143) (-755.149) (-757.471) [-752.487] * [-753.366] (-750.856) (-755.078) (-748.300) -- 0:02:35
213500 -- (-749.443) [-748.206] (-750.748) (-748.647) * (-750.040) (-748.315) [-749.027] (-752.774) -- 0:02:34
214000 -- [-745.337] (-746.660) (-750.133) (-745.292) * (-755.984) [-751.892] (-751.506) (-750.777) -- 0:02:34
214500 -- [-744.197] (-749.266) (-744.618) (-756.320) * (-760.273) [-748.037] (-751.137) (-750.092) -- 0:02:37
215000 -- (-751.482) [-745.015] (-749.612) (-746.937) * (-754.088) [-746.855] (-754.960) (-749.024) -- 0:02:37
Average standard deviation of split frequencies: 0.013458
215500 -- (-746.038) [-752.429] (-749.906) (-746.581) * (-747.354) [-746.174] (-755.790) (-748.551) -- 0:02:36
216000 -- (-746.083) (-748.859) (-749.587) [-747.752] * (-753.998) (-749.585) (-757.941) [-751.814] -- 0:02:36
216500 -- [-745.487] (-752.341) (-748.192) (-750.564) * (-756.018) [-754.773] (-748.797) (-748.725) -- 0:02:35
217000 -- (-749.347) [-748.744] (-750.130) (-748.342) * (-757.542) (-753.686) (-751.546) [-748.037] -- 0:02:35
217500 -- (-749.964) [-749.082] (-757.795) (-754.496) * (-751.929) [-748.696] (-755.120) (-755.379) -- 0:02:34
218000 -- (-754.321) (-744.776) (-756.904) [-754.513] * (-758.494) (-751.556) (-749.410) [-753.344] -- 0:02:34
218500 -- (-751.775) (-751.160) (-755.192) [-751.782] * (-755.069) (-748.658) (-754.110) [-746.351] -- 0:02:33
219000 -- (-748.182) [-749.249] (-751.531) (-750.080) * (-749.580) (-759.378) (-750.758) [-746.565] -- 0:02:33
219500 -- (-746.457) [-753.016] (-749.395) (-748.976) * (-751.021) (-753.273) [-748.023] (-748.527) -- 0:02:36
220000 -- (-754.146) (-749.113) (-750.785) [-750.587] * (-747.762) (-759.422) [-751.853] (-748.122) -- 0:02:36
Average standard deviation of split frequencies: 0.015666
220500 -- [-749.964] (-753.712) (-752.156) (-747.802) * [-750.718] (-752.174) (-746.542) (-751.932) -- 0:02:35
221000 -- [-747.889] (-750.190) (-754.878) (-746.073) * (-752.137) (-750.474) (-748.145) [-745.164] -- 0:02:35
221500 -- [-754.811] (-753.786) (-753.726) (-753.874) * (-744.578) (-750.108) [-749.706] (-752.207) -- 0:02:34
222000 -- (-747.237) (-748.115) (-751.709) [-753.381] * (-759.828) (-747.773) [-751.386] (-749.244) -- 0:02:34
222500 -- (-750.223) (-751.717) [-744.285] (-750.577) * (-745.047) (-748.826) [-753.288] (-747.381) -- 0:02:33
223000 -- (-751.945) (-746.744) (-751.382) [-749.470] * (-749.054) (-748.774) [-748.727] (-759.558) -- 0:02:33
223500 -- (-753.178) [-744.398] (-748.519) (-745.326) * (-742.151) (-757.832) [-748.155] (-748.167) -- 0:02:32
224000 -- (-753.063) (-744.482) [-743.542] (-747.974) * (-752.562) [-746.238] (-750.092) (-750.730) -- 0:02:32
224500 -- [-750.692] (-748.786) (-750.675) (-746.041) * (-744.814) (-748.769) [-749.725] (-748.877) -- 0:02:35
225000 -- [-749.989] (-747.433) (-748.111) (-757.234) * [-750.567] (-756.034) (-751.804) (-742.488) -- 0:02:35
Average standard deviation of split frequencies: 0.012863
225500 -- (-746.439) (-749.774) (-753.828) [-746.956] * [-743.023] (-755.294) (-749.260) (-750.863) -- 0:02:34
226000 -- (-751.471) (-747.920) [-750.745] (-752.174) * (-751.772) [-752.856] (-746.821) (-747.568) -- 0:02:34
226500 -- [-746.490] (-751.116) (-752.257) (-753.056) * (-750.646) (-755.195) (-751.319) [-748.347] -- 0:02:33
227000 -- (-747.522) [-746.778] (-752.545) (-750.204) * (-743.579) [-750.358] (-757.252) (-750.524) -- 0:02:33
227500 -- (-745.777) (-756.095) [-744.447] (-762.651) * (-749.193) (-754.855) [-751.262] (-748.103) -- 0:02:32
228000 -- (-742.531) [-749.989] (-754.050) (-751.150) * [-754.305] (-745.758) (-751.208) (-751.230) -- 0:02:32
228500 -- (-749.763) (-751.002) [-748.811] (-745.062) * (-753.356) (-750.316) [-744.728] (-745.115) -- 0:02:31
229000 -- (-750.757) (-750.478) (-754.913) [-748.609] * (-749.718) [-749.734] (-749.798) (-752.925) -- 0:02:31
229500 -- (-748.364) [-748.935] (-747.657) (-748.338) * [-749.279] (-748.328) (-750.510) (-750.314) -- 0:02:31
230000 -- (-750.903) (-749.390) (-757.883) [-745.491] * (-754.372) (-751.886) [-746.011] (-747.669) -- 0:02:34
Average standard deviation of split frequencies: 0.013284
230500 -- (-751.527) [-747.667] (-748.125) (-746.625) * (-746.046) (-746.833) (-746.399) [-747.551] -- 0:02:33
231000 -- (-745.795) (-749.676) (-749.074) [-744.936] * [-742.435] (-746.156) (-745.950) (-748.181) -- 0:02:33
231500 -- (-747.805) (-747.474) (-755.856) [-745.085] * (-754.593) (-749.553) [-744.883] (-751.858) -- 0:02:32
232000 -- [-753.393] (-753.353) (-753.255) (-746.129) * [-745.434] (-758.703) (-755.633) (-745.193) -- 0:02:32
232500 -- [-748.742] (-751.185) (-756.929) (-754.788) * [-745.883] (-752.052) (-753.727) (-746.010) -- 0:02:31
233000 -- (-747.829) [-754.379] (-758.482) (-746.951) * (-748.148) [-748.715] (-748.903) (-747.608) -- 0:02:31
233500 -- [-746.548] (-752.919) (-757.041) (-748.941) * (-749.320) (-751.184) [-748.284] (-748.422) -- 0:02:31
234000 -- [-750.976] (-748.361) (-750.319) (-748.463) * (-750.115) (-754.763) [-748.984] (-758.643) -- 0:02:30
234500 -- [-747.037] (-753.101) (-751.868) (-755.572) * (-752.336) (-749.069) (-751.664) [-745.792] -- 0:02:30
235000 -- (-759.037) (-746.383) [-753.333] (-747.027) * (-750.669) [-753.557] (-757.980) (-751.624) -- 0:02:33
Average standard deviation of split frequencies: 0.016979
235500 -- [-752.879] (-758.421) (-759.614) (-751.595) * (-756.313) (-750.147) [-752.749] (-754.074) -- 0:02:32
236000 -- (-755.879) (-750.531) (-761.568) [-743.318] * (-752.061) (-749.840) [-752.145] (-749.945) -- 0:02:32
236500 -- (-747.390) (-751.414) (-756.073) [-745.498] * [-745.583] (-754.288) (-752.891) (-754.727) -- 0:02:31
237000 -- [-748.943] (-750.569) (-746.095) (-748.257) * [-746.912] (-750.416) (-749.098) (-746.485) -- 0:02:31
237500 -- (-757.440) [-745.297] (-751.026) (-753.498) * (-754.365) (-749.049) (-750.133) [-747.774] -- 0:02:30
238000 -- (-753.564) (-748.838) [-749.025] (-750.765) * (-746.886) [-747.311] (-750.374) (-756.714) -- 0:02:30
238500 -- (-752.761) (-755.115) [-748.228] (-747.180) * (-747.122) (-749.840) (-752.359) [-754.757] -- 0:02:30
239000 -- (-748.605) (-754.237) [-749.714] (-750.523) * [-745.248] (-752.673) (-757.568) (-745.356) -- 0:02:29
239500 -- (-753.584) (-753.716) [-747.553] (-748.619) * (-747.028) [-749.519] (-753.770) (-746.455) -- 0:02:29
240000 -- (-746.414) (-749.449) [-749.098] (-758.146) * [-750.543] (-754.710) (-757.826) (-748.562) -- 0:02:32
Average standard deviation of split frequencies: 0.018608
240500 -- (-747.914) (-755.330) [-748.530] (-755.563) * [-748.287] (-754.854) (-752.144) (-748.763) -- 0:02:31
241000 -- (-750.008) [-748.599] (-745.380) (-751.263) * (-752.357) (-746.041) [-750.654] (-747.747) -- 0:02:31
241500 -- (-749.611) (-749.814) [-744.656] (-745.245) * (-756.166) (-755.658) (-752.760) [-751.881] -- 0:02:30
242000 -- (-750.587) (-749.159) (-750.427) [-745.948] * (-746.813) (-751.686) (-751.281) [-748.310] -- 0:02:30
242500 -- (-755.976) (-762.923) (-748.059) [-746.658] * (-747.515) (-748.138) [-746.629] (-748.114) -- 0:02:29
243000 -- (-757.640) (-750.726) (-754.205) [-744.785] * [-747.284] (-754.276) (-750.658) (-744.953) -- 0:02:29
243500 -- (-750.301) (-743.590) (-745.661) [-751.891] * (-759.313) (-750.600) (-754.809) [-747.273] -- 0:02:29
244000 -- (-743.954) (-750.393) [-744.173] (-752.140) * (-749.554) (-750.567) (-758.789) [-743.514] -- 0:02:28
244500 -- (-744.500) (-750.026) (-747.371) [-750.354] * (-750.053) (-752.590) (-750.356) [-748.029] -- 0:02:28
245000 -- [-748.442] (-750.680) (-746.123) (-750.871) * (-745.919) [-745.183] (-748.937) (-748.444) -- 0:02:27
Average standard deviation of split frequencies: 0.017566
245500 -- (-749.535) [-750.631] (-744.397) (-763.322) * [-753.476] (-754.268) (-747.556) (-747.941) -- 0:02:30
246000 -- (-751.564) (-753.484) [-746.812] (-751.837) * (-760.559) [-750.070] (-756.055) (-751.734) -- 0:02:30
246500 -- (-754.809) (-749.564) (-747.602) [-752.982] * (-750.595) (-760.982) (-751.620) [-751.921] -- 0:02:29
247000 -- (-750.853) (-753.979) [-744.791] (-753.599) * (-746.237) (-760.306) [-754.124] (-756.129) -- 0:02:29
247500 -- (-753.380) [-747.930] (-751.261) (-754.033) * (-752.556) (-752.421) [-751.049] (-755.883) -- 0:02:28
248000 -- [-750.270] (-749.468) (-750.996) (-756.667) * (-754.252) (-749.776) [-745.945] (-759.314) -- 0:02:28
248500 -- (-755.365) [-748.674] (-754.019) (-749.865) * (-748.346) (-750.176) [-745.261] (-753.547) -- 0:02:28
249000 -- (-754.112) [-744.243] (-751.381) (-750.159) * [-752.165] (-755.692) (-743.881) (-752.347) -- 0:02:27
249500 -- (-751.310) (-751.128) [-753.456] (-765.426) * (-747.552) [-749.448] (-757.790) (-754.054) -- 0:02:27
250000 -- (-742.595) [-746.702] (-745.552) (-754.070) * (-748.768) [-744.322] (-746.548) (-750.081) -- 0:02:27
Average standard deviation of split frequencies: 0.018179
250500 -- [-747.180] (-750.300) (-749.558) (-750.151) * (-748.366) (-753.524) (-747.230) [-751.098] -- 0:02:29
251000 -- (-745.623) (-745.740) [-748.733] (-744.351) * [-742.832] (-749.975) (-757.978) (-753.837) -- 0:02:29
251500 -- (-754.193) (-747.365) [-748.585] (-751.497) * (-753.825) (-754.706) (-749.481) [-753.302] -- 0:02:28
252000 -- (-751.540) (-753.623) (-747.592) [-750.089] * [-746.766] (-758.312) (-746.811) (-754.115) -- 0:02:28
252500 -- (-751.811) [-752.795] (-744.166) (-764.544) * [-750.887] (-753.098) (-754.284) (-750.380) -- 0:02:28
253000 -- [-751.377] (-765.820) (-753.086) (-751.402) * (-746.420) [-752.449] (-749.518) (-750.111) -- 0:02:27
253500 -- (-751.257) [-751.789] (-747.986) (-745.450) * (-745.402) (-747.080) [-748.748] (-751.121) -- 0:02:27
254000 -- (-759.916) (-749.679) (-749.239) [-750.262] * [-745.566] (-755.778) (-752.571) (-757.084) -- 0:02:26
254500 -- [-748.167] (-745.698) (-750.588) (-752.706) * (-753.875) [-747.311] (-760.220) (-751.669) -- 0:02:26
255000 -- (-751.769) (-749.954) (-747.661) [-744.621] * (-748.693) (-752.354) [-753.097] (-743.577) -- 0:02:26
Average standard deviation of split frequencies: 0.019335
255500 -- (-747.747) (-749.195) [-752.321] (-747.915) * (-752.303) (-746.732) (-744.311) [-752.276] -- 0:02:28
256000 -- (-754.729) [-746.870] (-745.008) (-749.776) * (-750.076) (-751.173) [-750.422] (-751.888) -- 0:02:28
256500 -- (-752.104) (-750.817) (-747.483) [-760.870] * (-753.929) (-747.276) (-750.224) [-746.380] -- 0:02:27
257000 -- [-745.655] (-750.977) (-742.775) (-752.358) * (-750.076) (-751.761) (-756.957) [-754.335] -- 0:02:27
257500 -- (-749.533) (-752.265) [-746.820] (-753.398) * [-745.235] (-751.839) (-752.441) (-748.727) -- 0:02:27
258000 -- (-752.828) (-754.724) (-752.774) [-745.600] * (-753.832) (-746.970) [-748.770] (-758.667) -- 0:02:26
258500 -- (-753.662) [-745.023] (-747.098) (-746.423) * (-760.523) [-752.688] (-749.239) (-746.631) -- 0:02:26
259000 -- [-742.947] (-751.843) (-745.475) (-755.371) * (-753.690) [-745.760] (-752.024) (-750.065) -- 0:02:25
259500 -- (-755.665) (-753.169) [-745.969] (-749.686) * (-767.665) (-751.330) [-751.837] (-754.360) -- 0:02:25
260000 -- [-744.685] (-750.283) (-752.527) (-753.754) * (-750.597) (-745.350) (-747.657) [-751.706] -- 0:02:25
Average standard deviation of split frequencies: 0.020194
260500 -- (-749.264) [-751.851] (-756.056) (-759.421) * (-752.967) [-751.483] (-751.712) (-746.781) -- 0:02:24
261000 -- (-753.228) [-748.672] (-745.866) (-747.892) * (-753.725) [-744.627] (-749.209) (-747.560) -- 0:02:27
261500 -- (-755.756) (-750.401) [-747.266] (-746.251) * (-750.839) (-748.283) (-750.323) [-751.333] -- 0:02:26
262000 -- (-749.862) [-750.668] (-747.306) (-746.274) * (-748.478) (-752.072) (-751.673) [-746.154] -- 0:02:26
262500 -- (-752.130) (-749.077) [-747.496] (-750.103) * [-752.188] (-746.393) (-748.156) (-747.130) -- 0:02:26
263000 -- (-756.487) (-750.975) (-746.955) [-750.425] * (-753.977) [-749.634] (-750.842) (-751.073) -- 0:02:25
263500 -- [-753.975] (-748.492) (-750.381) (-751.646) * (-752.940) (-757.730) [-749.466] (-744.165) -- 0:02:25
264000 -- (-756.306) (-752.996) [-746.650] (-746.801) * (-749.592) (-745.368) (-749.454) [-748.966] -- 0:02:24
264500 -- (-763.019) (-751.699) (-748.275) [-751.170] * (-746.229) [-744.564] (-749.382) (-753.349) -- 0:02:24
265000 -- (-751.942) [-746.980] (-753.545) (-748.457) * [-747.722] (-747.055) (-747.222) (-747.578) -- 0:02:24
Average standard deviation of split frequencies: 0.020676
265500 -- (-760.111) [-750.733] (-750.190) (-755.157) * (-749.700) (-747.016) [-749.431] (-750.745) -- 0:02:23
266000 -- (-763.084) (-746.386) [-748.035] (-758.370) * [-746.617] (-753.023) (-750.071) (-754.047) -- 0:02:26
266500 -- (-752.886) (-752.630) (-752.132) [-758.535] * [-749.650] (-753.362) (-747.432) (-750.354) -- 0:02:25
267000 -- (-754.179) [-748.418] (-750.681) (-750.497) * (-756.020) (-750.708) [-751.179] (-753.106) -- 0:02:25
267500 -- (-753.729) [-750.986] (-745.728) (-766.761) * (-748.890) [-747.810] (-742.817) (-744.253) -- 0:02:25
268000 -- (-754.003) [-749.907] (-755.537) (-752.246) * [-748.557] (-748.681) (-749.454) (-753.911) -- 0:02:24
268500 -- (-748.468) (-747.534) [-743.483] (-748.919) * (-754.598) [-743.642] (-748.045) (-752.312) -- 0:02:24
269000 -- (-755.462) (-746.437) [-743.145] (-748.338) * (-748.035) (-743.093) [-747.510] (-758.244) -- 0:02:24
269500 -- (-747.610) (-750.060) (-751.612) [-746.692] * (-749.246) [-746.727] (-748.365) (-756.778) -- 0:02:23
270000 -- (-757.450) (-754.042) (-745.323) [-752.130] * (-745.568) [-746.662] (-752.704) (-749.050) -- 0:02:23
Average standard deviation of split frequencies: 0.020029
270500 -- [-755.352] (-745.263) (-750.408) (-749.882) * (-746.483) (-759.261) [-748.793] (-752.053) -- 0:02:22
271000 -- (-756.736) [-752.211] (-751.659) (-752.889) * [-747.787] (-747.088) (-745.746) (-757.155) -- 0:02:25
271500 -- (-748.393) [-745.325] (-759.123) (-751.058) * (-751.212) [-750.798] (-744.419) (-749.203) -- 0:02:24
272000 -- [-746.524] (-746.352) (-747.262) (-749.906) * (-750.861) [-750.776] (-746.735) (-749.513) -- 0:02:24
272500 -- (-742.001) (-746.394) [-746.502] (-749.218) * (-749.310) (-753.475) (-753.029) [-748.342] -- 0:02:24
273000 -- (-750.019) (-753.239) [-747.812] (-751.397) * (-756.209) (-752.604) (-750.848) [-748.571] -- 0:02:23
273500 -- (-748.945) (-750.672) [-750.072] (-750.302) * [-755.331] (-744.547) (-749.445) (-749.251) -- 0:02:23
274000 -- (-758.899) [-749.246] (-745.344) (-755.924) * (-747.111) (-750.514) (-746.804) [-747.694] -- 0:02:23
274500 -- (-754.711) (-750.165) [-745.440] (-757.058) * (-746.104) (-751.394) [-743.670] (-749.871) -- 0:02:22
275000 -- (-751.699) (-755.163) [-748.230] (-751.917) * (-751.377) (-749.187) (-747.731) [-755.715] -- 0:02:22
Average standard deviation of split frequencies: 0.020211
275500 -- (-752.334) (-748.114) (-745.341) [-748.863] * [-747.239] (-749.030) (-750.211) (-755.936) -- 0:02:24
276000 -- (-757.733) (-752.226) (-753.296) [-745.534] * (-750.297) [-754.619] (-748.984) (-756.473) -- 0:02:24
276500 -- (-751.472) (-753.719) [-746.773] (-749.686) * (-748.881) (-753.816) (-749.756) [-751.044] -- 0:02:23
277000 -- (-746.855) (-748.778) (-752.015) [-746.217] * (-746.337) (-753.102) (-763.094) [-751.552] -- 0:02:23
277500 -- (-752.355) [-748.183] (-749.349) (-756.870) * (-756.014) (-748.384) [-747.277] (-750.622) -- 0:02:23
278000 -- (-754.573) (-747.879) [-750.477] (-746.900) * (-750.213) (-751.650) (-753.524) [-748.478] -- 0:02:22
278500 -- (-751.812) (-750.788) (-747.880) [-744.441] * [-744.908] (-753.660) (-749.570) (-759.849) -- 0:02:22
279000 -- (-748.689) (-749.727) [-754.573] (-756.908) * (-750.710) (-749.791) (-750.076) [-748.580] -- 0:02:22
279500 -- (-748.128) [-755.931] (-752.115) (-746.122) * (-752.910) (-753.362) [-752.362] (-752.033) -- 0:02:21
280000 -- [-742.235] (-747.861) (-750.469) (-748.380) * (-746.264) [-748.791] (-750.368) (-753.685) -- 0:02:24
Average standard deviation of split frequencies: 0.018755
280500 -- (-744.301) [-748.683] (-751.620) (-756.340) * (-749.488) (-747.033) [-755.105] (-758.926) -- 0:02:23
281000 -- (-747.096) [-750.434] (-750.264) (-752.385) * (-751.274) (-755.366) [-746.120] (-754.906) -- 0:02:23
281500 -- (-755.601) (-756.281) [-744.966] (-750.941) * [-746.812] (-753.512) (-752.230) (-765.977) -- 0:02:22
282000 -- (-750.024) (-749.457) (-747.376) [-747.658] * (-749.962) (-752.238) [-751.366] (-750.993) -- 0:02:22
282500 -- (-752.377) (-747.243) (-749.672) [-750.431] * (-747.117) (-754.902) (-750.009) [-746.516] -- 0:02:22
283000 -- (-750.328) (-751.927) (-747.234) [-747.278] * (-751.620) (-753.736) (-749.978) [-748.456] -- 0:02:21
283500 -- (-744.890) (-751.352) (-746.313) [-748.683] * (-750.166) (-754.568) [-747.839] (-746.326) -- 0:02:21
284000 -- (-754.890) (-749.865) (-751.681) [-743.627] * (-756.174) [-747.602] (-751.496) (-753.886) -- 0:02:21
284500 -- (-758.102) (-747.847) (-750.532) [-748.597] * [-752.143] (-752.470) (-748.664) (-754.944) -- 0:02:20
285000 -- (-747.558) (-744.545) [-748.110] (-749.050) * [-747.149] (-755.427) (-753.678) (-749.320) -- 0:02:20
Average standard deviation of split frequencies: 0.018955
285500 -- (-750.676) [-750.765] (-752.100) (-752.317) * (-773.821) (-753.047) [-747.514] (-758.696) -- 0:02:22
286000 -- [-749.070] (-747.196) (-748.099) (-747.320) * (-757.588) [-749.599] (-749.157) (-747.283) -- 0:02:22
286500 -- [-752.765] (-747.559) (-752.247) (-744.917) * (-751.000) (-752.543) [-749.744] (-749.061) -- 0:02:21
287000 -- (-754.294) (-750.330) [-751.520] (-747.899) * (-752.018) [-750.257] (-753.074) (-748.542) -- 0:02:21
287500 -- (-744.251) (-758.016) [-753.451] (-745.890) * (-752.036) [-744.639] (-754.050) (-744.953) -- 0:02:21
288000 -- (-754.857) (-752.851) (-752.633) [-745.817] * (-749.835) (-756.390) [-745.640] (-748.476) -- 0:02:20
288500 -- (-761.575) (-749.044) (-749.117) [-745.226] * (-753.837) [-748.122] (-742.152) (-747.036) -- 0:02:20
289000 -- (-748.724) [-751.330] (-754.262) (-748.625) * (-749.606) (-749.964) [-748.662] (-746.473) -- 0:02:20
289500 -- (-743.539) (-749.401) [-746.005] (-747.029) * (-747.786) [-745.226] (-751.450) (-747.714) -- 0:02:19
290000 -- [-746.550] (-746.525) (-748.925) (-752.820) * (-748.640) (-751.757) [-747.503] (-749.443) -- 0:02:19
Average standard deviation of split frequencies: 0.018651
290500 -- [-745.844] (-747.258) (-755.115) (-750.320) * (-754.083) [-745.063] (-756.429) (-750.416) -- 0:02:21
291000 -- [-745.943] (-751.595) (-752.594) (-749.961) * (-753.506) (-750.299) [-748.656] (-750.899) -- 0:02:21
291500 -- (-745.869) [-753.953] (-758.128) (-757.671) * [-746.822] (-747.351) (-749.282) (-753.388) -- 0:02:20
292000 -- (-750.716) (-753.863) (-752.807) [-756.603] * (-750.065) [-747.494] (-751.390) (-747.430) -- 0:02:20
292500 -- (-751.823) (-752.875) [-746.335] (-749.561) * (-746.724) [-752.870] (-754.524) (-755.083) -- 0:02:20
293000 -- (-755.278) [-744.905] (-752.069) (-748.867) * (-747.758) (-750.996) (-754.909) [-751.549] -- 0:02:19
293500 -- (-753.432) (-751.955) (-747.325) [-749.128] * (-750.680) (-750.046) (-750.957) [-753.714] -- 0:02:19
294000 -- (-753.825) (-751.361) (-744.551) [-749.977] * [-743.013] (-755.364) (-758.356) (-749.178) -- 0:02:19
294500 -- (-751.847) (-747.618) [-748.173] (-752.587) * [-749.337] (-751.834) (-753.101) (-749.318) -- 0:02:18
295000 -- (-743.942) (-750.351) [-748.442] (-754.120) * (-749.616) (-752.184) (-751.343) [-745.296] -- 0:02:18
Average standard deviation of split frequencies: 0.015926
295500 -- [-747.959] (-749.350) (-753.674) (-751.007) * [-749.506] (-752.364) (-754.497) (-748.118) -- 0:02:18
296000 -- [-749.123] (-750.550) (-750.287) (-746.830) * [-746.298] (-753.205) (-753.493) (-759.339) -- 0:02:20
296500 -- (-746.105) [-749.053] (-753.133) (-746.015) * (-756.201) (-757.179) (-755.085) [-751.612] -- 0:02:19
297000 -- [-743.594] (-755.055) (-749.236) (-761.057) * (-752.453) (-751.277) (-751.432) [-749.640] -- 0:02:19
297500 -- (-745.558) [-755.559] (-755.332) (-751.156) * (-751.847) [-751.012] (-747.861) (-751.239) -- 0:02:19
298000 -- (-743.697) (-746.992) (-758.072) [-750.839] * (-752.089) [-749.881] (-753.866) (-747.388) -- 0:02:18
298500 -- (-745.864) [-750.143] (-754.495) (-750.584) * (-753.442) (-751.811) (-751.718) [-746.472] -- 0:02:18
299000 -- (-752.421) [-748.791] (-754.687) (-751.056) * (-749.955) (-749.762) (-751.804) [-749.139] -- 0:02:18
299500 -- [-749.451] (-749.479) (-755.483) (-751.277) * [-750.255] (-755.071) (-755.383) (-759.487) -- 0:02:17
300000 -- (-752.980) (-748.922) [-750.832] (-755.537) * (-759.812) (-744.459) (-745.563) [-747.338] -- 0:02:17
Average standard deviation of split frequencies: 0.012804
300500 -- (-751.872) (-756.343) (-747.744) [-752.618] * (-750.284) (-749.840) (-749.255) [-752.149] -- 0:02:17
301000 -- (-749.778) (-752.230) [-750.045] (-753.273) * (-759.497) [-753.870] (-752.562) (-749.916) -- 0:02:19
301500 -- (-746.588) (-752.385) (-748.202) [-756.048] * (-755.633) [-744.450] (-747.782) (-752.249) -- 0:02:19
302000 -- (-750.349) [-748.990] (-755.343) (-756.765) * (-748.051) (-750.997) (-744.823) [-756.801] -- 0:02:18
302500 -- (-748.416) [-750.569] (-745.800) (-757.602) * [-746.442] (-746.175) (-749.267) (-749.554) -- 0:02:18
303000 -- [-750.685] (-750.842) (-746.571) (-751.760) * [-746.026] (-745.355) (-755.433) (-746.313) -- 0:02:18
303500 -- [-751.032] (-761.314) (-753.912) (-747.182) * [-747.564] (-745.938) (-752.770) (-753.007) -- 0:02:17
304000 -- [-745.903] (-755.807) (-758.131) (-752.851) * (-748.591) [-746.820] (-753.232) (-744.463) -- 0:02:17
304500 -- (-751.782) (-749.902) [-746.891] (-752.992) * (-750.486) [-747.710] (-747.768) (-749.717) -- 0:02:17
305000 -- (-745.775) [-747.336] (-755.336) (-756.566) * [-748.182] (-750.038) (-756.069) (-750.296) -- 0:02:16
Average standard deviation of split frequencies: 0.012581
305500 -- (-746.022) [-746.884] (-752.641) (-751.839) * (-752.838) [-752.923] (-755.349) (-750.220) -- 0:02:16
306000 -- [-746.051] (-748.633) (-753.767) (-750.144) * (-747.362) (-755.901) [-752.961] (-752.995) -- 0:02:18
306500 -- (-745.399) (-756.035) (-751.071) [-747.341] * (-746.324) [-748.719] (-747.935) (-750.556) -- 0:02:18
307000 -- [-750.588] (-748.228) (-749.950) (-756.993) * [-755.959] (-755.854) (-744.415) (-745.916) -- 0:02:17
307500 -- (-751.291) (-755.318) [-752.192] (-754.192) * (-749.548) (-746.666) [-751.326] (-744.136) -- 0:02:17
308000 -- (-750.981) [-749.565] (-750.514) (-753.851) * [-748.807] (-755.132) (-748.797) (-745.481) -- 0:02:17
308500 -- (-749.799) [-747.877] (-759.236) (-749.551) * (-748.157) (-750.330) [-747.415] (-750.718) -- 0:02:16
309000 -- (-753.079) (-749.422) [-754.155] (-752.343) * (-760.953) (-745.380) [-751.223] (-743.394) -- 0:02:16
309500 -- (-752.217) (-750.987) (-747.813) [-746.549] * [-752.205] (-752.265) (-757.328) (-755.103) -- 0:02:16
310000 -- (-759.484) (-752.216) (-753.092) [-747.526] * [-748.960] (-747.893) (-749.017) (-752.800) -- 0:02:15
Average standard deviation of split frequencies: 0.011128
310500 -- [-745.254] (-758.490) (-750.763) (-746.016) * (-747.967) [-752.614] (-747.376) (-759.068) -- 0:02:15
311000 -- (-750.983) [-747.403] (-753.913) (-744.500) * (-748.294) [-746.397] (-754.104) (-758.906) -- 0:02:15
311500 -- (-746.593) [-747.896] (-756.866) (-747.010) * (-747.302) [-748.154] (-750.360) (-755.774) -- 0:02:17
312000 -- (-754.748) [-749.501] (-750.371) (-751.732) * [-750.101] (-748.194) (-748.568) (-754.422) -- 0:02:16
312500 -- (-750.754) (-755.629) [-744.782] (-755.146) * (-744.877) (-754.008) (-748.359) [-755.241] -- 0:02:16
313000 -- [-749.557] (-749.329) (-749.053) (-751.812) * (-748.561) (-758.515) (-753.099) [-759.094] -- 0:02:16
313500 -- (-749.275) (-748.969) (-749.869) [-749.622] * (-743.745) (-754.381) [-749.469] (-752.517) -- 0:02:15
314000 -- (-742.973) (-753.627) (-745.955) [-749.916] * (-757.130) (-751.274) (-753.926) [-755.755] -- 0:02:15
314500 -- (-748.766) (-751.018) [-746.266] (-753.947) * (-749.164) (-754.177) [-754.299] (-755.893) -- 0:02:15
315000 -- (-743.312) [-746.563] (-748.897) (-748.686) * (-746.740) (-753.599) [-751.724] (-751.164) -- 0:02:14
Average standard deviation of split frequencies: 0.011188
315500 -- (-748.726) [-744.846] (-749.383) (-754.638) * (-749.376) [-752.962] (-753.459) (-752.119) -- 0:02:14
316000 -- (-750.277) [-748.490] (-754.658) (-754.037) * (-749.961) (-752.791) (-752.779) [-753.396] -- 0:02:14
316500 -- [-748.381] (-749.871) (-749.670) (-750.914) * [-749.293] (-752.161) (-750.984) (-751.272) -- 0:02:16
317000 -- [-757.299] (-753.065) (-759.309) (-764.456) * (-750.046) [-744.527] (-749.901) (-756.154) -- 0:02:15
317500 -- (-751.479) [-751.601] (-750.038) (-750.761) * (-752.198) [-746.974] (-749.699) (-759.017) -- 0:02:15
318000 -- (-748.483) [-745.787] (-748.529) (-756.449) * (-746.181) (-748.658) (-751.907) [-750.501] -- 0:02:15
318500 -- [-749.512] (-751.297) (-755.111) (-749.899) * (-751.673) (-747.042) [-750.251] (-761.222) -- 0:02:14
319000 -- (-748.310) (-744.479) [-749.176] (-750.275) * (-753.658) (-748.949) [-749.746] (-754.900) -- 0:02:14
319500 -- (-750.642) [-748.287] (-757.757) (-748.223) * [-745.776] (-752.362) (-747.887) (-754.964) -- 0:02:14
320000 -- [-746.394] (-752.711) (-748.647) (-755.353) * (-749.523) [-757.065] (-758.090) (-747.989) -- 0:02:13
Average standard deviation of split frequencies: 0.009801
320500 -- [-748.545] (-750.030) (-753.080) (-749.867) * (-746.851) (-748.664) (-754.257) [-747.119] -- 0:02:15
321000 -- (-756.313) [-744.201] (-747.957) (-753.515) * (-744.813) (-747.431) (-746.460) [-747.258] -- 0:02:15
321500 -- (-758.608) [-749.315] (-752.462) (-750.189) * [-748.607] (-744.749) (-753.708) (-757.182) -- 0:02:15
322000 -- (-751.265) [-751.018] (-756.035) (-754.611) * [-749.581] (-750.455) (-753.562) (-748.782) -- 0:02:14
322500 -- [-750.745] (-748.153) (-753.977) (-749.442) * [-748.094] (-748.707) (-750.942) (-753.779) -- 0:02:14
323000 -- (-751.204) [-747.691] (-748.392) (-755.726) * (-750.684) (-764.896) [-745.504] (-747.454) -- 0:02:14
323500 -- (-755.701) [-744.289] (-749.063) (-756.631) * (-748.539) [-749.445] (-747.403) (-755.244) -- 0:02:13
324000 -- (-752.168) (-750.027) (-759.282) [-747.704] * (-749.884) (-748.006) (-746.058) [-750.514] -- 0:02:13
324500 -- (-747.571) (-754.586) [-749.854] (-758.531) * (-746.836) [-749.832] (-749.974) (-749.329) -- 0:02:13
325000 -- (-748.983) (-752.548) [-751.998] (-746.795) * [-752.114] (-751.157) (-752.484) (-754.037) -- 0:02:12
Average standard deviation of split frequencies: 0.008435
325500 -- (-752.566) (-748.037) [-752.014] (-752.037) * (-748.079) (-758.618) [-750.384] (-756.847) -- 0:02:12
326000 -- (-745.023) (-752.110) (-745.910) [-748.493] * (-749.321) (-753.786) (-753.176) [-746.604] -- 0:02:14
326500 -- (-746.380) [-753.951] (-743.936) (-754.368) * (-748.406) (-751.285) [-745.870] (-754.664) -- 0:02:14
327000 -- (-761.195) (-754.325) [-748.131] (-752.834) * (-754.919) (-750.934) (-749.813) [-750.001] -- 0:02:13
327500 -- (-761.002) (-749.217) (-749.496) [-750.795] * (-763.988) (-751.369) (-752.016) [-749.381] -- 0:02:13
328000 -- [-753.572] (-756.754) (-750.060) (-748.873) * (-757.195) (-750.738) [-752.900] (-755.232) -- 0:02:13
328500 -- (-761.245) (-750.666) [-749.145] (-745.256) * (-755.207) [-750.243] (-747.826) (-751.502) -- 0:02:12
329000 -- (-748.609) (-753.407) [-748.643] (-748.967) * (-749.040) [-753.645] (-754.499) (-747.111) -- 0:02:12
329500 -- [-751.052] (-754.699) (-750.518) (-750.407) * (-749.449) (-753.542) (-749.281) [-752.650] -- 0:02:12
330000 -- [-756.216] (-744.810) (-747.780) (-747.867) * [-747.849] (-753.645) (-746.472) (-756.829) -- 0:02:11
Average standard deviation of split frequencies: 0.005702
330500 -- (-753.529) (-746.473) (-753.753) [-750.604] * [-745.640] (-754.752) (-747.241) (-757.070) -- 0:02:11
331000 -- (-750.485) [-747.833] (-747.814) (-748.236) * (-752.780) (-751.110) [-750.630] (-756.324) -- 0:02:13
331500 -- [-749.146] (-743.977) (-748.676) (-746.136) * [-745.913] (-746.911) (-754.805) (-758.482) -- 0:02:13
332000 -- [-752.144] (-751.881) (-746.634) (-743.584) * (-749.236) (-753.437) [-748.567] (-748.572) -- 0:02:12
332500 -- (-753.037) [-749.331] (-747.796) (-759.109) * (-743.198) (-749.115) [-744.616] (-752.223) -- 0:02:12
333000 -- (-749.308) (-747.372) [-745.876] (-761.869) * [-751.559] (-748.120) (-744.953) (-751.565) -- 0:02:12
333500 -- (-759.011) (-756.282) (-750.060) [-747.064] * (-747.337) [-752.737] (-749.654) (-751.487) -- 0:02:11
334000 -- (-747.942) (-749.402) [-746.750] (-749.712) * [-748.720] (-759.679) (-754.145) (-749.155) -- 0:02:11
334500 -- [-758.247] (-747.876) (-750.644) (-753.402) * (-751.317) (-755.788) (-752.965) [-743.128] -- 0:02:11
335000 -- (-750.924) (-747.944) [-744.922] (-747.130) * (-755.862) (-751.101) [-752.720] (-757.202) -- 0:02:11
Average standard deviation of split frequencies: 0.007716
335500 -- (-756.190) [-744.971] (-746.281) (-747.914) * (-754.169) [-748.264] (-751.836) (-753.110) -- 0:02:10
336000 -- [-751.738] (-752.878) (-745.545) (-751.107) * [-749.668] (-744.763) (-747.350) (-750.308) -- 0:02:12
336500 -- (-747.111) (-747.049) (-752.598) [-751.959] * (-750.241) (-751.888) [-751.300] (-748.714) -- 0:02:12
337000 -- (-752.110) [-750.340] (-749.357) (-751.925) * (-748.753) [-745.250] (-754.355) (-747.920) -- 0:02:11
337500 -- (-751.311) (-754.068) [-758.618] (-749.481) * (-748.447) (-753.639) [-748.297] (-750.241) -- 0:02:11
338000 -- [-743.953] (-752.921) (-754.130) (-743.682) * (-751.053) (-751.160) [-747.793] (-751.291) -- 0:02:11
338500 -- (-748.258) (-754.100) (-751.932) [-752.470] * (-750.783) (-753.764) [-748.853] (-755.615) -- 0:02:10
339000 -- (-746.634) (-755.138) [-749.798] (-755.343) * [-746.820] (-749.059) (-750.695) (-748.786) -- 0:02:10
339500 -- (-752.019) (-750.440) (-744.185) [-749.467] * (-751.367) [-746.210] (-752.631) (-752.064) -- 0:02:10
340000 -- (-746.928) (-767.320) [-746.399] (-752.708) * [-750.277] (-752.863) (-749.222) (-757.145) -- 0:02:10
Average standard deviation of split frequencies: 0.007611
340500 -- (-756.677) (-750.653) (-748.136) [-747.482] * (-751.382) (-760.946) (-748.804) [-749.948] -- 0:02:09
341000 -- [-747.406] (-753.744) (-755.785) (-744.876) * (-750.891) [-758.147] (-748.736) (-748.025) -- 0:02:09
341500 -- (-754.919) [-751.583] (-755.012) (-751.563) * (-749.585) [-750.432] (-749.720) (-752.241) -- 0:02:11
342000 -- (-752.273) (-748.078) [-746.180] (-757.740) * [-747.656] (-753.437) (-748.449) (-759.327) -- 0:02:10
342500 -- (-758.192) [-750.534] (-756.953) (-755.593) * (-752.079) (-749.384) (-753.045) [-748.505] -- 0:02:10
343000 -- (-757.993) [-749.299] (-751.398) (-752.673) * (-752.375) [-747.823] (-753.078) (-746.205) -- 0:02:10
343500 -- (-750.975) (-745.610) (-750.504) [-749.867] * (-752.449) [-749.879] (-745.467) (-748.193) -- 0:02:09
344000 -- [-745.297] (-756.299) (-749.602) (-744.253) * (-755.197) [-749.372] (-749.628) (-754.950) -- 0:02:09
344500 -- (-747.328) [-752.491] (-748.281) (-746.543) * [-748.121] (-758.602) (-747.865) (-751.632) -- 0:02:09
345000 -- [-748.763] (-744.603) (-751.013) (-742.291) * [-755.243] (-754.981) (-750.367) (-751.478) -- 0:02:09
Average standard deviation of split frequencies: 0.008402
345500 -- (-749.613) (-748.620) (-748.668) [-746.259] * [-747.340] (-749.722) (-750.283) (-749.544) -- 0:02:08
346000 -- (-752.459) (-751.280) [-755.418] (-751.237) * (-760.994) (-751.079) [-749.648] (-747.697) -- 0:02:08
346500 -- (-747.911) (-752.585) (-748.719) [-749.863] * [-747.351] (-757.427) (-758.586) (-747.631) -- 0:02:10
347000 -- (-757.689) [-753.711] (-747.480) (-749.434) * (-744.989) (-747.825) (-750.880) [-747.493] -- 0:02:09
347500 -- [-753.411] (-755.064) (-744.789) (-748.728) * (-746.439) (-754.839) (-748.924) [-747.947] -- 0:02:09
348000 -- (-750.539) (-757.546) [-748.378] (-753.583) * (-746.300) (-761.452) (-746.520) [-746.431] -- 0:02:09
348500 -- [-744.396] (-753.898) (-749.161) (-748.025) * [-746.711] (-750.778) (-748.679) (-753.321) -- 0:02:08
349000 -- [-752.582] (-752.547) (-757.962) (-751.508) * [-747.626] (-749.709) (-749.023) (-755.798) -- 0:02:08
349500 -- (-754.794) (-748.663) [-750.914] (-749.753) * (-746.885) (-750.368) (-751.052) [-748.353] -- 0:02:08
350000 -- (-746.939) (-751.713) (-755.499) [-743.994] * (-749.554) (-745.524) [-753.093] (-753.102) -- 0:02:08
Average standard deviation of split frequencies: 0.008290
350500 -- [-747.926] (-758.889) (-754.879) (-742.735) * (-746.264) [-748.427] (-747.636) (-751.386) -- 0:02:07
351000 -- (-751.935) (-757.227) (-759.562) [-747.387] * (-747.199) (-746.973) (-745.358) [-745.988] -- 0:02:07
351500 -- (-748.316) (-754.949) (-748.797) [-751.121] * (-749.789) (-746.387) [-744.949] (-745.403) -- 0:02:07
352000 -- [-745.203] (-760.505) (-749.536) (-751.729) * [-749.903] (-750.782) (-749.078) (-746.796) -- 0:02:08
352500 -- (-749.968) (-747.499) [-744.001] (-747.203) * (-752.044) (-752.533) (-752.140) [-746.279] -- 0:02:08
353000 -- (-752.923) (-748.576) (-743.822) [-746.338] * (-754.453) [-755.235] (-750.922) (-747.976) -- 0:02:08
353500 -- (-749.417) (-750.016) [-750.623] (-751.354) * (-754.386) (-750.470) (-751.451) [-746.705] -- 0:02:08
354000 -- (-748.166) (-748.611) [-749.164] (-761.207) * (-746.092) (-753.556) (-749.363) [-744.173] -- 0:02:07
354500 -- (-749.156) [-745.238] (-757.468) (-750.720) * (-751.390) (-753.746) [-744.514] (-751.030) -- 0:02:07
355000 -- (-751.588) (-769.664) (-747.033) [-749.982] * (-747.504) (-752.243) (-758.573) [-746.856] -- 0:02:07
Average standard deviation of split frequencies: 0.008607
355500 -- [-748.029] (-749.514) (-753.404) (-752.991) * (-765.338) (-751.548) (-748.182) [-746.595] -- 0:02:06
356000 -- (-751.275) (-749.163) [-750.439] (-744.881) * (-750.811) (-751.799) [-743.518] (-747.422) -- 0:02:06
356500 -- (-752.829) [-746.371] (-750.177) (-749.838) * (-746.315) [-746.166] (-752.082) (-747.664) -- 0:02:06
357000 -- (-750.767) (-747.038) (-751.950) [-744.051] * (-748.623) (-746.806) (-749.959) [-746.808] -- 0:02:07
357500 -- [-747.066] (-759.269) (-753.017) (-747.059) * [-753.093] (-750.277) (-746.582) (-747.030) -- 0:02:07
358000 -- [-747.484] (-744.019) (-747.832) (-746.454) * [-747.073] (-759.931) (-753.559) (-753.956) -- 0:02:07
358500 -- (-749.708) (-750.943) [-746.659] (-755.310) * (-751.244) (-747.817) (-755.129) [-746.154] -- 0:02:07
359000 -- (-754.502) [-744.283] (-746.733) (-757.355) * (-756.474) [-749.284] (-758.089) (-746.371) -- 0:02:06
359500 -- (-743.591) (-746.284) [-748.600] (-751.899) * (-753.858) (-758.795) (-752.274) [-746.950] -- 0:02:06
360000 -- (-748.537) [-759.209] (-748.490) (-756.812) * (-751.402) [-747.605] (-748.857) (-751.465) -- 0:02:06
Average standard deviation of split frequencies: 0.007189
360500 -- [-742.820] (-755.859) (-748.325) (-750.774) * [-755.104] (-748.746) (-748.545) (-748.013) -- 0:02:05
361000 -- (-747.735) (-754.591) (-749.448) [-750.852] * [-749.181] (-751.694) (-758.496) (-749.437) -- 0:02:05
361500 -- (-754.086) [-748.381] (-748.942) (-759.021) * (-750.591) (-755.516) [-756.448] (-752.173) -- 0:02:05
362000 -- (-749.767) (-748.541) [-750.285] (-749.459) * (-756.404) (-754.799) (-752.696) [-749.826] -- 0:02:06
362500 -- (-753.101) [-745.446] (-753.119) (-748.474) * (-751.299) [-754.163] (-765.036) (-743.501) -- 0:02:06
363000 -- [-747.415] (-747.274) (-750.388) (-745.092) * (-751.317) (-756.426) (-753.742) [-745.841] -- 0:02:06
363500 -- [-746.805] (-754.710) (-755.126) (-754.007) * (-745.252) (-758.627) (-744.293) [-749.322] -- 0:02:06
364000 -- [-749.233] (-751.231) (-752.087) (-753.169) * (-753.648) (-749.202) [-754.680] (-750.664) -- 0:02:05
364500 -- (-749.629) [-750.076] (-752.289) (-752.376) * (-747.249) (-753.856) [-747.270] (-750.878) -- 0:02:05
365000 -- [-750.667] (-761.081) (-755.150) (-752.701) * [-746.440] (-751.774) (-750.756) (-756.449) -- 0:02:05
Average standard deviation of split frequencies: 0.006655
365500 -- [-752.269] (-752.959) (-745.205) (-754.955) * (-751.498) (-754.501) [-750.259] (-747.702) -- 0:02:04
366000 -- (-756.693) [-747.981] (-748.186) (-751.195) * (-757.060) [-753.887] (-750.569) (-753.371) -- 0:02:04
366500 -- (-753.411) (-747.060) [-746.086] (-746.330) * [-747.718] (-749.165) (-749.957) (-747.884) -- 0:02:04
367000 -- (-758.673) (-752.562) [-748.663] (-752.657) * (-744.115) (-749.952) (-751.005) [-748.949] -- 0:02:04
367500 -- (-750.260) (-751.074) (-755.647) [-748.843] * (-751.378) (-751.051) [-755.994] (-757.782) -- 0:02:05
368000 -- (-745.835) (-757.078) (-749.315) [-748.784] * (-748.440) [-749.794] (-750.588) (-750.828) -- 0:02:05
368500 -- (-750.245) [-750.955] (-749.243) (-755.292) * (-753.888) [-750.026] (-749.291) (-758.587) -- 0:02:05
369000 -- [-744.594] (-746.946) (-752.412) (-753.622) * (-748.532) (-746.518) [-744.205] (-753.227) -- 0:02:04
369500 -- (-747.914) (-746.252) (-749.616) [-750.627] * (-748.458) (-753.562) [-750.728] (-748.856) -- 0:02:04
370000 -- (-749.776) [-750.154] (-745.701) (-751.570) * (-754.240) [-748.927] (-753.444) (-754.808) -- 0:02:04
Average standard deviation of split frequencies: 0.007207
370500 -- (-749.120) [-751.485] (-746.212) (-753.925) * (-748.672) [-755.482] (-754.893) (-742.572) -- 0:02:04
371000 -- (-746.960) (-749.855) (-746.664) [-748.176] * [-753.638] (-756.265) (-754.846) (-749.751) -- 0:02:03
371500 -- (-746.482) [-744.701] (-750.833) (-749.806) * [-747.328] (-751.221) (-749.021) (-751.136) -- 0:02:03
372000 -- [-753.518] (-749.144) (-747.670) (-746.273) * [-745.537] (-749.075) (-757.897) (-748.434) -- 0:02:03
372500 -- (-750.115) (-747.481) (-748.430) [-754.344] * (-746.000) (-759.172) [-749.708] (-752.371) -- 0:02:04
373000 -- (-749.577) (-753.606) [-744.978] (-749.124) * (-748.249) (-763.425) (-751.593) [-747.377] -- 0:02:04
373500 -- (-745.895) (-754.624) [-745.289] (-751.046) * [-748.679] (-751.941) (-752.256) (-755.570) -- 0:02:04
374000 -- (-749.816) [-743.333] (-748.674) (-749.630) * (-752.194) (-746.551) [-747.322] (-750.823) -- 0:02:03
374500 -- [-745.449] (-749.872) (-745.540) (-757.293) * [-747.216] (-762.919) (-757.373) (-748.341) -- 0:02:03
375000 -- [-746.687] (-744.169) (-748.454) (-751.434) * (-756.970) (-758.674) [-746.712] (-749.036) -- 0:02:03
Average standard deviation of split frequencies: 0.006269
375500 -- (-746.833) (-760.888) [-748.207] (-749.784) * (-752.748) [-753.088] (-750.851) (-745.564) -- 0:02:03
376000 -- (-749.673) (-752.960) (-749.978) [-749.460] * (-749.756) (-754.456) [-747.594] (-754.426) -- 0:02:02
376500 -- (-753.061) (-754.839) [-747.107] (-749.417) * [-747.443] (-749.643) (-749.611) (-751.962) -- 0:02:02
377000 -- (-746.977) [-752.330] (-749.549) (-748.560) * (-765.529) (-753.118) (-747.983) [-752.705] -- 0:02:02
377500 -- (-745.776) (-751.317) (-746.026) [-750.062] * [-746.640] (-751.797) (-747.009) (-749.837) -- 0:02:03
378000 -- (-748.903) [-754.209] (-755.438) (-744.729) * (-748.314) (-754.723) (-749.675) [-747.638] -- 0:02:03
378500 -- (-742.973) (-747.807) (-752.230) [-748.599] * [-747.622] (-752.388) (-751.293) (-751.271) -- 0:02:03
379000 -- (-761.976) (-749.067) [-749.484] (-752.355) * [-755.617] (-753.107) (-745.815) (-748.485) -- 0:02:02
379500 -- (-752.422) (-747.987) [-746.270] (-750.151) * (-751.146) (-747.742) (-748.676) [-748.691] -- 0:02:02
380000 -- (-747.485) (-750.165) [-744.982] (-744.689) * (-751.267) [-748.418] (-754.459) (-749.464) -- 0:02:02
Average standard deviation of split frequencies: 0.006605
380500 -- (-755.276) (-746.710) [-751.006] (-750.861) * (-761.868) [-754.880] (-748.127) (-753.984) -- 0:02:02
381000 -- (-748.773) (-754.814) (-753.019) [-748.729] * (-752.773) (-751.297) (-744.482) [-744.001] -- 0:02:01
381500 -- (-751.890) (-759.576) (-746.456) [-744.873] * [-753.381] (-758.344) (-748.873) (-749.342) -- 0:02:01
382000 -- [-746.132] (-751.637) (-751.880) (-746.794) * [-749.825] (-752.953) (-744.081) (-752.425) -- 0:02:01
382500 -- (-748.900) (-748.233) (-748.894) [-747.604] * [-751.157] (-750.350) (-755.633) (-745.537) -- 0:02:02
383000 -- (-749.648) (-749.341) [-742.177] (-753.261) * [-746.338] (-745.457) (-749.956) (-758.233) -- 0:02:02
383500 -- [-745.525] (-750.390) (-744.482) (-751.608) * (-748.773) (-756.766) [-741.996] (-756.241) -- 0:02:02
384000 -- (-749.470) (-753.798) (-746.776) [-746.661] * (-754.362) [-750.791] (-752.378) (-756.544) -- 0:02:01
384500 -- [-745.846] (-757.549) (-752.598) (-750.513) * [-752.868] (-748.531) (-747.759) (-754.269) -- 0:02:01
385000 -- (-744.397) (-747.655) [-750.807] (-746.008) * (-752.559) [-748.746] (-756.551) (-756.477) -- 0:02:01
Average standard deviation of split frequencies: 0.006717
385500 -- [-748.893] (-755.286) (-749.048) (-752.441) * [-747.267] (-746.251) (-746.850) (-750.577) -- 0:02:01
386000 -- [-746.292] (-755.531) (-753.086) (-760.009) * [-747.191] (-749.747) (-745.153) (-758.933) -- 0:02:00
386500 -- (-745.198) [-747.368] (-750.393) (-760.417) * (-749.011) [-760.021] (-747.831) (-756.310) -- 0:02:00
387000 -- [-749.567] (-751.839) (-751.481) (-753.334) * [-747.121] (-745.999) (-751.154) (-756.617) -- 0:02:00
387500 -- (-744.750) [-750.734] (-748.336) (-753.539) * [-746.460] (-751.733) (-746.285) (-747.024) -- 0:02:00
388000 -- (-752.715) [-744.809] (-753.903) (-752.527) * [-752.049] (-756.168) (-748.227) (-747.013) -- 0:02:01
388500 -- (-744.739) (-765.908) (-746.517) [-752.738] * [-748.788] (-749.660) (-747.677) (-747.763) -- 0:02:01
389000 -- [-750.867] (-746.177) (-754.072) (-758.614) * [-752.504] (-750.183) (-746.661) (-746.233) -- 0:02:00
389500 -- (-749.019) (-751.147) [-753.163] (-748.901) * (-756.258) (-750.694) [-749.298] (-749.649) -- 0:02:00
390000 -- (-755.768) (-750.332) [-751.450] (-745.339) * (-752.902) (-755.157) [-747.156] (-748.598) -- 0:02:00
Average standard deviation of split frequencies: 0.007642
390500 -- (-758.150) (-754.500) [-746.851] (-745.335) * (-752.957) (-749.291) (-747.055) [-743.251] -- 0:02:00
391000 -- (-756.141) [-749.144] (-751.618) (-749.955) * (-754.898) (-749.938) (-749.123) [-752.238] -- 0:01:59
391500 -- (-750.461) (-748.016) [-750.750] (-743.431) * (-747.228) (-752.115) [-746.521] (-748.023) -- 0:01:59
392000 -- (-745.687) (-749.999) [-747.675] (-747.338) * (-748.861) [-751.851] (-752.639) (-752.431) -- 0:01:59
392500 -- (-754.706) (-755.768) [-748.462] (-748.019) * [-748.126] (-753.873) (-748.400) (-752.748) -- 0:01:59
393000 -- (-757.511) (-747.504) (-755.128) [-746.269] * (-752.351) (-748.659) [-751.645] (-751.483) -- 0:02:00
393500 -- [-745.425] (-750.280) (-753.315) (-745.631) * [-748.115] (-753.307) (-749.573) (-748.001) -- 0:02:00
394000 -- (-745.377) (-761.068) (-753.442) [-753.182] * (-746.193) (-754.325) [-748.250] (-747.475) -- 0:01:59
394500 -- (-750.172) (-753.477) (-751.409) [-743.556] * (-752.209) (-751.378) [-751.443] (-751.686) -- 0:01:59
395000 -- [-746.173] (-754.491) (-746.837) (-744.873) * (-748.163) (-750.655) (-747.682) [-746.328] -- 0:01:59
Average standard deviation of split frequencies: 0.008135
395500 -- (-751.227) [-752.304] (-753.743) (-750.420) * [-749.395] (-758.757) (-756.768) (-753.914) -- 0:01:59
396000 -- [-753.225] (-755.184) (-749.982) (-748.783) * [-744.823] (-752.501) (-756.380) (-756.130) -- 0:01:58
396500 -- (-751.912) (-754.718) (-756.270) [-747.042] * (-748.034) [-753.921] (-745.727) (-757.668) -- 0:01:58
397000 -- [-746.902] (-752.168) (-748.375) (-746.339) * (-760.784) [-753.353] (-747.670) (-751.716) -- 0:01:58
397500 -- (-753.182) [-746.593] (-754.417) (-752.885) * (-756.530) [-756.652] (-756.759) (-752.251) -- 0:01:58
398000 -- (-750.351) (-748.923) (-751.173) [-748.296] * [-752.868] (-750.937) (-755.405) (-748.178) -- 0:01:59
398500 -- (-750.443) (-747.735) (-752.319) [-754.695] * (-764.451) (-752.086) (-757.567) [-746.410] -- 0:01:59
399000 -- (-745.799) (-755.751) (-755.893) [-753.908] * (-749.726) (-754.810) [-742.864] (-746.306) -- 0:01:58
399500 -- (-749.364) (-748.157) [-754.109] (-757.593) * (-754.689) [-755.148] (-745.711) (-750.140) -- 0:01:58
400000 -- (-746.797) (-750.106) [-749.015] (-760.084) * (-753.121) (-749.017) [-746.318] (-750.256) -- 0:01:58
Average standard deviation of split frequencies: 0.007059
400500 -- (-752.295) (-749.706) (-762.383) [-750.281] * (-754.766) (-753.561) (-749.495) [-747.992] -- 0:01:58
401000 -- (-747.038) [-757.866] (-758.864) (-758.039) * (-753.020) (-756.882) (-748.372) [-747.093] -- 0:01:58
401500 -- (-756.496) [-747.023] (-752.250) (-751.576) * [-748.020] (-766.911) (-752.624) (-744.570) -- 0:01:57
402000 -- (-748.313) [-745.109] (-750.342) (-749.730) * [-752.971] (-753.045) (-744.893) (-748.216) -- 0:01:57
402500 -- [-749.100] (-748.727) (-754.608) (-754.275) * (-748.106) (-753.780) [-751.203] (-751.592) -- 0:01:57
403000 -- (-751.231) (-754.543) (-751.569) [-752.836] * [-752.717] (-753.649) (-748.900) (-749.722) -- 0:01:58
403500 -- (-752.847) (-747.901) (-747.101) [-745.883] * (-750.740) (-756.871) [-747.612] (-748.853) -- 0:01:58
404000 -- (-755.444) [-748.378] (-753.249) (-747.543) * [-749.104] (-755.077) (-747.776) (-750.670) -- 0:01:58
404500 -- (-750.974) [-749.301] (-753.634) (-752.189) * (-750.291) (-756.982) (-746.394) [-746.059] -- 0:01:57
405000 -- [-747.965] (-749.757) (-758.517) (-748.538) * (-753.248) (-752.458) [-750.721] (-752.831) -- 0:01:57
Average standard deviation of split frequencies: 0.006386
405500 -- (-752.278) (-755.204) (-759.171) [-745.074] * (-752.816) (-755.509) [-745.542] (-748.118) -- 0:01:57
406000 -- (-747.483) (-751.546) [-753.465] (-747.513) * (-749.210) (-763.492) (-744.157) [-749.817] -- 0:01:57
406500 -- (-757.157) [-746.709] (-752.474) (-758.554) * (-749.622) [-761.433] (-743.477) (-751.011) -- 0:01:56
407000 -- (-753.969) [-751.187] (-757.482) (-751.364) * [-746.323] (-761.752) (-748.185) (-752.449) -- 0:01:56
407500 -- (-750.997) (-749.129) [-747.101] (-747.300) * (-750.106) (-755.258) [-746.388] (-754.286) -- 0:01:56
408000 -- (-749.559) (-757.355) [-749.796] (-751.701) * (-751.077) (-759.989) (-752.425) [-752.580] -- 0:01:56
408500 -- (-745.917) (-748.491) (-758.978) [-747.753] * [-746.582] (-762.358) (-754.350) (-754.260) -- 0:01:57
409000 -- (-756.958) [-751.687] (-749.480) (-753.109) * [-747.031] (-759.070) (-749.744) (-756.722) -- 0:01:57
409500 -- [-751.676] (-746.713) (-748.768) (-746.333) * (-754.382) (-758.197) (-749.744) [-753.897] -- 0:01:56
410000 -- [-748.931] (-751.013) (-753.272) (-754.055) * (-745.342) (-749.922) (-753.320) [-744.446] -- 0:01:56
Average standard deviation of split frequencies: 0.007270
410500 -- [-748.531] (-751.312) (-749.743) (-749.001) * (-750.424) (-752.913) (-755.157) [-746.495] -- 0:01:56
411000 -- [-754.256] (-748.876) (-759.610) (-749.087) * (-753.276) (-750.667) [-748.513] (-754.945) -- 0:01:56
411500 -- (-755.760) (-753.340) (-747.848) [-747.878] * (-755.135) (-753.721) (-756.618) [-749.553] -- 0:01:55
412000 -- (-751.448) [-749.152] (-754.855) (-749.258) * (-754.413) (-752.746) (-746.786) [-745.753] -- 0:01:55
412500 -- (-756.013) (-745.890) (-747.858) [-747.572] * (-754.364) (-757.485) [-745.770] (-749.210) -- 0:01:55
413000 -- (-746.984) (-749.471) [-747.446] (-750.525) * (-759.068) (-749.487) (-757.091) [-746.648] -- 0:01:55
413500 -- (-747.998) [-744.110] (-749.234) (-749.613) * (-755.202) [-750.922] (-749.417) (-751.125) -- 0:01:56
414000 -- (-750.875) [-750.831] (-751.768) (-758.875) * [-752.937] (-748.357) (-750.896) (-748.906) -- 0:01:56
414500 -- (-752.323) (-744.872) [-747.571] (-751.711) * (-753.364) [-747.767] (-747.836) (-750.252) -- 0:01:55
415000 -- (-752.233) (-753.157) (-748.195) [-751.239] * (-756.312) (-753.472) [-750.182] (-750.178) -- 0:01:55
Average standard deviation of split frequencies: 0.006988
415500 -- [-746.017] (-752.815) (-748.671) (-754.435) * (-743.122) (-758.162) [-746.464] (-748.930) -- 0:01:55
416000 -- [-748.497] (-751.981) (-752.063) (-755.450) * (-748.021) (-757.851) (-752.593) [-749.691] -- 0:01:55
416500 -- [-746.282] (-756.490) (-754.726) (-750.285) * (-748.586) [-756.149] (-751.380) (-752.902) -- 0:01:54
417000 -- (-747.420) [-751.460] (-749.333) (-759.891) * (-743.705) (-752.796) (-755.423) [-748.155] -- 0:01:54
417500 -- (-748.825) (-750.782) [-748.593] (-748.076) * (-746.339) (-763.390) (-748.248) [-749.434] -- 0:01:54
418000 -- [-746.718] (-748.270) (-754.487) (-749.686) * (-764.038) (-751.006) [-746.277] (-748.320) -- 0:01:54
418500 -- (-751.004) (-746.156) (-751.330) [-744.683] * (-748.596) (-757.141) (-747.735) [-746.639] -- 0:01:55
419000 -- (-751.612) (-749.853) [-748.972] (-749.495) * [-746.893] (-767.423) (-754.441) (-745.771) -- 0:01:55
419500 -- [-746.640] (-748.293) (-757.597) (-745.316) * [-748.183] (-751.372) (-755.404) (-752.621) -- 0:01:54
420000 -- (-757.662) (-748.202) (-750.291) [-744.752] * (-749.813) (-749.789) [-753.258] (-753.718) -- 0:01:54
Average standard deviation of split frequencies: 0.006724
420500 -- (-757.056) (-748.540) (-749.862) [-754.857] * [-748.659] (-746.097) (-748.642) (-758.640) -- 0:01:54
421000 -- (-754.611) (-748.323) (-751.114) [-743.245] * [-752.123] (-753.946) (-748.803) (-747.082) -- 0:01:54
421500 -- [-744.903] (-748.225) (-748.080) (-744.410) * [-747.897] (-753.965) (-760.958) (-750.601) -- 0:01:53
422000 -- (-749.027) (-753.733) [-744.107] (-745.464) * (-753.299) (-750.100) [-749.139] (-749.117) -- 0:01:53
422500 -- (-746.962) (-747.146) (-752.730) [-745.543] * (-749.417) (-751.414) (-752.086) [-746.086] -- 0:01:53
423000 -- (-756.789) [-744.913] (-753.482) (-747.703) * (-756.183) (-751.111) [-744.623] (-749.103) -- 0:01:53
423500 -- (-750.617) [-746.038] (-747.638) (-754.698) * (-752.221) (-753.020) [-746.354] (-747.111) -- 0:01:54
424000 -- (-753.216) (-750.953) [-745.001] (-752.757) * [-747.330] (-747.204) (-746.022) (-751.540) -- 0:01:54
424500 -- (-755.201) [-752.020] (-752.435) (-745.352) * (-748.311) (-753.174) (-755.328) [-750.122] -- 0:01:53
425000 -- (-750.509) [-746.929] (-747.930) (-760.768) * (-751.735) (-746.266) (-749.000) [-747.678] -- 0:01:53
Average standard deviation of split frequencies: 0.007562
425500 -- (-744.448) [-747.258] (-747.949) (-746.712) * (-750.200) (-744.842) (-760.703) [-751.911] -- 0:01:53
426000 -- [-747.942] (-751.230) (-747.544) (-747.765) * [-748.768] (-748.716) (-748.936) (-752.366) -- 0:01:53
426500 -- (-755.104) [-748.406] (-750.409) (-751.218) * (-746.777) [-750.424] (-752.758) (-753.810) -- 0:01:52
427000 -- (-751.298) (-751.278) [-746.275] (-744.932) * (-755.245) [-747.347] (-748.431) (-758.391) -- 0:01:52
427500 -- [-751.374] (-745.936) (-746.003) (-751.692) * (-750.077) [-748.797] (-754.803) (-756.044) -- 0:01:52
428000 -- (-756.487) (-752.440) (-749.397) [-752.566] * (-756.260) [-751.914] (-750.665) (-755.669) -- 0:01:52
428500 -- [-751.471] (-749.041) (-759.639) (-745.907) * (-751.045) (-748.674) [-748.718] (-760.756) -- 0:01:52
429000 -- [-745.933] (-757.048) (-746.652) (-747.553) * (-753.397) (-760.422) [-749.039] (-757.548) -- 0:01:53
429500 -- [-746.358] (-746.562) (-755.097) (-751.038) * [-749.805] (-754.341) (-749.765) (-752.745) -- 0:01:52
430000 -- (-751.902) (-745.209) [-750.699] (-755.973) * (-748.458) (-754.291) [-746.859] (-752.526) -- 0:01:52
Average standard deviation of split frequencies: 0.007480
430500 -- (-744.677) (-749.284) (-753.191) [-746.507] * (-751.194) (-752.205) (-754.014) [-751.811] -- 0:01:52
431000 -- (-752.077) (-753.359) [-746.733] (-752.646) * (-749.103) [-745.338] (-751.381) (-746.766) -- 0:01:52
431500 -- (-748.819) (-753.858) (-750.266) [-747.949] * (-748.607) (-753.973) [-754.531] (-748.199) -- 0:01:51
432000 -- (-756.305) (-751.839) [-752.295] (-746.396) * (-749.718) [-751.903] (-758.333) (-752.541) -- 0:01:51
432500 -- [-749.778] (-755.390) (-751.025) (-746.342) * (-751.679) (-751.321) [-756.548] (-752.591) -- 0:01:51
433000 -- (-748.784) (-751.012) [-744.658] (-753.554) * [-757.075] (-747.763) (-753.493) (-749.968) -- 0:01:51
433500 -- (-747.806) [-747.269] (-750.438) (-747.841) * (-761.432) (-753.363) (-752.034) [-749.738] -- 0:01:51
434000 -- (-753.384) (-746.621) [-745.540] (-748.848) * (-749.849) [-749.083] (-759.018) (-756.902) -- 0:01:52
434500 -- (-757.129) (-744.896) (-748.503) [-746.977] * (-761.842) [-748.490] (-753.347) (-748.460) -- 0:01:51
435000 -- (-762.357) (-743.502) (-751.989) [-744.346] * (-749.488) (-753.821) (-749.165) [-745.219] -- 0:01:51
Average standard deviation of split frequencies: 0.006848
435500 -- (-749.249) (-747.681) [-759.140] (-751.607) * (-749.179) (-747.153) [-752.578] (-744.023) -- 0:01:51
436000 -- [-745.096] (-753.706) (-750.229) (-754.734) * [-748.940] (-749.841) (-750.903) (-749.023) -- 0:01:51
436500 -- (-750.491) (-752.043) [-757.598] (-754.765) * (-751.322) (-757.096) [-752.697] (-748.761) -- 0:01:51
437000 -- (-746.446) (-751.525) (-748.146) [-746.072] * (-747.069) (-747.773) [-752.554] (-760.251) -- 0:01:50
437500 -- [-744.886] (-748.851) (-751.590) (-748.852) * (-748.430) [-749.762] (-750.052) (-747.207) -- 0:01:50
438000 -- (-747.198) [-747.336] (-750.427) (-748.149) * (-746.372) (-749.666) [-753.724] (-751.467) -- 0:01:50
438500 -- (-749.272) [-746.735] (-750.067) (-746.158) * (-754.968) [-746.284] (-763.182) (-753.477) -- 0:01:50
439000 -- [-751.649] (-755.358) (-752.792) (-752.434) * [-752.070] (-751.783) (-751.071) (-749.282) -- 0:01:51
439500 -- (-749.690) (-751.442) (-754.560) [-747.746] * (-751.630) (-749.504) (-748.926) [-746.287] -- 0:01:50
440000 -- [-746.834] (-747.893) (-747.642) (-744.620) * [-746.306] (-752.976) (-753.097) (-743.753) -- 0:01:50
Average standard deviation of split frequencies: 0.005705
440500 -- (-760.983) (-749.870) [-746.212] (-749.617) * [-754.231] (-748.996) (-748.860) (-746.032) -- 0:01:50
441000 -- (-755.914) (-748.488) [-743.720] (-749.475) * (-756.278) [-752.695] (-746.298) (-752.681) -- 0:01:50
441500 -- (-756.379) [-742.593] (-748.167) (-756.487) * (-755.491) [-751.731] (-750.390) (-747.492) -- 0:01:50
442000 -- [-749.836] (-751.256) (-747.167) (-747.283) * (-752.405) (-752.893) [-751.519] (-747.900) -- 0:01:49
442500 -- (-753.140) [-747.544] (-749.032) (-754.522) * (-759.609) [-750.855] (-751.622) (-755.428) -- 0:01:49
443000 -- (-754.147) (-744.781) [-746.761] (-755.276) * (-751.101) (-748.406) (-752.373) [-751.116] -- 0:01:49
443500 -- (-749.705) (-747.046) [-750.160] (-750.637) * (-747.460) (-747.011) (-754.266) [-750.054] -- 0:01:49
444000 -- (-754.650) (-746.050) (-750.060) [-749.849] * (-749.323) [-750.306] (-757.208) (-745.712) -- 0:01:50
444500 -- (-745.972) [-747.124] (-759.020) (-749.699) * (-749.177) [-752.014] (-754.178) (-750.412) -- 0:01:49
445000 -- [-746.966] (-746.282) (-758.656) (-748.338) * [-743.537] (-747.608) (-752.651) (-754.897) -- 0:01:49
Average standard deviation of split frequencies: 0.006870
445500 -- [-747.869] (-750.984) (-751.749) (-749.825) * [-748.372] (-753.021) (-747.273) (-745.703) -- 0:01:49
446000 -- (-756.170) (-749.566) (-754.519) [-745.267] * (-745.197) [-753.082] (-754.696) (-753.393) -- 0:01:49
446500 -- (-745.693) (-748.706) [-762.291] (-755.338) * (-747.370) (-747.981) (-755.536) [-746.646] -- 0:01:49
447000 -- [-748.242] (-753.724) (-759.524) (-745.711) * [-758.816] (-744.585) (-757.539) (-754.077) -- 0:01:48
447500 -- (-744.965) (-746.644) (-752.681) [-750.106] * (-745.458) [-748.057] (-752.943) (-754.307) -- 0:01:48
448000 -- [-750.021] (-755.513) (-750.009) (-746.752) * [-748.367] (-747.657) (-754.423) (-747.349) -- 0:01:48
448500 -- (-747.265) (-747.734) (-754.567) [-747.387] * (-748.844) (-757.492) (-767.756) [-747.625] -- 0:01:48
449000 -- (-750.603) [-746.260] (-749.201) (-749.664) * [-748.927] (-753.243) (-745.463) (-750.781) -- 0:01:47
449500 -- (-753.816) (-747.049) (-750.118) [-753.468] * (-746.958) (-751.849) [-745.385] (-749.851) -- 0:01:48
450000 -- (-761.125) (-743.332) (-752.781) [-747.926] * (-744.573) (-744.301) [-747.841] (-754.482) -- 0:01:48
Average standard deviation of split frequencies: 0.006450
450500 -- [-744.275] (-751.257) (-753.420) (-749.963) * (-749.594) (-749.520) [-743.864] (-754.606) -- 0:01:48
451000 -- (-747.560) [-747.011] (-755.585) (-751.044) * (-750.399) (-749.120) [-748.630] (-754.593) -- 0:01:48
451500 -- (-759.243) (-750.467) (-753.244) [-744.691] * (-755.041) (-755.767) [-751.884] (-760.695) -- 0:01:48
452000 -- (-748.855) (-746.946) [-746.089] (-750.734) * [-751.417] (-748.281) (-749.114) (-750.718) -- 0:01:47
452500 -- (-749.390) (-750.261) [-746.814] (-763.056) * (-745.797) [-747.859] (-753.407) (-756.437) -- 0:01:47
453000 -- (-750.214) (-751.501) [-746.350] (-752.372) * [-750.248] (-749.274) (-754.099) (-753.239) -- 0:01:47
453500 -- (-751.757) (-748.799) (-750.032) [-744.817] * (-753.870) (-751.954) (-756.748) [-751.511] -- 0:01:47
454000 -- (-750.589) (-751.288) (-747.343) [-746.365] * (-752.695) [-744.696] (-749.480) (-750.351) -- 0:01:47
454500 -- [-747.682] (-753.701) (-744.869) (-748.845) * (-756.005) [-747.595] (-753.505) (-761.132) -- 0:01:48
455000 -- [-746.971] (-747.142) (-748.154) (-749.783) * (-749.190) [-748.934] (-747.208) (-745.169) -- 0:01:47
Average standard deviation of split frequencies: 0.007581
455500 -- [-746.638] (-755.601) (-749.618) (-754.394) * (-749.276) [-744.322] (-746.643) (-744.993) -- 0:01:47
456000 -- [-750.383] (-748.186) (-745.520) (-750.999) * [-757.303] (-746.564) (-747.078) (-750.970) -- 0:01:47
456500 -- (-747.615) (-748.276) [-747.088] (-751.407) * [-750.597] (-753.005) (-752.674) (-746.889) -- 0:01:47
457000 -- [-748.006] (-745.904) (-743.985) (-761.970) * (-754.484) [-747.503] (-752.361) (-758.554) -- 0:01:46
457500 -- (-749.570) [-750.164] (-747.730) (-749.269) * (-751.660) (-746.810) (-752.782) [-743.632] -- 0:01:46
458000 -- (-746.853) (-755.476) [-746.795] (-745.499) * (-747.898) (-746.605) [-750.824] (-746.581) -- 0:01:46
458500 -- (-753.557) (-752.466) (-758.511) [-748.581] * [-747.711] (-751.712) (-746.759) (-749.668) -- 0:01:46
459000 -- (-746.386) (-757.940) [-749.704] (-748.272) * (-750.542) (-749.535) [-748.598] (-745.680) -- 0:01:46
459500 -- (-757.785) (-752.957) [-746.022] (-745.011) * (-752.191) (-747.200) (-745.848) [-745.971] -- 0:01:47
460000 -- (-755.237) (-749.903) [-746.897] (-746.593) * (-752.711) (-747.817) [-749.211] (-745.488) -- 0:01:46
Average standard deviation of split frequencies: 0.007163
460500 -- (-752.793) (-756.392) [-746.814] (-751.829) * (-750.331) (-750.598) [-748.266] (-743.642) -- 0:01:46
461000 -- (-751.957) (-752.368) [-751.639] (-753.727) * (-747.586) (-751.920) (-745.441) [-749.164] -- 0:01:46
461500 -- (-750.631) (-751.767) [-745.892] (-754.382) * (-750.288) (-747.582) (-753.119) [-749.791] -- 0:01:46
462000 -- (-758.951) (-751.538) [-751.360] (-757.666) * (-744.934) (-754.809) [-743.802] (-755.436) -- 0:01:45
462500 -- (-750.427) [-754.793] (-758.249) (-755.744) * [-748.601] (-752.059) (-747.747) (-753.623) -- 0:01:45
463000 -- (-752.873) (-756.424) [-749.347] (-756.408) * (-748.092) [-754.216] (-743.078) (-748.929) -- 0:01:45
463500 -- (-752.969) [-748.189] (-755.979) (-755.862) * (-744.740) (-748.872) (-749.479) [-745.876] -- 0:01:45
464000 -- (-753.212) (-752.551) [-751.598] (-752.439) * (-748.410) [-749.940] (-752.394) (-747.166) -- 0:01:45
464500 -- (-747.235) (-757.204) (-752.848) [-752.271] * (-749.735) (-748.587) (-755.080) [-747.768] -- 0:01:46
465000 -- (-749.568) (-741.167) [-755.753] (-750.252) * (-749.007) (-754.093) (-751.251) [-748.781] -- 0:01:45
Average standard deviation of split frequencies: 0.006913
465500 -- (-761.634) [-746.868] (-752.935) (-757.427) * (-750.144) [-747.137] (-747.631) (-745.728) -- 0:01:45
466000 -- (-752.591) [-747.871] (-750.741) (-743.409) * [-745.949] (-754.812) (-748.673) (-750.366) -- 0:01:45
466500 -- (-758.893) [-745.450] (-754.667) (-746.324) * (-756.718) (-748.027) (-756.333) [-749.778] -- 0:01:45
467000 -- (-746.670) [-754.037] (-755.006) (-749.559) * (-745.279) (-748.656) (-744.770) [-742.798] -- 0:01:45
467500 -- (-750.959) [-745.131] (-762.231) (-751.504) * [-748.636] (-751.277) (-757.687) (-749.121) -- 0:01:44
468000 -- (-753.183) (-748.481) (-756.438) [-760.900] * [-749.163] (-749.955) (-754.972) (-750.081) -- 0:01:44
468500 -- (-747.056) [-746.582] (-760.808) (-743.256) * (-746.425) [-752.748] (-756.041) (-747.451) -- 0:01:44
469000 -- [-746.282] (-751.922) (-756.456) (-747.243) * (-751.270) [-752.818] (-757.700) (-752.299) -- 0:01:44
469500 -- [-744.880] (-754.086) (-755.687) (-752.079) * [-746.852] (-756.530) (-748.811) (-746.509) -- 0:01:43
470000 -- (-749.447) (-752.971) [-752.258] (-744.307) * [-753.645] (-755.870) (-750.947) (-749.046) -- 0:01:44
Average standard deviation of split frequencies: 0.007345
470500 -- (-747.595) [-749.020] (-747.674) (-742.578) * [-753.023] (-752.197) (-749.345) (-749.196) -- 0:01:44
471000 -- [-745.514] (-743.554) (-748.372) (-750.470) * (-757.420) (-743.208) (-752.281) [-746.088] -- 0:01:44
471500 -- [-748.554] (-747.218) (-751.123) (-757.192) * [-751.868] (-751.202) (-755.104) (-748.018) -- 0:01:44
472000 -- [-745.745] (-751.363) (-748.198) (-752.335) * (-749.616) (-748.114) [-747.141] (-751.151) -- 0:01:44
472500 -- (-753.208) (-753.899) (-749.179) [-748.911] * (-751.718) [-745.217] (-755.891) (-756.882) -- 0:01:43
473000 -- [-745.229] (-752.341) (-752.508) (-749.856) * (-749.097) (-750.993) [-746.958] (-754.870) -- 0:01:43
473500 -- [-751.043] (-752.525) (-758.554) (-751.933) * (-754.451) (-744.122) [-748.853] (-758.369) -- 0:01:43
474000 -- (-749.065) (-754.412) (-758.251) [-749.423] * (-757.687) [-753.938] (-746.104) (-752.830) -- 0:01:43
474500 -- (-755.419) [-751.708] (-747.070) (-751.613) * (-751.963) (-754.778) (-752.815) [-758.316] -- 0:01:42
475000 -- (-755.297) (-754.212) (-749.534) [-748.165] * (-751.744) (-748.253) [-744.752] (-745.275) -- 0:01:43
Average standard deviation of split frequencies: 0.006107
475500 -- (-748.942) (-749.129) (-757.902) [-748.680] * (-745.614) [-744.330] (-754.625) (-747.087) -- 0:01:43
476000 -- [-750.863] (-755.793) (-756.351) (-744.538) * (-753.914) (-755.447) (-749.861) [-747.975] -- 0:01:43
476500 -- (-748.698) [-745.147] (-754.502) (-761.549) * (-752.847) (-754.508) [-747.981] (-748.458) -- 0:01:43
477000 -- (-756.979) (-749.095) [-753.326] (-747.084) * (-748.384) (-745.542) (-745.492) [-747.962] -- 0:01:43
477500 -- (-752.117) [-743.991] (-752.850) (-751.049) * (-757.312) (-748.966) [-747.110] (-754.046) -- 0:01:42
478000 -- [-755.058] (-749.195) (-752.116) (-747.269) * (-742.685) [-752.480] (-751.616) (-747.912) -- 0:01:42
478500 -- (-747.194) (-743.418) (-745.818) [-747.203] * (-751.191) (-751.890) [-749.676] (-752.448) -- 0:01:42
479000 -- (-748.822) [-748.962] (-751.601) (-746.029) * [-744.230] (-748.857) (-747.453) (-748.243) -- 0:01:42
479500 -- (-750.806) (-743.822) (-744.954) [-751.833] * [-746.173] (-751.717) (-752.323) (-745.968) -- 0:01:42
480000 -- (-749.173) (-761.210) [-749.240] (-751.259) * (-744.431) (-763.034) [-752.328] (-757.053) -- 0:01:42
Average standard deviation of split frequencies: 0.006702
480500 -- (-746.537) (-747.903) (-754.108) [-744.395] * [-744.649] (-754.457) (-753.077) (-754.016) -- 0:01:42
481000 -- (-747.716) (-749.678) (-747.488) [-746.382] * [-750.194] (-748.660) (-745.233) (-752.688) -- 0:01:42
481500 -- (-750.840) (-755.529) (-745.650) [-745.343] * (-754.838) (-748.765) (-764.934) [-749.362] -- 0:01:42
482000 -- (-744.961) (-745.579) [-748.098] (-746.109) * (-753.775) (-750.240) (-759.225) [-753.651] -- 0:01:42
482500 -- (-745.856) (-749.965) (-743.826) [-752.933] * (-747.492) [-743.788] (-751.975) (-749.639) -- 0:01:41
483000 -- (-751.558) (-747.455) [-748.147] (-746.590) * (-749.075) (-746.169) [-752.635] (-750.858) -- 0:01:41
483500 -- [-748.500] (-751.716) (-750.915) (-749.599) * (-755.838) (-751.279) [-747.668] (-750.849) -- 0:01:41
484000 -- [-752.484] (-750.774) (-752.573) (-750.751) * (-755.641) [-745.859] (-751.880) (-754.839) -- 0:01:41
484500 -- (-757.203) (-750.014) (-754.176) [-745.041] * [-748.003] (-757.136) (-748.672) (-750.718) -- 0:01:41
485000 -- [-756.029] (-747.213) (-756.875) (-753.727) * (-750.770) (-757.997) (-754.230) [-753.696] -- 0:01:40
Average standard deviation of split frequencies: 0.006790
485500 -- [-753.685] (-747.604) (-750.905) (-753.803) * (-766.059) [-751.453] (-747.407) (-741.483) -- 0:01:41
486000 -- (-755.240) (-759.842) [-759.435] (-751.434) * (-754.279) (-748.182) [-748.784] (-755.427) -- 0:01:41
486500 -- (-746.897) [-750.569] (-754.440) (-752.169) * (-752.909) [-746.372] (-745.820) (-748.161) -- 0:01:41
487000 -- (-748.102) (-747.340) [-742.166] (-752.447) * (-749.414) [-750.757] (-754.057) (-747.508) -- 0:01:41
487500 -- (-750.458) (-753.222) (-747.064) [-750.082] * (-747.899) (-752.545) (-750.337) [-745.246] -- 0:01:40
488000 -- (-750.875) (-747.667) [-743.409] (-750.049) * (-746.962) (-749.936) (-749.796) [-749.538] -- 0:01:40
488500 -- [-750.467] (-757.982) (-751.462) (-751.782) * (-749.160) (-748.147) [-746.195] (-746.614) -- 0:01:40
489000 -- [-745.786] (-757.149) (-749.611) (-753.645) * [-747.770] (-742.978) (-761.423) (-747.617) -- 0:01:40
489500 -- (-746.933) (-761.447) (-754.549) [-753.230] * [-749.373] (-751.237) (-749.625) (-758.122) -- 0:01:40
490000 -- [-745.504] (-749.271) (-752.939) (-754.011) * [-747.209] (-755.794) (-754.034) (-745.508) -- 0:01:39
Average standard deviation of split frequencies: 0.006725
490500 -- (-750.931) (-755.153) (-748.739) [-750.554] * (-748.908) (-749.537) (-757.673) [-749.539] -- 0:01:40
491000 -- (-750.205) [-749.066] (-747.488) (-757.055) * [-750.190] (-748.754) (-752.025) (-754.023) -- 0:01:40
491500 -- (-751.905) (-753.370) [-746.977] (-751.974) * (-746.504) (-748.119) [-749.489] (-756.366) -- 0:01:40
492000 -- (-755.744) (-753.479) [-751.172] (-747.297) * [-749.979] (-751.962) (-753.380) (-750.751) -- 0:01:40
492500 -- (-753.691) (-747.368) (-757.214) [-746.838] * [-746.550] (-757.382) (-752.053) (-752.165) -- 0:01:39
493000 -- (-746.155) [-746.727] (-748.768) (-753.338) * (-748.466) (-751.233) [-749.818] (-761.691) -- 0:01:39
493500 -- (-746.927) [-751.577] (-748.152) (-744.579) * [-743.858] (-751.349) (-750.046) (-756.893) -- 0:01:39
494000 -- (-746.850) (-755.718) [-745.564] (-751.928) * [-750.362] (-762.517) (-755.051) (-746.412) -- 0:01:39
494500 -- (-743.384) (-752.328) (-748.994) [-749.212] * (-758.417) (-757.038) (-744.372) [-745.373] -- 0:01:39
495000 -- (-747.153) (-749.105) (-760.517) [-747.602] * (-750.450) (-760.652) [-746.947] (-747.380) -- 0:01:38
Average standard deviation of split frequencies: 0.006653
495500 -- [-747.826] (-748.859) (-760.469) (-748.964) * [-748.099] (-749.190) (-756.527) (-749.788) -- 0:01:39
496000 -- [-746.106] (-756.142) (-752.367) (-743.502) * (-749.950) (-752.595) [-752.085] (-745.507) -- 0:01:39
496500 -- (-744.084) (-750.516) (-752.563) [-748.190] * (-748.510) (-756.019) [-751.213] (-749.132) -- 0:01:39
497000 -- (-754.996) (-750.991) (-755.388) [-751.278] * [-752.639] (-748.038) (-754.695) (-750.738) -- 0:01:39
497500 -- [-747.397] (-755.739) (-749.093) (-748.541) * (-749.021) [-750.902] (-748.258) (-748.671) -- 0:01:38
498000 -- (-754.849) (-753.790) [-747.463] (-749.898) * (-755.078) (-751.812) (-747.105) [-745.579] -- 0:01:38
498500 -- [-750.858] (-751.114) (-753.007) (-753.019) * (-753.625) (-755.665) (-751.991) [-745.104] -- 0:01:38
499000 -- [-754.850] (-750.691) (-750.889) (-754.925) * [-750.296] (-748.757) (-750.376) (-747.212) -- 0:01:38
499500 -- (-755.086) [-745.112] (-752.876) (-753.488) * (-749.815) (-745.779) (-751.641) [-747.688] -- 0:01:38
500000 -- (-748.236) [-744.363] (-752.927) (-754.879) * [-749.003] (-752.563) (-750.849) (-746.022) -- 0:01:38
Average standard deviation of split frequencies: 0.008317
500500 -- (-758.021) (-749.300) (-752.747) [-746.640] * [-747.046] (-753.304) (-751.725) (-754.689) -- 0:01:38
501000 -- (-752.885) (-750.524) (-753.979) [-744.759] * [-748.032] (-753.884) (-753.781) (-754.677) -- 0:01:38
501500 -- (-750.761) (-747.806) [-757.315] (-744.744) * (-751.191) [-752.172] (-747.234) (-752.697) -- 0:01:38
502000 -- [-750.427] (-742.436) (-751.680) (-752.373) * (-754.181) [-750.734] (-750.648) (-749.839) -- 0:01:38
502500 -- (-754.329) [-749.074] (-755.282) (-753.322) * (-755.576) (-746.900) (-749.387) [-748.269] -- 0:01:38
503000 -- [-746.068] (-747.974) (-751.956) (-752.897) * (-752.013) [-745.911] (-744.521) (-750.544) -- 0:01:37
503500 -- (-761.098) (-745.353) [-749.640] (-748.495) * (-759.394) [-750.139] (-750.722) (-751.058) -- 0:01:37
504000 -- (-751.450) (-750.901) (-750.346) [-748.845] * (-754.688) (-758.506) (-749.733) [-746.064] -- 0:01:37
504500 -- (-758.427) (-750.329) (-745.745) [-747.748] * (-757.779) (-748.699) (-745.828) [-747.163] -- 0:01:37
505000 -- (-749.172) [-747.964] (-744.901) (-751.191) * (-750.898) (-753.065) (-748.111) [-750.441] -- 0:01:37
Average standard deviation of split frequencies: 0.008850
505500 -- [-753.092] (-755.341) (-749.391) (-749.605) * (-751.066) [-748.582] (-745.919) (-749.105) -- 0:01:36
506000 -- (-751.222) (-750.747) (-748.135) [-750.715] * (-751.703) (-747.712) (-752.055) [-749.777] -- 0:01:37
506500 -- [-752.748] (-751.986) (-752.474) (-750.560) * [-746.449] (-760.287) (-746.591) (-751.040) -- 0:01:37
507000 -- (-749.927) (-755.485) (-751.022) [-746.817] * (-746.450) (-756.500) [-744.330] (-761.624) -- 0:01:37
507500 -- [-752.279] (-750.654) (-751.044) (-743.622) * (-747.141) [-746.373] (-750.168) (-747.092) -- 0:01:37
508000 -- (-758.478) [-752.416] (-758.686) (-748.233) * [-748.789] (-748.536) (-753.759) (-746.135) -- 0:01:36
508500 -- (-755.147) (-751.575) (-754.721) [-750.990] * [-747.529] (-755.912) (-752.280) (-749.679) -- 0:01:36
509000 -- (-749.548) (-747.150) (-753.154) [-750.862] * [-752.225] (-751.230) (-752.362) (-746.797) -- 0:01:36
509500 -- (-751.256) (-749.129) (-757.144) [-746.450] * [-748.725] (-748.746) (-755.230) (-751.872) -- 0:01:36
510000 -- (-749.058) [-758.070] (-753.024) (-752.296) * (-752.885) (-749.842) [-757.860] (-752.881) -- 0:01:36
Average standard deviation of split frequencies: 0.008308
510500 -- (-752.418) (-753.241) [-750.849] (-749.221) * (-747.344) [-754.577] (-751.308) (-754.732) -- 0:01:35
511000 -- (-751.558) (-746.945) (-753.904) [-743.833] * [-743.731] (-754.772) (-751.074) (-753.557) -- 0:01:36
511500 -- (-750.613) [-749.611] (-755.561) (-747.398) * (-757.498) (-746.497) [-745.093] (-745.116) -- 0:01:36
512000 -- (-743.799) (-748.873) [-747.785] (-746.506) * (-750.739) (-751.933) (-753.931) [-746.983] -- 0:01:36
512500 -- (-745.018) (-753.636) (-757.827) [-750.669] * (-754.579) [-747.590] (-753.682) (-751.514) -- 0:01:36
513000 -- (-755.880) (-751.099) [-760.769] (-745.448) * (-754.981) (-745.961) (-747.895) [-749.824] -- 0:01:35
513500 -- (-750.954) (-754.993) (-755.802) [-753.126] * (-753.595) (-748.273) (-748.580) [-747.051] -- 0:01:35
514000 -- (-752.874) [-744.517] (-756.470) (-757.990) * (-750.971) [-749.393] (-749.776) (-747.783) -- 0:01:35
514500 -- [-749.515] (-748.096) (-760.469) (-752.566) * (-747.105) (-756.575) (-751.221) [-750.252] -- 0:01:35
515000 -- [-750.004] (-758.248) (-759.483) (-760.026) * [-745.867] (-749.065) (-747.544) (-748.979) -- 0:01:35
Average standard deviation of split frequencies: 0.008527
515500 -- (-745.818) (-751.152) (-750.769) [-748.989] * (-745.547) (-754.563) (-755.624) [-746.244] -- 0:01:34
516000 -- (-745.513) (-746.434) [-749.451] (-748.719) * [-748.915] (-764.524) (-748.061) (-755.077) -- 0:01:35
516500 -- (-747.107) (-749.198) (-753.212) [-749.431] * (-747.387) (-755.972) (-750.073) [-749.844] -- 0:01:35
517000 -- (-748.521) (-743.715) (-746.824) [-749.080] * (-749.794) (-758.282) [-748.067] (-758.178) -- 0:01:35
517500 -- [-752.556] (-753.600) (-745.174) (-755.521) * [-748.488] (-752.157) (-750.001) (-751.208) -- 0:01:35
518000 -- [-746.522] (-751.175) (-748.961) (-746.386) * (-748.769) (-757.132) [-744.992] (-754.479) -- 0:01:34
518500 -- (-752.536) (-751.621) (-754.523) [-751.003] * (-744.848) (-756.789) [-748.929] (-753.371) -- 0:01:34
519000 -- (-753.055) (-752.634) [-747.910] (-744.670) * (-746.170) (-755.793) (-747.259) [-755.492] -- 0:01:34
519500 -- (-755.057) (-755.773) [-745.293] (-752.209) * (-745.054) (-757.934) [-762.976] (-749.541) -- 0:01:34
520000 -- (-750.220) (-745.140) [-745.589] (-752.487) * [-745.945] (-761.422) (-748.751) (-753.499) -- 0:01:34
Average standard deviation of split frequencies: 0.008903
520500 -- (-754.498) (-753.333) [-753.761] (-760.387) * (-753.648) (-748.014) (-745.683) [-746.426] -- 0:01:33
521000 -- (-747.565) (-747.312) [-750.493] (-752.323) * (-760.125) (-760.074) [-746.484] (-749.720) -- 0:01:34
521500 -- (-752.554) [-743.411] (-754.175) (-752.952) * (-753.474) (-755.524) [-745.586] (-748.048) -- 0:01:34
522000 -- (-751.049) [-747.426] (-753.180) (-750.720) * (-757.431) [-749.063] (-758.486) (-752.930) -- 0:01:34
522500 -- (-749.791) (-750.088) (-748.308) [-743.049] * [-748.029] (-757.605) (-750.769) (-754.607) -- 0:01:34
523000 -- (-749.191) (-747.594) [-748.059] (-750.703) * [-748.188] (-752.036) (-752.819) (-747.189) -- 0:01:33
523500 -- (-758.075) (-753.228) (-756.063) [-745.783] * (-744.803) [-746.104] (-746.567) (-746.772) -- 0:01:33
524000 -- [-749.136] (-753.996) (-750.416) (-746.919) * [-746.577] (-744.680) (-747.844) (-750.479) -- 0:01:33
524500 -- (-748.356) (-753.427) [-750.666] (-747.118) * (-750.995) [-745.319] (-743.178) (-748.478) -- 0:01:33
525000 -- [-752.224] (-750.383) (-747.160) (-754.632) * (-751.389) (-747.400) (-754.778) [-750.761] -- 0:01:33
Average standard deviation of split frequencies: 0.008365
525500 -- (-755.320) (-745.149) [-749.621] (-752.799) * [-747.067] (-749.320) (-751.575) (-750.265) -- 0:01:33
526000 -- [-747.977] (-752.439) (-748.517) (-751.042) * (-743.587) (-747.281) [-749.206] (-752.184) -- 0:01:33
526500 -- [-751.224] (-751.123) (-748.209) (-747.964) * [-745.536] (-757.714) (-750.919) (-748.539) -- 0:01:33
527000 -- [-756.317] (-749.812) (-743.916) (-753.882) * (-753.537) (-755.839) [-746.721] (-748.402) -- 0:01:33
527500 -- (-753.106) (-744.998) [-748.813] (-748.367) * (-756.532) [-749.338] (-747.930) (-749.562) -- 0:01:33
528000 -- [-749.215] (-749.521) (-746.381) (-754.078) * (-750.816) [-749.254] (-755.353) (-746.109) -- 0:01:33
528500 -- [-749.188] (-748.824) (-752.301) (-753.845) * (-749.309) [-745.630] (-753.920) (-750.624) -- 0:01:33
529000 -- (-747.124) [-750.733] (-756.686) (-753.425) * (-749.820) [-746.128] (-758.114) (-754.288) -- 0:01:33
529500 -- (-746.466) [-743.245] (-756.525) (-751.129) * [-745.684] (-751.796) (-749.890) (-756.055) -- 0:01:33
530000 -- (-754.932) (-749.338) (-762.276) [-753.367] * (-743.908) [-745.923] (-749.568) (-750.038) -- 0:01:33
Average standard deviation of split frequencies: 0.007699
530500 -- (-754.905) [-756.186] (-756.430) (-750.246) * (-751.052) [-753.507] (-746.361) (-749.864) -- 0:01:32
531000 -- [-748.950] (-749.153) (-750.840) (-749.988) * (-748.340) [-752.813] (-749.718) (-747.604) -- 0:01:32
531500 -- (-746.662) [-746.076] (-757.956) (-746.444) * (-750.750) (-746.271) (-749.143) [-745.623] -- 0:01:33
532000 -- [-747.689] (-753.365) (-748.677) (-750.230) * (-750.623) (-755.213) [-746.507] (-754.536) -- 0:01:33
532500 -- (-750.007) (-747.699) (-751.156) [-747.635] * [-750.755] (-751.511) (-747.127) (-755.133) -- 0:01:33
533000 -- (-752.349) [-748.646] (-747.207) (-752.741) * (-744.710) (-753.768) [-753.008] (-756.301) -- 0:01:32
533500 -- (-750.460) (-751.131) [-750.120] (-757.763) * [-756.364] (-745.120) (-743.029) (-754.497) -- 0:01:32
534000 -- [-747.863] (-754.086) (-747.102) (-746.367) * [-749.406] (-749.826) (-757.819) (-746.516) -- 0:01:32
534500 -- [-745.109] (-756.824) (-757.251) (-746.328) * [-745.219] (-746.290) (-753.478) (-752.950) -- 0:01:32
535000 -- (-745.229) (-750.528) (-753.177) [-749.514] * (-747.459) (-749.369) [-747.307] (-753.220) -- 0:01:32
Average standard deviation of split frequencies: 0.008062
535500 -- [-752.180] (-756.509) (-746.292) (-749.777) * (-748.262) (-746.561) [-747.068] (-751.092) -- 0:01:31
536000 -- (-751.295) (-753.236) [-748.785] (-748.154) * (-750.327) (-745.705) (-756.583) [-749.530] -- 0:01:31
536500 -- [-749.876] (-749.570) (-747.243) (-750.554) * (-750.750) [-747.196] (-754.569) (-752.778) -- 0:01:32
537000 -- (-745.642) [-744.480] (-752.069) (-751.331) * (-750.642) (-749.521) [-750.935] (-753.023) -- 0:01:32
537500 -- [-748.802] (-746.481) (-749.395) (-755.692) * (-748.840) (-751.955) [-747.722] (-753.715) -- 0:01:32
538000 -- (-747.631) (-753.092) [-747.575] (-749.427) * [-748.614] (-755.035) (-752.037) (-747.179) -- 0:01:31
538500 -- (-748.674) [-748.256] (-754.004) (-750.401) * (-751.406) [-747.621] (-750.072) (-746.012) -- 0:01:31
539000 -- (-748.301) (-750.465) (-748.202) [-748.312] * (-747.089) (-755.376) [-747.983] (-754.206) -- 0:01:31
539500 -- [-752.795] (-750.595) (-747.923) (-746.742) * (-752.468) (-755.679) (-748.391) [-748.090] -- 0:01:31
540000 -- [-748.518] (-750.056) (-750.928) (-746.999) * [-753.504] (-749.251) (-750.160) (-746.154) -- 0:01:31
Average standard deviation of split frequencies: 0.007992
540500 -- (-753.731) (-760.468) [-747.541] (-748.377) * (-749.816) [-747.537] (-747.785) (-747.440) -- 0:01:30
541000 -- (-748.247) [-749.309] (-751.930) (-747.476) * [-744.603] (-751.519) (-748.759) (-749.129) -- 0:01:30
541500 -- [-748.259] (-749.778) (-747.695) (-750.874) * (-747.173) [-745.555] (-750.580) (-750.748) -- 0:01:31
542000 -- [-747.643] (-754.715) (-754.173) (-746.676) * (-747.072) (-751.514) (-747.782) [-749.690] -- 0:01:31
542500 -- (-753.138) [-751.772] (-755.648) (-752.405) * (-746.388) (-747.922) (-746.810) [-745.863] -- 0:01:31
543000 -- [-750.978] (-758.939) (-753.362) (-749.448) * (-747.257) (-749.543) [-749.536] (-747.277) -- 0:01:30
543500 -- [-748.738] (-750.063) (-755.025) (-750.247) * [-749.861] (-747.711) (-750.227) (-746.241) -- 0:01:30
544000 -- (-754.626) (-748.016) [-752.798] (-756.170) * (-745.503) (-748.866) (-744.432) [-750.384] -- 0:01:30
544500 -- (-752.036) (-747.862) [-753.031] (-750.548) * (-749.649) [-743.369] (-746.027) (-751.225) -- 0:01:30
545000 -- (-754.337) (-748.817) (-749.806) [-751.939] * (-749.211) (-750.195) (-750.444) [-745.822] -- 0:01:30
Average standard deviation of split frequencies: 0.007627
545500 -- [-756.243] (-754.455) (-749.838) (-756.143) * (-750.789) (-747.086) [-745.667] (-749.938) -- 0:01:29
546000 -- (-747.024) [-747.798] (-757.219) (-753.484) * (-752.586) [-746.106] (-755.555) (-752.458) -- 0:01:29
546500 -- [-750.655] (-748.691) (-755.758) (-748.428) * [-748.346] (-747.272) (-747.499) (-748.468) -- 0:01:30
547000 -- (-749.651) (-753.207) [-752.060] (-748.397) * [-746.328] (-749.624) (-751.156) (-752.950) -- 0:01:30
547500 -- [-746.540] (-750.426) (-750.629) (-746.186) * (-751.016) [-745.755] (-747.264) (-753.260) -- 0:01:30
548000 -- [-751.366] (-748.577) (-755.578) (-751.588) * [-751.068] (-745.614) (-747.912) (-749.641) -- 0:01:29
548500 -- (-751.150) [-749.138] (-757.227) (-747.179) * (-749.553) [-749.795] (-747.381) (-753.827) -- 0:01:29
549000 -- (-749.239) [-752.005] (-755.530) (-755.703) * (-745.536) (-749.997) [-744.849] (-748.851) -- 0:01:29
549500 -- (-760.759) [-745.639] (-758.102) (-749.691) * (-751.392) (-746.245) (-753.034) [-745.795] -- 0:01:29
550000 -- (-753.219) (-747.643) [-748.838] (-751.259) * (-749.647) (-750.104) (-742.900) [-753.012] -- 0:01:29
Average standard deviation of split frequencies: 0.007134
550500 -- [-745.122] (-752.412) (-747.634) (-755.141) * (-749.024) (-749.934) (-751.396) [-751.439] -- 0:01:29
551000 -- (-749.720) (-748.493) [-747.292] (-748.714) * (-749.213) (-745.628) (-753.863) [-748.782] -- 0:01:28
551500 -- (-750.143) (-750.883) [-745.926] (-746.842) * [-748.471] (-749.972) (-749.899) (-748.811) -- 0:01:28
552000 -- [-753.375] (-747.725) (-749.103) (-753.334) * (-748.528) (-754.669) (-751.341) [-747.456] -- 0:01:29
552500 -- [-747.089] (-752.832) (-747.249) (-752.148) * [-745.876] (-754.089) (-752.622) (-746.687) -- 0:01:29
553000 -- (-744.130) (-748.556) [-753.069] (-743.881) * (-750.737) (-758.889) (-744.721) [-749.085] -- 0:01:28
553500 -- (-750.122) (-753.908) (-752.173) [-749.900] * (-744.770) (-749.330) (-759.910) [-747.774] -- 0:01:28
554000 -- (-753.836) [-751.880] (-750.309) (-746.436) * (-747.203) (-754.681) (-768.307) [-746.475] -- 0:01:28
554500 -- (-751.102) (-752.289) (-749.489) [-748.276] * [-748.628] (-752.964) (-761.396) (-753.387) -- 0:01:28
555000 -- (-751.246) (-750.405) (-752.335) [-747.972] * (-746.888) (-745.560) [-759.458] (-753.521) -- 0:01:28
Average standard deviation of split frequencies: 0.006924
555500 -- (-759.397) (-748.953) (-751.595) [-753.263] * (-750.929) [-747.949] (-751.189) (-746.267) -- 0:01:28
556000 -- (-756.589) (-750.444) (-747.134) [-756.302] * (-748.275) (-746.962) [-752.857] (-746.981) -- 0:01:27
556500 -- [-753.889] (-760.950) (-749.342) (-752.724) * (-746.261) [-747.379] (-759.555) (-749.331) -- 0:01:27
557000 -- (-750.999) [-747.579] (-752.090) (-752.097) * (-755.717) [-745.932] (-757.178) (-760.440) -- 0:01:28
557500 -- (-759.179) [-749.141] (-754.051) (-750.697) * (-751.519) [-755.107] (-747.064) (-746.312) -- 0:01:28
558000 -- (-757.396) (-749.937) (-757.962) [-745.108] * [-756.165] (-754.981) (-748.825) (-749.766) -- 0:01:27
558500 -- (-755.200) (-749.820) (-752.126) [-741.725] * (-751.824) [-753.088] (-751.263) (-744.572) -- 0:01:27
559000 -- (-751.176) (-754.004) (-749.883) [-750.676] * (-746.997) (-753.272) [-750.872] (-747.223) -- 0:01:27
559500 -- (-751.165) (-757.377) [-752.341] (-746.769) * (-750.650) [-750.265] (-758.011) (-750.266) -- 0:01:27
560000 -- (-749.190) [-746.597] (-746.783) (-753.413) * [-748.256] (-743.533) (-753.933) (-748.664) -- 0:01:27
Average standard deviation of split frequencies: 0.007147
560500 -- (-753.224) (-745.174) (-744.321) [-750.783] * [-747.906] (-749.820) (-748.600) (-745.333) -- 0:01:27
561000 -- (-752.687) (-751.398) (-747.811) [-759.493] * (-750.723) [-750.741] (-745.257) (-751.084) -- 0:01:26
561500 -- (-745.651) [-748.265] (-746.720) (-753.497) * (-754.042) [-751.854] (-748.788) (-752.914) -- 0:01:26
562000 -- (-744.308) [-748.572] (-746.092) (-749.285) * [-745.223] (-754.702) (-748.222) (-747.421) -- 0:01:27
562500 -- [-744.709] (-756.906) (-752.892) (-749.916) * (-751.109) (-749.956) [-752.695] (-745.173) -- 0:01:27
563000 -- (-759.117) (-752.957) (-752.704) [-752.116] * (-746.451) (-750.598) (-748.738) [-742.734] -- 0:01:26
563500 -- (-753.589) (-752.330) [-748.251] (-749.188) * (-748.929) [-745.728] (-748.877) (-749.932) -- 0:01:26
564000 -- (-748.378) [-747.471] (-744.779) (-758.384) * (-750.494) (-745.732) [-748.751] (-753.101) -- 0:01:26
564500 -- [-754.116] (-754.965) (-754.710) (-751.271) * (-755.670) (-745.900) (-743.559) [-750.823] -- 0:01:26
565000 -- [-751.671] (-753.672) (-749.134) (-748.461) * (-757.918) (-752.612) [-751.769] (-745.433) -- 0:01:26
Average standard deviation of split frequencies: 0.007218
565500 -- [-746.176] (-749.717) (-750.872) (-753.148) * (-758.458) (-748.239) (-747.843) [-747.751] -- 0:01:26
566000 -- [-751.990] (-744.412) (-751.323) (-754.593) * (-753.048) (-744.658) (-747.103) [-748.569] -- 0:01:25
566500 -- (-756.965) [-748.936] (-747.092) (-751.461) * (-747.803) (-746.876) [-747.096] (-753.941) -- 0:01:25
567000 -- (-748.458) (-751.471) [-745.800] (-750.976) * (-752.879) [-754.355] (-752.321) (-752.483) -- 0:01:25
567500 -- (-756.107) (-748.783) (-751.495) [-751.818] * (-753.939) (-747.593) (-757.674) [-746.612] -- 0:01:26
568000 -- (-747.820) (-751.621) [-749.098] (-754.407) * (-752.756) (-749.909) (-755.611) [-750.330] -- 0:01:25
568500 -- (-749.223) (-750.698) [-747.859] (-749.788) * (-747.255) (-751.227) [-753.680] (-751.399) -- 0:01:25
569000 -- [-753.956] (-750.014) (-748.205) (-751.040) * (-747.982) (-749.527) (-755.006) [-747.725] -- 0:01:25
569500 -- [-748.028] (-748.680) (-752.293) (-756.079) * [-748.461] (-751.264) (-753.491) (-746.263) -- 0:01:25
570000 -- (-751.737) (-748.462) (-749.052) [-749.810] * [-751.511] (-749.003) (-745.978) (-751.954) -- 0:01:25
Average standard deviation of split frequencies: 0.007572
570500 -- [-742.150] (-749.860) (-745.993) (-751.570) * (-750.070) [-744.990] (-748.343) (-755.161) -- 0:01:25
571000 -- (-751.825) (-746.546) (-752.188) [-743.954] * (-748.500) [-745.357] (-752.460) (-758.734) -- 0:01:24
571500 -- (-745.951) [-751.100] (-745.713) (-758.983) * (-747.594) [-749.294] (-750.792) (-749.179) -- 0:01:24
572000 -- [-749.590] (-753.178) (-752.855) (-753.031) * (-751.020) (-754.034) (-747.829) [-749.081] -- 0:01:24
572500 -- (-759.882) (-751.220) (-757.017) [-745.732] * [-747.151] (-754.561) (-749.106) (-756.051) -- 0:01:25
573000 -- [-745.410] (-750.172) (-751.160) (-745.887) * (-752.541) [-752.041] (-746.712) (-759.092) -- 0:01:24
573500 -- (-747.926) (-751.468) [-751.049] (-749.177) * (-754.060) (-753.608) [-752.460] (-749.124) -- 0:01:24
574000 -- (-752.657) [-749.909] (-745.090) (-743.979) * (-752.030) (-751.074) [-746.306] (-750.810) -- 0:01:24
574500 -- [-743.405] (-746.672) (-748.535) (-751.017) * (-761.115) [-751.366] (-745.625) (-763.124) -- 0:01:24
575000 -- [-752.358] (-747.629) (-753.199) (-752.873) * (-753.477) (-749.463) (-747.600) [-750.938] -- 0:01:24
Average standard deviation of split frequencies: 0.007229
575500 -- [-749.116] (-749.891) (-750.188) (-749.049) * (-752.029) [-747.117] (-747.838) (-749.225) -- 0:01:24
576000 -- (-748.259) (-764.618) [-746.956] (-754.138) * (-750.878) (-749.179) (-752.176) [-746.737] -- 0:01:23
576500 -- (-748.489) (-752.028) [-749.303] (-753.371) * [-752.154] (-754.180) (-746.399) (-748.623) -- 0:01:23
577000 -- (-749.072) (-749.524) (-747.202) [-752.646] * (-751.894) (-743.904) [-746.623] (-750.823) -- 0:01:23
577500 -- (-757.416) (-751.877) (-746.652) [-750.845] * (-749.600) [-746.161] (-754.460) (-750.584) -- 0:01:24
578000 -- (-751.974) (-755.873) [-748.972] (-751.893) * (-749.531) [-747.025] (-744.935) (-752.677) -- 0:01:23
578500 -- (-753.469) (-759.188) [-750.583] (-751.342) * (-749.334) (-750.606) [-746.665] (-754.830) -- 0:01:23
579000 -- (-757.439) (-758.479) (-750.627) [-754.428] * (-752.658) [-750.870] (-749.091) (-756.227) -- 0:01:23
579500 -- (-753.578) (-755.966) [-755.070] (-749.077) * [-747.600] (-750.120) (-753.904) (-751.741) -- 0:01:23
580000 -- [-757.884] (-755.616) (-744.397) (-760.768) * (-751.354) [-750.771] (-750.798) (-751.853) -- 0:01:23
Average standard deviation of split frequencies: 0.007577
580500 -- (-755.487) [-751.102] (-749.590) (-750.824) * (-752.725) (-745.038) [-745.557] (-758.457) -- 0:01:23
581000 -- [-749.825] (-757.286) (-747.411) (-747.303) * (-749.626) [-746.231] (-753.175) (-750.203) -- 0:01:22
581500 -- (-748.233) (-750.177) (-749.294) [-749.847] * (-748.781) (-752.755) [-751.825] (-756.643) -- 0:01:22
582000 -- [-744.421] (-755.858) (-753.852) (-745.363) * [-744.806] (-756.940) (-751.211) (-756.225) -- 0:01:22
582500 -- (-747.020) (-755.101) (-746.684) [-746.270] * (-747.976) [-752.188] (-763.354) (-751.716) -- 0:01:23
583000 -- [-749.510] (-745.564) (-751.552) (-750.670) * (-747.751) (-759.606) (-747.518) [-750.037] -- 0:01:22
583500 -- (-751.003) [-748.300] (-750.116) (-755.784) * [-749.600] (-750.772) (-757.281) (-755.828) -- 0:01:22
584000 -- (-749.270) (-756.523) (-754.228) [-749.853] * (-755.971) (-749.405) [-756.562] (-750.491) -- 0:01:22
584500 -- (-753.707) [-756.465] (-755.073) (-758.407) * (-746.955) (-767.960) (-745.080) [-751.750] -- 0:01:22
585000 -- (-749.580) (-751.770) [-750.025] (-751.089) * (-745.299) (-754.152) [-749.376] (-748.976) -- 0:01:22
Average standard deviation of split frequencies: 0.008044
585500 -- (-758.632) (-748.409) (-745.460) [-752.780] * (-746.390) (-754.281) (-751.339) [-752.974] -- 0:01:22
586000 -- (-753.687) [-750.568] (-750.771) (-749.065) * (-750.181) [-752.979] (-752.189) (-748.720) -- 0:01:21
586500 -- (-749.688) (-754.992) [-748.398] (-754.241) * (-749.775) (-754.688) (-750.821) [-749.667] -- 0:01:21
587000 -- (-750.918) (-749.332) [-749.602] (-752.257) * (-749.714) [-750.267] (-749.411) (-747.769) -- 0:01:21
587500 -- (-751.818) (-751.715) [-748.351] (-755.190) * (-752.552) [-747.642] (-745.589) (-745.298) -- 0:01:21
588000 -- (-750.693) (-753.406) [-748.482] (-754.491) * (-762.518) (-752.139) (-752.424) [-751.685] -- 0:01:21
588500 -- [-744.830] (-749.949) (-753.014) (-747.110) * (-749.155) (-748.501) [-750.270] (-752.679) -- 0:01:21
589000 -- [-750.327] (-749.774) (-754.440) (-753.004) * [-744.962] (-754.260) (-752.003) (-754.519) -- 0:01:21
589500 -- (-750.174) (-750.926) (-751.418) [-753.276] * (-755.793) (-748.129) (-755.313) [-746.591] -- 0:01:21
590000 -- (-747.921) [-745.168] (-745.155) (-745.771) * (-754.595) (-752.764) [-752.878] (-747.272) -- 0:01:21
Average standard deviation of split frequencies: 0.008380
590500 -- (-748.332) [-745.493] (-749.181) (-749.252) * [-746.978] (-751.931) (-752.534) (-752.078) -- 0:01:21
591000 -- [-747.434] (-751.518) (-757.107) (-757.088) * (-754.098) (-749.305) [-750.725] (-749.838) -- 0:01:20
591500 -- (-746.263) [-743.292] (-752.332) (-747.401) * (-753.749) [-746.691] (-751.040) (-748.481) -- 0:01:20
592000 -- [-749.719] (-753.217) (-760.306) (-752.898) * (-747.802) (-748.226) [-749.658] (-753.211) -- 0:01:20
592500 -- (-753.651) (-750.428) [-748.700] (-747.859) * [-746.970] (-744.678) (-750.959) (-753.338) -- 0:01:20
593000 -- (-751.393) (-752.051) [-748.455] (-757.363) * (-748.306) [-744.125] (-755.627) (-749.221) -- 0:01:20
593500 -- [-751.659] (-748.590) (-751.821) (-752.871) * (-755.345) [-745.675] (-752.822) (-749.308) -- 0:01:20
594000 -- (-756.808) (-750.370) (-749.142) [-752.476] * (-749.899) (-750.942) (-749.588) [-745.056] -- 0:01:20
594500 -- (-747.389) [-755.382] (-753.010) (-757.825) * [-751.616] (-749.485) (-753.966) (-750.618) -- 0:01:20
595000 -- (-746.682) (-756.821) (-747.748) [-750.559] * (-766.230) [-756.661] (-748.864) (-750.861) -- 0:01:20
Average standard deviation of split frequencies: 0.008964
595500 -- (-752.159) (-747.793) [-751.684] (-758.566) * (-753.433) (-749.951) [-749.479] (-745.591) -- 0:01:20
596000 -- (-749.078) (-746.426) [-750.716] (-753.674) * (-750.972) (-749.738) (-748.458) [-749.884] -- 0:01:19
596500 -- (-750.625) [-751.952] (-752.118) (-753.636) * (-752.093) (-751.861) [-748.833] (-751.204) -- 0:01:19
597000 -- [-748.303] (-750.711) (-749.149) (-749.390) * [-744.234] (-743.560) (-748.741) (-752.916) -- 0:01:19
597500 -- (-755.876) [-748.583] (-749.668) (-753.874) * (-754.309) (-748.936) (-744.556) [-752.798] -- 0:01:19
598000 -- (-748.427) (-747.723) [-748.921] (-753.054) * (-747.745) (-749.947) [-756.296] (-748.310) -- 0:01:19
598500 -- (-746.558) (-751.840) [-748.864] (-750.184) * (-753.745) (-748.880) (-749.619) [-752.412] -- 0:01:19
599000 -- [-745.733] (-763.549) (-749.134) (-749.811) * (-747.540) (-765.575) [-744.965] (-749.942) -- 0:01:19
599500 -- (-750.297) [-754.556] (-755.638) (-756.368) * (-749.888) [-747.240] (-754.385) (-746.524) -- 0:01:19
600000 -- (-743.746) (-748.387) (-748.063) [-747.225] * (-751.334) (-750.795) [-752.190] (-754.358) -- 0:01:19
Average standard deviation of split frequencies: 0.009287
600500 -- (-749.992) [-749.111] (-747.732) (-745.010) * (-751.457) (-746.498) [-752.812] (-757.220) -- 0:01:19
601000 -- (-753.941) (-758.417) [-746.629] (-745.493) * (-749.262) (-751.085) [-748.159] (-753.529) -- 0:01:19
601500 -- [-748.298] (-750.631) (-751.193) (-746.642) * (-750.724) [-747.863] (-749.397) (-754.153) -- 0:01:18
602000 -- [-748.252] (-750.860) (-753.896) (-746.811) * [-747.327] (-744.310) (-754.003) (-751.761) -- 0:01:18
602500 -- (-745.149) (-752.772) (-749.586) [-742.468] * (-745.070) [-746.575] (-757.526) (-749.705) -- 0:01:18
603000 -- (-749.036) (-752.948) (-756.366) [-749.019] * (-755.962) (-750.918) [-751.163] (-747.746) -- 0:01:19
603500 -- [-750.112] (-751.982) (-747.172) (-747.757) * (-750.270) (-748.568) (-754.366) [-746.850] -- 0:01:18
604000 -- (-753.984) (-751.318) [-752.602] (-758.556) * (-751.103) (-751.342) [-752.310] (-750.530) -- 0:01:18
604500 -- [-751.806] (-750.538) (-754.766) (-748.281) * (-745.978) (-745.416) [-747.024] (-749.716) -- 0:01:18
605000 -- (-755.296) [-751.814] (-748.212) (-742.709) * (-746.835) (-745.714) [-761.635] (-756.249) -- 0:01:18
Average standard deviation of split frequencies: 0.009464
605500 -- (-745.484) (-749.214) [-754.936] (-746.196) * [-757.140] (-749.856) (-755.171) (-753.537) -- 0:01:18
606000 -- (-749.944) (-752.335) [-746.813] (-748.620) * (-761.078) [-746.092] (-752.526) (-748.174) -- 0:01:18
606500 -- (-745.169) (-744.916) (-761.685) [-747.509] * (-755.018) [-748.757] (-760.140) (-753.007) -- 0:01:17
607000 -- (-751.553) [-744.452] (-757.600) (-747.804) * (-749.160) [-745.115] (-748.260) (-745.561) -- 0:01:17
607500 -- (-750.666) (-745.172) (-746.989) [-756.445] * (-752.125) [-745.325] (-754.543) (-749.556) -- 0:01:17
608000 -- (-752.942) (-755.198) (-747.882) [-751.732] * (-750.316) (-754.886) (-767.155) [-745.935] -- 0:01:17
608500 -- [-750.477] (-750.128) (-750.329) (-747.994) * [-755.364] (-753.160) (-754.655) (-751.919) -- 0:01:17
609000 -- (-754.790) [-746.463] (-750.746) (-757.986) * (-753.949) [-749.332] (-747.216) (-756.908) -- 0:01:17
609500 -- [-750.348] (-746.213) (-758.552) (-751.930) * [-748.826] (-741.265) (-756.753) (-752.058) -- 0:01:17
610000 -- (-751.047) (-746.271) (-752.625) [-752.553] * (-742.349) [-744.293] (-755.168) (-745.982) -- 0:01:17
Average standard deviation of split frequencies: 0.009006
610500 -- (-755.895) (-749.075) (-746.298) [-751.698] * (-750.332) (-748.897) (-754.817) [-746.544] -- 0:01:17
611000 -- (-749.138) [-746.331] (-747.096) (-750.407) * (-755.198) [-752.234] (-747.919) (-749.267) -- 0:01:17
611500 -- [-746.307] (-750.106) (-752.832) (-754.525) * (-753.499) [-746.253] (-746.952) (-750.811) -- 0:01:16
612000 -- [-750.696] (-744.833) (-752.856) (-753.777) * (-744.995) (-746.992) [-750.569] (-756.209) -- 0:01:16
612500 -- (-748.269) (-752.101) [-752.489] (-752.004) * [-746.232] (-756.163) (-754.139) (-747.044) -- 0:01:16
613000 -- (-749.935) (-744.246) [-750.432] (-752.182) * (-754.587) (-752.341) [-749.416] (-749.369) -- 0:01:16
613500 -- (-749.635) (-757.183) (-745.547) [-748.502] * (-751.120) (-752.309) (-747.233) [-749.366] -- 0:01:16
614000 -- (-753.326) (-747.652) [-751.245] (-755.524) * (-759.732) [-755.812] (-749.284) (-750.144) -- 0:01:16
614500 -- (-754.643) (-747.140) [-746.085] (-758.305) * (-749.881) [-746.673] (-750.825) (-748.464) -- 0:01:16
615000 -- [-746.872] (-751.431) (-754.967) (-747.730) * (-759.819) (-744.870) (-748.615) [-745.733] -- 0:01:16
Average standard deviation of split frequencies: 0.008673
615500 -- (-750.247) [-750.387] (-752.354) (-748.172) * (-751.635) (-755.940) (-748.904) [-745.459] -- 0:01:16
616000 -- [-746.789] (-755.261) (-754.898) (-749.778) * (-749.471) (-753.877) [-747.769] (-745.398) -- 0:01:16
616500 -- [-746.303] (-756.812) (-746.488) (-748.461) * (-750.070) [-754.157] (-749.636) (-747.465) -- 0:01:15
617000 -- [-747.380] (-752.384) (-746.160) (-747.036) * (-747.946) (-755.663) [-745.191] (-754.241) -- 0:01:15
617500 -- [-749.404] (-746.818) (-749.745) (-748.217) * (-753.732) (-747.696) [-745.637] (-749.021) -- 0:01:15
618000 -- (-760.496) [-746.879] (-743.392) (-745.615) * [-748.265] (-746.535) (-752.513) (-751.694) -- 0:01:15
618500 -- (-760.639) [-750.153] (-744.748) (-749.204) * (-760.337) [-743.946] (-753.439) (-746.484) -- 0:01:15
619000 -- (-752.774) (-760.458) [-752.824] (-758.273) * (-750.380) (-748.869) [-748.304] (-744.563) -- 0:01:15
619500 -- [-756.200] (-753.580) (-752.933) (-753.510) * (-749.291) (-749.761) [-751.280] (-749.625) -- 0:01:15
620000 -- (-751.723) (-753.374) (-747.216) [-745.345] * (-746.915) (-748.617) [-746.688] (-762.376) -- 0:01:15
Average standard deviation of split frequencies: 0.008608
620500 -- (-749.952) (-760.089) (-747.380) [-751.579] * (-744.149) (-748.740) (-752.498) [-752.710] -- 0:01:15
621000 -- (-747.222) (-748.671) (-752.171) [-745.858] * [-748.018] (-742.934) (-747.853) (-749.412) -- 0:01:15
621500 -- (-752.070) (-749.742) (-748.227) [-745.521] * [-749.826] (-748.200) (-763.449) (-748.363) -- 0:01:14
622000 -- (-753.018) (-748.215) [-750.530] (-750.096) * (-744.744) [-752.125] (-753.564) (-753.615) -- 0:01:14
622500 -- [-748.810] (-748.309) (-749.451) (-745.574) * [-749.199] (-752.890) (-754.856) (-751.150) -- 0:01:14
623000 -- (-750.756) (-746.934) [-750.166] (-746.515) * (-748.812) (-746.522) [-754.553] (-760.124) -- 0:01:14
623500 -- (-757.465) (-756.035) (-748.454) [-748.876] * (-755.615) [-754.105] (-759.242) (-755.683) -- 0:01:14
624000 -- (-749.646) (-749.744) [-744.569] (-752.568) * (-759.144) [-750.773] (-750.111) (-754.540) -- 0:01:14
624500 -- (-748.447) (-750.320) (-750.830) [-746.036] * (-753.284) (-749.687) [-753.935] (-752.727) -- 0:01:14
625000 -- (-754.181) (-746.602) [-745.735] (-748.283) * (-751.947) [-743.484] (-756.886) (-754.148) -- 0:01:14
Average standard deviation of split frequencies: 0.007907
625500 -- (-751.040) (-748.984) [-744.361] (-747.918) * (-748.233) (-752.149) (-754.137) [-751.242] -- 0:01:14
626000 -- (-750.758) (-749.497) (-759.236) [-743.758] * (-753.188) (-752.509) (-758.282) [-746.004] -- 0:01:14
626500 -- (-749.600) (-761.953) [-746.208] (-745.787) * (-750.535) (-745.048) (-758.908) [-749.551] -- 0:01:13
627000 -- (-750.274) (-752.725) (-754.680) [-745.481] * (-747.253) (-755.003) [-752.260] (-753.315) -- 0:01:13
627500 -- (-747.402) (-757.287) (-755.064) [-754.487] * (-747.951) (-748.848) (-751.578) [-748.065] -- 0:01:13
628000 -- (-754.107) (-753.255) [-752.243] (-767.446) * (-748.974) (-748.522) (-752.154) [-751.319] -- 0:01:13
628500 -- (-745.480) [-748.457] (-749.251) (-749.694) * (-742.894) (-748.498) (-755.267) [-747.032] -- 0:01:13
629000 -- [-749.404] (-751.028) (-750.005) (-749.983) * [-747.326] (-763.188) (-760.277) (-746.861) -- 0:01:13
629500 -- (-755.014) [-748.999] (-750.305) (-751.299) * (-753.235) (-749.118) (-755.238) [-749.529] -- 0:01:13
630000 -- [-758.166] (-748.364) (-752.717) (-749.306) * (-752.183) (-747.182) [-755.945] (-755.723) -- 0:01:13
Average standard deviation of split frequencies: 0.008098
630500 -- (-746.002) [-745.379] (-749.164) (-745.971) * (-746.434) [-748.162] (-757.186) (-747.480) -- 0:01:13
631000 -- (-751.519) [-750.545] (-753.091) (-753.592) * (-748.010) (-745.667) (-755.958) [-749.648] -- 0:01:13
631500 -- [-749.551] (-757.623) (-752.427) (-748.681) * (-752.877) (-750.528) (-750.652) [-748.277] -- 0:01:12
632000 -- (-746.471) (-758.545) (-750.775) [-746.977] * [-749.583] (-748.146) (-752.447) (-746.594) -- 0:01:12
632500 -- (-745.808) (-749.490) (-749.532) [-747.265] * (-750.758) (-750.529) (-758.085) [-746.387] -- 0:01:12
633000 -- [-744.116] (-765.446) (-746.533) (-749.223) * [-746.868] (-748.648) (-752.080) (-750.157) -- 0:01:12
633500 -- (-748.397) (-754.372) [-747.863] (-753.096) * (-754.235) [-749.495] (-753.014) (-751.782) -- 0:01:12
634000 -- (-746.962) [-749.262] (-750.754) (-752.398) * (-755.554) [-752.364] (-756.284) (-751.919) -- 0:01:12
634500 -- (-751.803) (-750.984) [-751.970] (-749.638) * (-746.812) [-755.563] (-750.007) (-749.798) -- 0:01:12
635000 -- (-748.770) (-750.028) [-749.649] (-747.762) * (-751.958) [-748.318] (-750.340) (-747.347) -- 0:01:12
Average standard deviation of split frequencies: 0.007659
635500 -- [-747.178] (-751.238) (-759.587) (-755.108) * [-751.543] (-754.426) (-761.441) (-758.004) -- 0:01:12
636000 -- (-745.014) (-755.766) [-747.233] (-762.024) * [-750.471] (-749.905) (-749.115) (-747.776) -- 0:01:12
636500 -- (-748.822) (-749.209) (-756.281) [-748.667] * (-746.827) (-748.691) (-754.611) [-747.814] -- 0:01:11
637000 -- [-746.488] (-749.887) (-744.609) (-747.181) * [-747.628] (-743.163) (-744.253) (-748.407) -- 0:01:11
637500 -- (-749.131) (-748.404) [-748.844] (-753.123) * (-750.620) (-752.721) (-756.435) [-746.293] -- 0:01:11
638000 -- (-746.801) (-749.701) (-748.272) [-747.603] * (-748.598) (-753.109) (-759.514) [-751.111] -- 0:01:11
638500 -- (-748.821) (-764.290) (-749.860) [-742.990] * [-744.686] (-750.899) (-755.094) (-749.475) -- 0:01:11
639000 -- (-748.260) (-749.494) (-748.768) [-747.876] * (-746.725) (-750.716) [-748.522] (-745.239) -- 0:01:11
639500 -- (-750.515) (-746.143) (-753.084) [-743.669] * [-753.551] (-750.523) (-749.305) (-751.646) -- 0:01:11
640000 -- (-751.559) (-748.176) (-752.869) [-746.499] * (-745.822) [-747.629] (-745.309) (-745.523) -- 0:01:11
Average standard deviation of split frequencies: 0.007481
640500 -- [-749.998] (-747.359) (-754.176) (-744.254) * (-756.984) (-747.767) [-750.146] (-749.243) -- 0:01:11
641000 -- [-749.716] (-749.998) (-744.379) (-749.867) * (-748.495) (-749.066) (-748.803) [-746.515] -- 0:01:11
641500 -- (-754.451) (-753.188) (-748.838) [-751.891] * (-748.597) (-751.213) [-746.690] (-751.589) -- 0:01:10
642000 -- [-748.791] (-750.129) (-749.562) (-747.792) * (-752.287) (-755.456) [-747.378] (-758.862) -- 0:01:10
642500 -- (-753.740) (-750.625) [-743.979] (-747.321) * [-746.720] (-749.064) (-747.720) (-743.217) -- 0:01:10
643000 -- (-746.704) (-750.118) (-746.616) [-747.269] * (-742.721) (-748.012) [-748.754] (-752.190) -- 0:01:10
643500 -- (-754.464) (-748.430) (-746.869) [-746.377] * [-750.599] (-751.343) (-757.236) (-749.050) -- 0:01:10
644000 -- (-747.887) [-744.450] (-745.740) (-758.158) * (-743.399) (-749.664) (-754.796) [-745.144] -- 0:01:10
644500 -- (-747.995) [-746.378] (-749.587) (-753.490) * (-746.839) (-750.364) (-754.003) [-746.895] -- 0:01:10
645000 -- (-761.109) (-744.044) [-748.247] (-752.560) * (-749.330) [-744.738] (-749.788) (-750.614) -- 0:01:10
Average standard deviation of split frequencies: 0.007419
645500 -- (-758.575) [-744.947] (-750.085) (-753.928) * [-748.011] (-753.468) (-745.364) (-752.128) -- 0:01:10
646000 -- (-754.846) (-752.080) [-756.728] (-750.817) * (-755.966) [-747.917] (-753.450) (-749.123) -- 0:01:10
646500 -- (-749.366) [-749.313] (-750.494) (-752.767) * (-751.730) [-749.205] (-753.992) (-752.185) -- 0:01:09
647000 -- [-752.008] (-753.033) (-749.384) (-762.136) * (-746.138) [-751.292] (-750.129) (-757.507) -- 0:01:09
647500 -- (-749.230) [-745.574] (-755.957) (-754.081) * (-749.960) [-749.032] (-747.273) (-751.244) -- 0:01:09
648000 -- (-746.891) [-749.084] (-751.470) (-758.645) * [-743.942] (-752.231) (-752.541) (-754.899) -- 0:01:09
648500 -- [-751.504] (-748.240) (-751.659) (-764.330) * (-750.921) [-744.129] (-751.284) (-749.217) -- 0:01:09
649000 -- [-750.140] (-753.358) (-753.883) (-751.588) * [-747.155] (-751.279) (-750.708) (-756.252) -- 0:01:09
649500 -- (-754.140) [-750.984] (-752.005) (-761.707) * (-753.541) (-749.829) (-747.882) [-748.658] -- 0:01:09
650000 -- [-749.424] (-750.877) (-752.270) (-749.474) * (-747.117) (-749.867) (-744.987) [-745.487] -- 0:01:09
Average standard deviation of split frequencies: 0.008815
650500 -- (-754.577) [-749.245] (-755.567) (-746.897) * (-748.835) (-750.354) [-747.597] (-748.761) -- 0:01:09
651000 -- (-749.557) (-754.891) (-747.871) [-752.136] * (-747.296) [-748.999] (-749.301) (-747.348) -- 0:01:09
651500 -- (-751.676) (-750.287) (-751.243) [-750.018] * (-750.205) [-744.064] (-745.789) (-749.862) -- 0:01:09
652000 -- (-748.626) [-748.833] (-751.291) (-748.945) * [-745.017] (-751.360) (-749.313) (-753.423) -- 0:01:08
652500 -- (-750.163) (-749.396) (-755.215) [-746.038] * [-748.629] (-748.618) (-746.450) (-751.247) -- 0:01:08
653000 -- (-751.400) (-749.510) [-745.149] (-747.430) * [-753.072] (-757.682) (-748.556) (-758.244) -- 0:01:08
653500 -- [-750.024] (-752.121) (-749.641) (-750.451) * (-755.950) (-751.770) (-753.144) [-751.731] -- 0:01:08
654000 -- (-752.989) (-747.695) [-746.039] (-746.413) * [-749.576] (-749.598) (-749.825) (-749.401) -- 0:01:08
654500 -- (-749.967) (-749.438) (-748.605) [-745.891] * (-750.996) [-749.579] (-752.754) (-753.902) -- 0:01:08
655000 -- (-755.697) [-753.496] (-747.245) (-748.337) * (-755.230) (-747.766) (-753.673) [-746.327] -- 0:01:08
Average standard deviation of split frequencies: 0.008623
655500 -- (-747.850) (-753.056) [-749.538] (-746.000) * (-754.038) (-748.496) [-754.745] (-747.695) -- 0:01:08
656000 -- (-753.494) (-756.350) (-758.834) [-746.321] * (-750.842) (-748.160) (-751.280) [-745.222] -- 0:01:08
656500 -- [-750.685] (-750.702) (-751.757) (-752.110) * (-747.287) [-756.747] (-761.958) (-750.103) -- 0:01:08
657000 -- [-751.144] (-768.205) (-754.800) (-754.156) * [-750.295] (-756.021) (-750.783) (-754.054) -- 0:01:07
657500 -- (-745.776) [-750.567] (-749.662) (-747.460) * (-745.891) (-752.193) [-747.302] (-745.527) -- 0:01:07
658000 -- (-749.595) (-744.484) [-753.345] (-755.238) * (-752.788) [-753.863] (-752.704) (-749.951) -- 0:01:07
658500 -- (-750.384) [-744.106] (-751.973) (-745.762) * (-754.956) (-755.998) (-750.891) [-743.914] -- 0:01:07
659000 -- [-749.510] (-746.999) (-752.665) (-747.333) * (-749.007) (-750.115) (-758.047) [-742.895] -- 0:01:07
659500 -- (-748.039) (-749.680) [-754.305] (-743.915) * (-747.748) [-754.054] (-746.372) (-749.144) -- 0:01:07
660000 -- (-751.049) (-757.397) (-752.072) [-745.644] * (-751.886) [-744.251] (-749.657) (-750.289) -- 0:01:07
Average standard deviation of split frequencies: 0.008443
660500 -- (-748.092) (-753.977) (-745.116) [-751.147] * (-753.266) (-755.172) [-754.592] (-746.580) -- 0:01:07
661000 -- (-757.491) (-745.994) [-752.326] (-763.487) * (-748.989) [-743.861] (-754.299) (-755.161) -- 0:01:07
661500 -- (-751.116) (-748.406) [-749.514] (-749.256) * (-753.065) (-753.983) [-748.665] (-752.899) -- 0:01:07
662000 -- [-745.414] (-754.316) (-746.854) (-753.620) * (-753.877) (-746.774) (-750.573) [-746.541] -- 0:01:06
662500 -- (-747.278) (-748.852) (-752.483) [-750.569] * (-746.950) (-757.918) (-747.111) [-747.962] -- 0:01:06
663000 -- [-749.618] (-747.861) (-755.945) (-765.247) * (-757.168) (-757.248) [-745.914] (-752.222) -- 0:01:06
663500 -- (-748.281) (-745.625) [-755.150] (-743.683) * (-747.976) [-747.854] (-752.526) (-751.405) -- 0:01:06
664000 -- (-754.442) (-752.447) (-751.821) [-751.735] * [-741.964] (-751.078) (-757.024) (-749.895) -- 0:01:06
664500 -- (-750.220) (-744.777) (-750.492) [-746.879] * (-749.024) [-749.083] (-748.092) (-747.386) -- 0:01:06
665000 -- [-751.409] (-749.122) (-745.650) (-749.816) * (-747.804) (-750.548) [-742.576] (-746.345) -- 0:01:06
Average standard deviation of split frequencies: 0.008966
665500 -- [-754.075] (-758.755) (-749.181) (-746.696) * (-747.701) (-746.622) [-751.497] (-749.699) -- 0:01:06
666000 -- [-747.656] (-747.936) (-751.228) (-746.915) * (-751.282) [-749.488] (-748.546) (-747.689) -- 0:01:06
666500 -- (-745.388) (-754.422) (-745.084) [-752.023] * (-755.215) (-746.037) (-749.144) [-746.732] -- 0:01:06
667000 -- (-752.003) (-751.881) [-746.976] (-748.745) * [-748.620] (-756.275) (-753.400) (-745.744) -- 0:01:05
667500 -- (-746.395) (-748.093) [-755.751] (-749.874) * (-757.402) (-748.450) (-745.432) [-746.054] -- 0:01:05
668000 -- [-746.524] (-750.477) (-746.580) (-754.469) * (-753.830) [-750.137] (-750.255) (-757.284) -- 0:01:05
668500 -- (-747.513) [-750.257] (-746.207) (-755.940) * (-751.198) (-750.588) (-749.900) [-750.299] -- 0:01:05
669000 -- (-751.623) (-747.804) (-759.399) [-745.259] * (-750.386) (-752.819) (-753.472) [-744.590] -- 0:01:05
669500 -- (-760.418) (-748.564) (-751.495) [-755.501] * [-755.445] (-750.728) (-757.017) (-743.823) -- 0:01:05
670000 -- (-753.670) [-745.438] (-755.722) (-747.987) * (-753.603) [-750.654] (-755.265) (-744.068) -- 0:01:05
Average standard deviation of split frequencies: 0.008435
670500 -- (-757.676) (-748.005) [-744.432] (-751.800) * (-752.625) (-750.629) (-757.971) [-744.522] -- 0:01:05
671000 -- (-756.168) (-750.419) (-750.490) [-752.052] * (-752.845) (-749.869) (-747.345) [-751.042] -- 0:01:05
671500 -- (-741.129) (-746.458) [-748.564] (-741.232) * [-750.958] (-747.951) (-746.932) (-756.375) -- 0:01:05
672000 -- (-747.101) (-750.090) [-744.582] (-751.472) * (-751.467) [-746.428] (-754.072) (-747.721) -- 0:01:04
672500 -- [-745.928] (-748.968) (-745.018) (-750.841) * [-747.078] (-743.329) (-747.278) (-751.125) -- 0:01:04
673000 -- (-748.139) [-749.262] (-761.426) (-760.445) * [-750.262] (-746.378) (-754.662) (-742.909) -- 0:01:04
673500 -- (-746.057) (-747.992) [-750.516] (-752.533) * [-744.996] (-756.453) (-748.496) (-752.081) -- 0:01:04
674000 -- (-756.477) [-744.306] (-750.415) (-754.174) * (-752.670) (-758.638) (-752.848) [-746.142] -- 0:01:04
674500 -- (-752.385) [-747.925] (-748.953) (-756.162) * (-754.956) (-752.302) (-746.735) [-745.734] -- 0:01:04
675000 -- [-748.127] (-746.005) (-749.221) (-750.268) * (-751.563) [-749.005] (-756.622) (-751.055) -- 0:01:04
Average standard deviation of split frequencies: 0.007903
675500 -- (-751.002) [-750.956] (-747.505) (-749.572) * [-750.300] (-749.679) (-743.125) (-759.979) -- 0:01:04
676000 -- [-745.137] (-744.856) (-748.458) (-753.787) * [-749.019] (-753.405) (-742.762) (-751.783) -- 0:01:04
676500 -- (-755.860) [-747.533] (-750.713) (-754.584) * (-747.940) (-754.870) (-748.863) [-752.385] -- 0:01:04
677000 -- (-748.265) (-751.145) (-747.351) [-749.735] * [-748.951] (-744.643) (-744.295) (-754.067) -- 0:01:03
677500 -- (-745.804) (-747.079) (-749.865) [-751.892] * [-745.870] (-746.033) (-744.642) (-758.351) -- 0:01:03
678000 -- (-748.007) (-752.364) [-748.545] (-749.800) * [-754.719] (-758.640) (-751.348) (-750.148) -- 0:01:03
678500 -- [-747.813] (-744.774) (-751.549) (-746.509) * (-752.240) (-746.439) (-756.905) [-750.703] -- 0:01:03
679000 -- (-748.091) (-742.726) (-750.907) [-747.969] * [-747.988] (-763.508) (-749.459) (-754.092) -- 0:01:03
679500 -- [-747.670] (-752.981) (-748.040) (-744.893) * (-748.086) (-745.246) (-753.610) [-744.277] -- 0:01:03
680000 -- [-745.215] (-756.581) (-752.627) (-753.247) * [-744.616] (-748.642) (-747.484) (-744.686) -- 0:01:03
Average standard deviation of split frequencies: 0.006579
680500 -- (-747.944) (-753.251) (-747.161) [-749.314] * (-746.521) (-751.632) (-749.207) [-750.539] -- 0:01:03
681000 -- [-746.532] (-751.163) (-747.146) (-746.097) * (-751.421) [-756.831] (-748.658) (-755.446) -- 0:01:03
681500 -- (-755.129) [-751.498] (-750.689) (-757.583) * (-749.646) [-745.307] (-751.349) (-749.858) -- 0:01:03
682000 -- [-749.043] (-755.208) (-749.360) (-748.966) * (-745.448) [-745.704] (-750.675) (-754.264) -- 0:01:02
682500 -- (-750.358) (-745.924) [-747.966] (-754.372) * (-753.026) (-750.598) (-751.525) [-749.958] -- 0:01:02
683000 -- (-756.499) (-745.738) [-749.617] (-745.758) * (-749.815) (-751.201) [-745.842] (-746.201) -- 0:01:02
683500 -- (-757.199) (-750.456) [-743.277] (-746.906) * (-749.360) [-747.849] (-751.326) (-760.133) -- 0:01:02
684000 -- (-757.634) (-747.641) (-747.784) [-745.116] * (-755.596) (-747.026) [-746.956] (-750.964) -- 0:01:02
684500 -- (-748.896) (-752.710) (-742.972) [-755.598] * (-748.756) (-762.006) [-744.309] (-754.166) -- 0:01:02
685000 -- (-752.973) [-744.810] (-748.374) (-746.995) * (-747.861) (-754.130) [-746.207] (-752.052) -- 0:01:02
Average standard deviation of split frequencies: 0.006872
685500 -- (-753.306) (-755.370) [-748.757] (-759.274) * (-757.538) [-746.838] (-750.767) (-754.060) -- 0:01:02
686000 -- [-746.804] (-746.131) (-749.480) (-759.893) * (-756.800) (-752.064) (-751.531) [-748.065] -- 0:01:02
686500 -- (-746.440) [-748.363] (-755.014) (-754.119) * (-753.343) [-750.707] (-746.604) (-750.547) -- 0:01:02
687000 -- (-746.987) (-751.137) (-745.549) [-748.386] * (-748.542) (-746.710) (-750.218) [-748.966] -- 0:01:01
687500 -- (-744.534) [-753.759] (-748.251) (-759.765) * [-749.695] (-750.842) (-752.890) (-745.689) -- 0:01:01
688000 -- [-744.815] (-753.648) (-753.198) (-747.072) * (-753.303) (-752.896) [-748.256] (-743.237) -- 0:01:01
688500 -- (-749.045) [-750.855] (-757.411) (-750.888) * (-749.218) (-745.950) (-754.246) [-743.781] -- 0:01:01
689000 -- (-752.487) (-750.146) (-748.666) [-753.706] * (-746.964) (-751.457) (-748.439) [-753.884] -- 0:01:01
689500 -- (-753.444) (-747.990) (-755.161) [-751.436] * (-747.168) (-747.460) (-752.708) [-752.858] -- 0:01:01
690000 -- [-753.702] (-752.267) (-745.820) (-758.095) * (-746.112) (-743.981) [-749.628] (-748.818) -- 0:01:01
Average standard deviation of split frequencies: 0.006257
690500 -- (-753.874) (-754.914) (-749.140) [-751.813] * (-752.720) (-751.818) [-748.486] (-747.865) -- 0:01:01
691000 -- (-745.713) (-751.659) [-753.127] (-756.344) * (-747.459) (-746.769) [-750.569] (-748.209) -- 0:01:01
691500 -- [-747.130] (-753.661) (-754.680) (-750.997) * (-749.748) (-746.946) (-755.679) [-748.350] -- 0:01:01
692000 -- (-749.681) [-750.178] (-749.553) (-748.626) * (-751.090) (-752.033) (-751.788) [-747.820] -- 0:01:00
692500 -- (-759.340) (-751.366) (-752.029) [-749.404] * (-745.367) (-750.871) [-747.991] (-748.085) -- 0:01:00
693000 -- (-747.901) [-754.558] (-748.059) (-747.226) * [-752.100] (-754.559) (-761.636) (-744.766) -- 0:01:00
693500 -- (-751.720) (-753.718) (-753.607) [-748.944] * (-752.032) (-754.235) (-748.794) [-746.927] -- 0:01:00
694000 -- (-752.053) (-748.793) (-748.231) [-746.456] * (-757.287) [-748.329] (-759.845) (-753.561) -- 0:01:00
694500 -- (-751.643) (-757.158) (-750.466) [-750.374] * (-750.136) (-747.976) (-754.201) [-748.071] -- 0:01:00
695000 -- [-746.084] (-747.531) (-750.465) (-758.046) * (-748.858) (-755.168) [-750.786] (-749.574) -- 0:01:00
Average standard deviation of split frequencies: 0.006322
695500 -- (-755.316) [-745.319] (-748.140) (-756.181) * (-753.001) [-750.758] (-749.679) (-745.887) -- 0:01:00
696000 -- (-747.690) [-758.601] (-750.156) (-753.205) * (-752.471) (-749.189) (-756.167) [-744.431] -- 0:01:00
696500 -- (-752.928) (-748.299) (-749.045) [-761.459] * (-746.263) (-753.746) [-750.143] (-747.700) -- 0:01:00
697000 -- [-756.599] (-753.501) (-751.749) (-749.672) * (-752.701) (-757.254) (-752.162) [-745.315] -- 0:00:59
697500 -- [-747.811] (-755.115) (-745.175) (-749.494) * (-753.255) (-745.580) (-752.708) [-744.982] -- 0:00:59
698000 -- [-741.602] (-752.176) (-746.945) (-755.453) * [-751.188] (-748.955) (-752.628) (-752.020) -- 0:00:59
698500 -- (-747.924) (-750.872) (-748.146) [-752.375] * [-748.081] (-746.958) (-757.192) (-748.017) -- 0:00:59
699000 -- [-747.968] (-751.259) (-745.753) (-751.405) * (-751.776) [-744.741] (-753.070) (-749.595) -- 0:00:59
699500 -- (-752.226) [-749.803] (-750.463) (-752.119) * [-746.750] (-750.019) (-746.254) (-750.171) -- 0:00:59
700000 -- (-746.211) [-750.980] (-752.092) (-753.240) * [-744.738] (-748.393) (-749.604) (-752.159) -- 0:00:59
Average standard deviation of split frequencies: 0.006392
700500 -- [-749.642] (-756.342) (-749.902) (-757.306) * (-749.595) (-746.721) [-749.692] (-751.589) -- 0:00:59
701000 -- (-752.144) (-750.176) [-745.256] (-752.683) * (-752.295) [-748.978] (-751.258) (-748.813) -- 0:00:59
701500 -- (-753.962) (-746.589) (-756.066) [-751.525] * [-753.166] (-747.393) (-749.858) (-753.938) -- 0:00:59
702000 -- (-756.821) (-746.626) (-750.755) [-749.417] * [-752.077] (-746.677) (-749.821) (-754.530) -- 0:00:59
702500 -- [-752.810] (-748.654) (-755.720) (-757.500) * (-750.153) [-751.652] (-750.436) (-761.482) -- 0:00:58
703000 -- (-755.413) [-750.926] (-749.942) (-745.449) * (-751.742) (-754.435) [-754.310] (-748.956) -- 0:00:58
703500 -- (-748.646) (-752.733) [-752.175] (-744.835) * (-755.997) (-746.973) (-755.745) [-755.664] -- 0:00:58
704000 -- [-753.655] (-748.820) (-744.679) (-746.687) * (-754.460) [-754.498] (-742.882) (-752.146) -- 0:00:58
704500 -- (-746.851) (-750.430) [-749.578] (-746.822) * (-753.213) [-749.905] (-755.279) (-752.215) -- 0:00:58
705000 -- (-758.188) [-750.331] (-747.948) (-753.084) * (-748.229) (-748.203) (-741.877) [-745.324] -- 0:00:58
Average standard deviation of split frequencies: 0.006455
705500 -- (-756.450) [-749.191] (-746.898) (-745.460) * (-750.342) (-752.335) [-746.456] (-751.167) -- 0:00:58
706000 -- (-751.587) [-747.831] (-749.419) (-747.766) * (-755.298) (-751.427) (-747.588) [-750.792] -- 0:00:58
706500 -- (-743.584) (-747.580) [-749.414] (-753.487) * (-747.101) (-746.260) (-751.134) [-747.568] -- 0:00:58
707000 -- (-746.036) (-749.921) (-751.947) [-748.999] * (-758.720) (-756.963) (-754.126) [-750.270] -- 0:00:58
707500 -- (-748.286) (-752.709) [-747.512] (-750.644) * (-755.378) (-748.978) (-753.876) [-746.968] -- 0:00:57
708000 -- (-750.243) (-749.151) [-751.261] (-753.401) * [-753.360] (-753.375) (-751.842) (-752.337) -- 0:00:57
708500 -- (-749.148) (-742.917) [-754.753] (-758.989) * [-747.671] (-754.045) (-757.653) (-755.620) -- 0:00:57
709000 -- [-747.283] (-748.518) (-753.453) (-753.201) * (-749.647) (-749.987) (-752.438) [-750.732] -- 0:00:57
709500 -- (-745.022) (-754.279) [-746.725] (-750.719) * (-752.484) [-752.840] (-752.149) (-747.624) -- 0:00:57
710000 -- (-749.572) [-744.245] (-753.460) (-754.111) * (-751.358) (-747.245) [-750.137] (-755.836) -- 0:00:57
Average standard deviation of split frequencies: 0.006854
710500 -- (-749.313) (-745.753) [-749.805] (-749.097) * (-746.680) (-749.224) [-750.434] (-750.330) -- 0:00:57
711000 -- (-749.651) (-743.337) (-753.394) [-747.366] * (-744.745) (-753.284) [-749.303] (-747.541) -- 0:00:57
711500 -- (-751.001) [-743.972] (-764.287) (-753.961) * (-747.725) (-750.892) [-746.692] (-748.446) -- 0:00:57
712000 -- (-748.474) (-751.009) (-747.608) [-746.460] * [-749.146] (-753.434) (-752.220) (-747.471) -- 0:00:57
712500 -- (-745.074) (-754.050) [-749.585] (-751.529) * [-748.646] (-752.190) (-753.105) (-749.926) -- 0:00:56
713000 -- (-751.990) (-748.597) (-757.638) [-749.264] * (-761.572) (-752.181) (-751.878) [-744.680] -- 0:00:56
713500 -- (-749.153) (-749.285) [-749.152] (-755.640) * (-750.320) [-751.544] (-749.151) (-748.289) -- 0:00:56
714000 -- [-747.845] (-753.288) (-748.469) (-756.531) * [-754.392] (-750.206) (-748.374) (-746.249) -- 0:00:56
714500 -- [-755.137] (-752.298) (-752.734) (-744.268) * (-753.293) (-749.895) (-751.083) [-748.749] -- 0:00:56
715000 -- [-744.311] (-758.867) (-750.216) (-745.846) * (-754.551) (-747.645) (-754.582) [-752.044] -- 0:00:56
Average standard deviation of split frequencies: 0.006474
715500 -- (-750.444) (-753.434) (-751.923) [-741.584] * (-756.477) (-748.682) (-750.102) [-750.104] -- 0:00:56
716000 -- (-746.850) (-752.646) [-744.585] (-748.122) * (-762.544) (-759.553) [-744.805] (-752.093) -- 0:00:56
716500 -- (-747.356) (-746.514) (-748.171) [-746.340] * (-753.027) (-760.922) (-744.725) [-748.756] -- 0:00:56
717000 -- (-753.692) (-748.451) [-749.885] (-750.080) * [-746.392] (-758.102) (-748.608) (-756.174) -- 0:00:56
717500 -- (-745.052) (-749.440) (-751.660) [-743.638] * (-750.100) (-755.090) (-745.857) [-750.073] -- 0:00:55
718000 -- [-747.928] (-745.817) (-753.196) (-748.794) * [-753.368] (-747.989) (-746.670) (-752.609) -- 0:00:55
718500 -- (-746.293) (-752.398) (-748.070) [-743.365] * (-753.528) [-746.101] (-751.293) (-749.597) -- 0:00:55
719000 -- (-749.795) (-761.148) (-756.026) [-749.276] * (-759.577) [-743.673] (-744.588) (-752.859) -- 0:00:55
719500 -- [-750.203] (-746.761) (-749.292) (-750.056) * (-755.155) (-750.045) (-751.611) [-749.678] -- 0:00:55
720000 -- (-759.569) (-748.231) (-744.078) [-743.934] * (-752.756) (-746.246) [-744.882] (-748.300) -- 0:00:55
Average standard deviation of split frequencies: 0.006650
720500 -- (-755.017) (-748.919) [-748.724] (-747.583) * (-753.939) (-757.074) [-750.513] (-750.760) -- 0:00:55
721000 -- (-750.829) [-745.911] (-746.992) (-754.149) * [-748.420] (-758.170) (-753.850) (-752.374) -- 0:00:55
721500 -- (-751.479) (-760.492) (-753.061) [-751.892] * [-752.928] (-750.785) (-745.965) (-758.276) -- 0:00:55
722000 -- (-756.178) (-753.496) [-745.431] (-747.386) * (-746.434) [-744.997] (-753.656) (-765.443) -- 0:00:55
722500 -- (-755.306) [-747.941] (-750.664) (-757.724) * [-744.967] (-747.861) (-751.453) (-750.613) -- 0:00:54
723000 -- (-747.178) (-749.401) [-751.389] (-753.655) * [-750.521] (-743.316) (-749.627) (-752.245) -- 0:00:54
723500 -- (-748.631) (-749.835) (-746.953) [-743.651] * (-749.736) (-745.459) [-744.629] (-746.203) -- 0:00:54
724000 -- (-748.898) (-754.898) [-747.018] (-748.026) * (-755.097) (-760.918) [-745.033] (-751.908) -- 0:00:54
724500 -- (-751.938) [-753.986] (-743.351) (-746.642) * (-754.124) (-755.546) [-746.034] (-747.623) -- 0:00:54
725000 -- [-745.984] (-751.425) (-753.484) (-753.817) * [-743.544] (-748.707) (-749.387) (-749.471) -- 0:00:54
Average standard deviation of split frequencies: 0.007142
725500 -- (-757.984) [-759.392] (-745.665) (-750.032) * (-752.679) [-755.780] (-752.964) (-754.470) -- 0:00:54
726000 -- (-752.417) (-750.980) [-746.596] (-751.983) * (-751.179) (-747.783) (-748.287) [-744.876] -- 0:00:54
726500 -- (-751.954) (-753.581) (-748.243) [-748.700] * [-753.163] (-746.034) (-754.824) (-751.805) -- 0:00:54
727000 -- [-749.595] (-748.148) (-749.436) (-753.502) * [-749.761] (-746.282) (-748.966) (-748.238) -- 0:00:54
727500 -- (-750.435) (-751.834) (-745.906) [-750.882] * (-745.978) (-752.213) (-746.818) [-753.491] -- 0:00:53
728000 -- (-747.747) (-752.763) (-747.398) [-748.992] * (-749.147) (-753.716) [-749.197] (-750.830) -- 0:00:53
728500 -- [-746.721] (-748.699) (-754.665) (-747.213) * (-744.279) (-752.993) (-747.284) [-749.836] -- 0:00:53
729000 -- (-753.458) [-749.221] (-749.789) (-746.170) * [-744.851] (-746.790) (-757.138) (-753.347) -- 0:00:53
729500 -- (-750.350) (-750.157) [-751.356] (-744.243) * (-748.159) (-746.856) [-744.319] (-765.451) -- 0:00:53
730000 -- (-750.351) (-749.807) [-746.560] (-749.177) * [-748.070] (-753.784) (-752.183) (-750.590) -- 0:00:53
Average standard deviation of split frequencies: 0.006882
730500 -- (-750.834) [-756.866] (-747.758) (-747.947) * (-751.577) [-748.482] (-748.891) (-746.202) -- 0:00:53
731000 -- [-753.308] (-750.091) (-744.825) (-757.636) * [-749.411] (-752.981) (-747.361) (-747.729) -- 0:00:53
731500 -- (-750.975) [-745.603] (-746.733) (-744.222) * [-745.323] (-750.964) (-756.332) (-747.390) -- 0:00:53
732000 -- [-753.350] (-746.842) (-755.284) (-749.115) * (-757.959) [-746.870] (-754.257) (-752.940) -- 0:00:53
732500 -- (-752.057) [-749.380] (-751.107) (-751.279) * [-751.000] (-747.281) (-751.443) (-755.772) -- 0:00:52
733000 -- (-753.404) (-752.394) [-753.834] (-749.762) * (-758.067) (-754.134) (-743.746) [-750.699] -- 0:00:52
733500 -- (-761.906) (-749.628) (-750.479) [-743.486] * [-750.728] (-750.747) (-746.829) (-752.103) -- 0:00:52
734000 -- (-749.098) (-752.164) [-748.553] (-746.116) * [-747.168] (-754.141) (-750.387) (-753.349) -- 0:00:52
734500 -- (-755.705) [-746.489] (-750.731) (-759.594) * (-748.814) (-750.427) [-745.883] (-750.308) -- 0:00:52
735000 -- (-752.522) (-753.831) [-756.696] (-759.208) * [-752.517] (-748.095) (-754.149) (-758.973) -- 0:00:52
Average standard deviation of split frequencies: 0.008006
735500 -- (-749.107) (-753.766) [-748.874] (-755.389) * (-754.176) [-749.460] (-757.452) (-749.003) -- 0:00:52
736000 -- (-756.245) (-747.971) [-749.008] (-752.550) * (-751.495) (-757.387) [-752.707] (-747.098) -- 0:00:52
736500 -- [-743.529] (-761.740) (-761.635) (-750.745) * [-751.072] (-755.323) (-750.410) (-749.884) -- 0:00:52
737000 -- (-745.362) [-747.855] (-748.899) (-757.240) * (-748.845) (-748.970) [-749.609] (-748.327) -- 0:00:52
737500 -- (-752.546) (-749.686) [-754.496] (-754.532) * (-742.954) (-747.653) (-750.201) [-750.894] -- 0:00:51
738000 -- (-754.671) (-749.497) [-750.296] (-747.436) * (-756.155) (-752.521) (-748.922) [-750.463] -- 0:00:51
738500 -- (-753.404) (-748.517) (-753.877) [-747.417] * (-748.761) [-752.448] (-745.487) (-751.801) -- 0:00:51
739000 -- (-750.174) (-747.202) (-752.145) [-750.363] * (-754.976) [-751.409] (-750.751) (-750.936) -- 0:00:51
739500 -- (-751.863) [-754.273] (-745.576) (-751.045) * (-746.060) (-751.184) (-750.853) [-750.279] -- 0:00:51
740000 -- (-745.506) (-748.020) (-750.601) [-750.883] * [-749.124] (-750.506) (-745.331) (-746.966) -- 0:00:51
Average standard deviation of split frequencies: 0.008168
740500 -- [-748.330] (-743.926) (-748.913) (-756.283) * (-757.525) (-751.839) (-752.455) [-749.394] -- 0:00:51
741000 -- [-748.030] (-759.607) (-752.601) (-750.000) * [-752.791] (-746.716) (-748.039) (-750.590) -- 0:00:51
741500 -- (-747.789) (-758.390) [-748.469] (-756.977) * [-747.277] (-751.655) (-752.838) (-750.037) -- 0:00:51
742000 -- [-752.204] (-753.976) (-752.606) (-755.855) * (-748.781) (-746.599) (-751.357) [-748.421] -- 0:00:51
742500 -- (-746.797) (-754.258) [-752.478] (-749.910) * [-749.969] (-747.826) (-752.408) (-750.339) -- 0:00:50
743000 -- (-752.417) (-745.316) [-756.660] (-751.601) * [-750.516] (-746.278) (-752.485) (-743.164) -- 0:00:50
743500 -- [-747.432] (-749.289) (-749.933) (-752.564) * (-752.799) (-746.119) (-757.052) [-745.734] -- 0:00:50
744000 -- (-749.860) [-748.604] (-751.536) (-748.117) * [-753.070] (-747.750) (-750.751) (-757.617) -- 0:00:50
744500 -- [-751.870] (-752.999) (-749.747) (-747.530) * (-750.390) (-749.233) [-759.685] (-747.105) -- 0:00:50
745000 -- (-753.225) (-758.485) [-756.966] (-752.390) * (-751.295) (-746.753) (-754.174) [-745.992] -- 0:00:50
Average standard deviation of split frequencies: 0.007794
745500 -- [-746.206] (-754.530) (-745.340) (-744.524) * (-747.193) (-746.720) (-754.390) [-754.879] -- 0:00:50
746000 -- [-756.634] (-747.795) (-752.646) (-745.986) * (-752.242) (-748.576) (-760.117) [-748.867] -- 0:00:50
746500 -- (-750.176) [-748.673] (-755.973) (-746.052) * (-755.784) (-751.945) (-742.575) [-745.077] -- 0:00:50
747000 -- (-759.073) [-744.910] (-748.163) (-753.684) * (-752.559) (-746.193) (-746.501) [-749.611] -- 0:00:50
747500 -- [-751.212] (-750.699) (-747.710) (-749.050) * (-749.689) [-745.447] (-751.367) (-752.614) -- 0:00:49
748000 -- (-747.587) [-743.838] (-752.631) (-744.919) * (-755.097) (-746.338) (-749.828) [-745.572] -- 0:00:49
748500 -- (-752.335) [-744.990] (-760.582) (-745.757) * (-751.698) (-746.659) (-750.951) [-747.426] -- 0:00:49
749000 -- (-751.162) (-751.344) (-758.989) [-747.187] * (-752.589) [-744.984] (-746.398) (-745.300) -- 0:00:49
749500 -- [-746.384] (-753.403) (-750.804) (-743.387) * (-753.861) (-750.386) [-747.891] (-750.420) -- 0:00:49
750000 -- (-755.730) (-761.331) (-752.441) [-746.290] * [-745.462] (-756.409) (-747.729) (-750.599) -- 0:00:49
Average standard deviation of split frequencies: 0.007850
750500 -- (-750.278) (-751.464) (-760.674) [-746.215] * (-753.774) (-749.199) [-746.933] (-752.668) -- 0:00:49
751000 -- (-744.098) (-754.203) (-749.359) [-742.468] * (-750.673) (-746.040) [-743.483] (-745.674) -- 0:00:49
751500 -- (-745.418) (-753.235) [-754.585] (-757.893) * (-754.937) (-749.483) [-752.043] (-752.773) -- 0:00:49
752000 -- (-753.476) (-749.866) (-758.546) [-744.878] * (-761.717) (-750.564) [-751.883] (-748.797) -- 0:00:49
752500 -- (-748.236) (-755.581) (-752.595) [-746.630] * (-756.515) [-747.483] (-747.826) (-750.199) -- 0:00:49
753000 -- [-752.769] (-754.169) (-747.294) (-746.733) * (-751.826) (-759.487) [-748.918] (-757.678) -- 0:00:48
753500 -- (-747.616) (-746.131) [-752.074] (-756.008) * [-751.713] (-758.289) (-759.060) (-749.939) -- 0:00:48
754000 -- (-750.103) (-762.059) [-745.736] (-751.648) * (-761.022) (-754.010) (-758.968) [-746.654] -- 0:00:48
754500 -- (-747.653) (-748.748) (-756.625) [-747.735] * (-751.530) (-754.267) [-751.721] (-751.411) -- 0:00:48
755000 -- (-753.411) (-750.637) [-747.324] (-749.501) * [-750.510] (-748.525) (-750.303) (-755.767) -- 0:00:48
Average standard deviation of split frequencies: 0.007171
755500 -- (-753.050) [-745.728] (-745.299) (-748.720) * (-754.363) (-750.408) (-749.116) [-750.056] -- 0:00:48
756000 -- (-750.372) (-755.103) [-745.995] (-753.436) * (-747.360) [-748.358] (-754.443) (-749.772) -- 0:00:48
756500 -- (-747.629) [-751.506] (-756.901) (-750.675) * (-751.984) [-744.996] (-750.802) (-749.987) -- 0:00:48
757000 -- (-753.838) (-752.907) [-747.163] (-753.089) * (-753.717) (-754.120) [-747.435] (-744.435) -- 0:00:48
757500 -- [-750.450] (-750.588) (-743.811) (-743.955) * (-743.625) (-751.966) (-748.298) [-756.082] -- 0:00:48
758000 -- [-749.874] (-752.193) (-756.258) (-745.581) * (-749.780) (-748.049) [-750.796] (-745.232) -- 0:00:47
758500 -- (-757.762) (-755.207) (-758.890) [-749.957] * [-746.959] (-748.377) (-761.215) (-750.339) -- 0:00:47
759000 -- [-751.758] (-754.630) (-750.158) (-753.665) * (-752.526) (-749.668) (-754.560) [-745.862] -- 0:00:47
759500 -- (-767.726) (-749.134) [-748.647] (-752.175) * [-746.103] (-751.263) (-758.722) (-750.155) -- 0:00:47
760000 -- (-754.636) [-747.973] (-755.007) (-748.274) * (-748.103) (-761.070) (-753.608) [-751.094] -- 0:00:47
Average standard deviation of split frequencies: 0.006301
760500 -- (-756.371) (-750.723) (-753.406) [-745.762] * (-748.937) [-750.180] (-751.038) (-756.299) -- 0:00:47
761000 -- (-747.165) (-749.191) [-746.033] (-752.978) * [-746.948] (-747.210) (-754.675) (-752.516) -- 0:00:47
761500 -- [-748.482] (-748.522) (-753.937) (-756.613) * (-753.754) (-749.026) [-746.567] (-748.475) -- 0:00:47
762000 -- [-749.182] (-749.131) (-762.358) (-758.528) * [-748.379] (-752.871) (-753.605) (-755.618) -- 0:00:47
762500 -- (-750.297) (-748.341) (-754.723) [-751.991] * (-747.822) (-748.224) [-745.002] (-749.742) -- 0:00:47
763000 -- (-751.779) (-752.724) [-752.065] (-747.431) * (-748.150) (-744.861) (-755.983) [-747.839] -- 0:00:46
763500 -- (-753.998) [-756.148] (-747.639) (-746.302) * (-752.827) [-752.280] (-754.712) (-750.668) -- 0:00:46
764000 -- (-744.203) [-744.432] (-751.833) (-749.190) * (-748.485) [-744.300] (-750.247) (-744.436) -- 0:00:46
764500 -- [-746.055] (-744.375) (-747.879) (-750.573) * (-754.794) (-747.559) [-756.239] (-750.542) -- 0:00:46
765000 -- (-749.235) [-747.103] (-748.835) (-751.266) * [-745.605] (-752.441) (-749.782) (-754.558) -- 0:00:46
Average standard deviation of split frequencies: 0.006667
765500 -- [-742.755] (-748.244) (-751.271) (-748.677) * (-757.536) (-750.275) [-749.356] (-749.546) -- 0:00:46
766000 -- (-745.411) [-744.586] (-752.470) (-745.443) * [-746.152] (-753.044) (-752.615) (-747.457) -- 0:00:46
766500 -- (-748.987) (-752.141) [-748.767] (-759.106) * (-750.174) [-748.324] (-751.740) (-755.703) -- 0:00:46
767000 -- [-748.931] (-754.632) (-750.096) (-746.679) * [-744.822] (-749.701) (-745.978) (-751.572) -- 0:00:46
767500 -- [-753.863] (-747.060) (-753.438) (-748.155) * [-745.495] (-756.031) (-748.668) (-748.217) -- 0:00:46
768000 -- (-755.934) [-753.333] (-748.118) (-747.181) * (-745.461) (-752.142) (-753.986) [-750.772] -- 0:00:45
768500 -- (-748.161) [-751.542] (-747.654) (-758.985) * [-748.178] (-754.910) (-754.371) (-755.451) -- 0:00:45
769000 -- (-752.438) [-751.498] (-747.404) (-752.946) * [-748.349] (-749.306) (-756.013) (-756.165) -- 0:00:45
769500 -- (-749.093) (-753.482) [-742.648] (-750.978) * (-749.452) (-755.555) (-751.260) [-752.044] -- 0:00:45
770000 -- (-745.148) (-757.046) (-762.365) [-747.171] * (-753.521) (-744.765) [-747.766] (-754.433) -- 0:00:45
Average standard deviation of split frequencies: 0.006321
770500 -- (-751.567) [-749.001] (-748.144) (-748.791) * (-752.584) [-749.941] (-762.269) (-749.021) -- 0:00:45
771000 -- (-750.175) (-752.569) (-752.127) [-748.923] * [-748.634] (-749.849) (-758.567) (-755.094) -- 0:00:45
771500 -- [-751.253] (-751.085) (-751.450) (-746.147) * (-752.204) (-751.151) (-759.946) [-745.234] -- 0:00:45
772000 -- (-753.780) (-750.214) (-747.354) [-747.409] * (-743.877) (-750.388) (-759.289) [-741.794] -- 0:00:45
772500 -- (-755.805) (-749.671) (-748.816) [-747.812] * (-751.848) (-746.745) (-761.233) [-743.796] -- 0:00:45
773000 -- (-755.819) [-747.386] (-754.050) (-742.696) * (-748.437) (-745.176) (-762.871) [-745.063] -- 0:00:44
773500 -- (-762.153) [-748.325] (-758.548) (-751.836) * (-751.217) (-748.109) (-769.553) [-748.590] -- 0:00:44
774000 -- [-757.373] (-752.079) (-750.058) (-757.386) * [-746.979] (-750.286) (-751.881) (-750.065) -- 0:00:44
774500 -- (-757.320) (-755.494) (-749.773) [-755.166] * (-747.369) [-747.099] (-756.255) (-754.353) -- 0:00:44
775000 -- (-766.240) [-753.245] (-764.597) (-755.900) * [-751.917] (-752.928) (-748.531) (-754.773) -- 0:00:44
Average standard deviation of split frequencies: 0.005670
775500 -- (-756.892) [-746.374] (-752.957) (-753.314) * (-757.232) (-749.168) (-751.048) [-748.067] -- 0:00:44
776000 -- [-749.496] (-747.591) (-756.656) (-756.234) * (-749.593) (-748.595) (-748.531) [-753.152] -- 0:00:44
776500 -- [-747.213] (-754.328) (-750.338) (-761.779) * (-750.054) (-756.798) [-747.106] (-749.519) -- 0:00:44
777000 -- (-748.575) [-759.318] (-748.169) (-751.381) * [-753.594] (-753.897) (-751.910) (-750.768) -- 0:00:44
777500 -- [-749.897] (-756.724) (-745.001) (-753.817) * (-752.869) (-757.731) (-750.331) [-745.993] -- 0:00:44
778000 -- [-745.556] (-756.424) (-748.815) (-750.536) * (-748.464) (-751.535) [-752.712] (-751.887) -- 0:00:43
778500 -- (-747.622) [-748.285] (-753.690) (-748.587) * (-746.719) (-749.881) (-751.905) [-747.026] -- 0:00:43
779000 -- (-744.947) (-751.364) [-747.840] (-750.015) * (-752.824) [-746.068] (-746.857) (-754.246) -- 0:00:43
779500 -- (-750.091) [-747.309] (-752.784) (-757.664) * [-750.473] (-747.179) (-750.672) (-748.863) -- 0:00:43
780000 -- (-751.478) (-753.530) (-758.117) [-744.227] * (-755.644) [-745.437] (-755.669) (-762.283) -- 0:00:43
Average standard deviation of split frequencies: 0.006240
780500 -- (-745.087) (-744.121) (-763.638) [-748.708] * [-751.142] (-754.640) (-744.808) (-758.475) -- 0:00:43
781000 -- (-747.349) [-747.413] (-752.667) (-747.534) * [-750.324] (-746.540) (-748.344) (-746.525) -- 0:00:43
781500 -- (-752.632) [-746.959] (-758.425) (-749.640) * (-751.636) [-745.446] (-760.640) (-752.092) -- 0:00:43
782000 -- (-751.631) (-742.067) [-755.712] (-751.797) * (-751.784) [-749.569] (-758.117) (-748.632) -- 0:00:43
782500 -- (-750.717) (-751.477) [-747.841] (-748.468) * (-752.049) [-751.702] (-753.639) (-757.151) -- 0:00:43
783000 -- [-747.908] (-746.695) (-756.105) (-752.410) * (-752.477) [-743.228] (-759.802) (-750.201) -- 0:00:42
783500 -- (-751.096) [-747.968] (-746.866) (-752.240) * (-761.226) (-753.894) (-755.564) [-751.290] -- 0:00:42
784000 -- [-754.426] (-753.493) (-748.833) (-744.076) * (-751.755) (-755.628) (-751.650) [-748.563] -- 0:00:42
784500 -- [-751.358] (-746.308) (-751.445) (-751.572) * (-750.748) (-747.197) (-749.230) [-749.376] -- 0:00:42
785000 -- (-747.477) [-749.676] (-746.023) (-750.728) * (-745.923) [-747.171] (-752.442) (-749.175) -- 0:00:42
Average standard deviation of split frequencies: 0.007197
785500 -- (-754.417) (-750.500) (-748.817) [-750.746] * (-754.669) (-748.208) [-745.307] (-751.289) -- 0:00:42
786000 -- (-759.086) (-747.460) [-747.504] (-744.776) * (-756.519) (-757.008) [-745.449] (-743.938) -- 0:00:42
786500 -- (-746.055) (-753.224) [-750.152] (-751.687) * [-754.171] (-761.395) (-745.817) (-743.855) -- 0:00:42
787000 -- (-751.516) [-746.265] (-756.639) (-744.726) * (-749.092) [-751.404] (-746.959) (-749.270) -- 0:00:42
787500 -- [-752.993] (-758.005) (-753.397) (-751.071) * (-751.774) (-746.379) (-748.604) [-748.248] -- 0:00:42
788000 -- [-751.673] (-748.389) (-746.336) (-750.809) * (-750.366) [-752.162] (-748.607) (-753.897) -- 0:00:41
788500 -- (-750.728) (-745.327) [-754.663] (-750.055) * (-750.009) (-750.929) (-752.796) [-746.795] -- 0:00:41
789000 -- (-747.799) [-750.508] (-757.028) (-751.990) * [-754.365] (-750.798) (-753.097) (-747.375) -- 0:00:41
789500 -- (-754.040) (-750.742) [-749.761] (-745.486) * [-749.578] (-763.085) (-760.989) (-755.250) -- 0:00:41
790000 -- [-750.239] (-750.182) (-751.728) (-753.000) * (-748.721) (-751.179) [-756.155] (-753.262) -- 0:00:41
Average standard deviation of split frequencies: 0.007055
790500 -- (-744.048) (-753.820) [-746.748] (-750.864) * [-755.240] (-748.187) (-752.185) (-763.040) -- 0:00:41
791000 -- (-747.576) [-746.599] (-746.492) (-747.360) * (-752.408) (-754.059) [-746.842] (-756.991) -- 0:00:41
791500 -- (-749.360) [-745.880] (-750.094) (-749.683) * [-750.063] (-749.315) (-748.321) (-754.343) -- 0:00:41
792000 -- (-748.073) (-751.369) [-746.808] (-757.296) * (-758.775) [-745.900] (-746.980) (-751.520) -- 0:00:41
792500 -- (-749.779) [-742.364] (-751.361) (-750.378) * (-755.166) (-746.184) (-742.699) [-748.513] -- 0:00:41
793000 -- [-748.197] (-745.004) (-755.445) (-746.907) * (-753.126) (-746.647) (-752.813) [-743.456] -- 0:00:40
793500 -- (-748.807) (-748.729) (-755.737) [-746.811] * (-742.668) (-750.313) (-744.489) [-748.772] -- 0:00:40
794000 -- (-753.688) [-742.118] (-747.276) (-760.557) * (-747.315) (-748.520) [-748.197] (-754.147) -- 0:00:40
794500 -- [-749.300] (-749.400) (-753.489) (-755.944) * [-748.280] (-762.893) (-748.213) (-749.094) -- 0:00:40
795000 -- (-750.434) [-746.738] (-752.184) (-755.084) * (-753.131) [-757.802] (-742.662) (-751.378) -- 0:00:40
Average standard deviation of split frequencies: 0.006416
795500 -- [-750.068] (-754.732) (-753.199) (-746.137) * (-754.847) (-743.377) (-746.058) [-747.967] -- 0:00:40
796000 -- (-750.918) [-746.519] (-749.899) (-758.383) * (-748.446) (-748.588) [-744.900] (-746.307) -- 0:00:40
796500 -- (-758.579) (-747.331) [-750.344] (-752.790) * [-750.951] (-746.632) (-745.845) (-747.686) -- 0:00:40
797000 -- (-754.574) (-754.342) [-744.921] (-752.035) * (-748.871) (-751.500) (-749.374) [-750.319] -- 0:00:40
797500 -- (-754.575) (-753.613) [-750.547] (-751.440) * (-746.725) [-752.107] (-743.660) (-750.520) -- 0:00:40
798000 -- (-748.102) [-749.364] (-746.799) (-744.508) * [-747.194] (-750.244) (-750.931) (-749.614) -- 0:00:39
798500 -- (-755.756) (-751.847) (-759.348) [-748.875] * (-754.082) (-757.207) [-744.400] (-751.009) -- 0:00:39
799000 -- (-751.977) [-742.902] (-748.370) (-751.937) * (-745.674) (-756.906) [-743.567] (-749.422) -- 0:00:39
799500 -- (-748.126) [-745.164] (-755.491) (-748.799) * (-749.355) (-750.182) [-748.602] (-752.474) -- 0:00:39
800000 -- (-750.000) (-756.251) (-752.403) [-747.438] * (-748.995) [-751.226] (-745.586) (-743.920) -- 0:00:39
Average standard deviation of split frequencies: 0.005103
800500 -- (-748.362) (-743.273) [-751.688] (-754.530) * (-750.246) (-759.377) [-747.080] (-751.068) -- 0:00:39
801000 -- (-751.070) (-753.997) [-744.671] (-750.921) * (-750.065) (-768.413) [-745.088] (-752.146) -- 0:00:39
801500 -- (-751.447) [-752.424] (-754.271) (-748.131) * (-755.472) [-751.359] (-754.397) (-751.223) -- 0:00:39
802000 -- (-753.038) [-750.383] (-745.024) (-748.300) * (-749.464) [-746.677] (-745.297) (-747.848) -- 0:00:39
802500 -- [-748.689] (-747.056) (-749.676) (-752.645) * (-755.875) (-747.676) [-751.509] (-748.465) -- 0:00:39
803000 -- (-750.750) [-750.274] (-757.025) (-747.196) * (-755.553) [-756.132] (-753.092) (-750.143) -- 0:00:39
803500 -- (-748.494) (-750.589) (-749.659) [-752.618] * (-755.628) [-745.588] (-747.051) (-748.266) -- 0:00:38
804000 -- (-743.916) (-748.235) [-754.998] (-745.462) * [-753.930] (-746.893) (-750.695) (-746.816) -- 0:00:38
804500 -- [-748.244] (-747.767) (-759.455) (-756.704) * [-749.517] (-749.817) (-752.729) (-746.874) -- 0:00:38
805000 -- (-747.722) [-746.179] (-751.051) (-752.318) * (-754.885) (-746.952) (-750.670) [-747.007] -- 0:00:38
Average standard deviation of split frequencies: 0.005459
805500 -- (-750.338) (-760.003) (-748.079) [-745.206] * [-749.478] (-753.975) (-744.601) (-752.514) -- 0:00:38
806000 -- (-750.776) [-747.549] (-747.678) (-751.981) * (-755.829) [-745.782] (-747.901) (-747.425) -- 0:00:38
806500 -- (-752.983) (-748.398) (-747.353) [-746.882] * (-757.887) (-747.449) [-755.763] (-743.147) -- 0:00:38
807000 -- (-749.046) (-747.508) (-744.002) [-756.829] * (-746.030) [-748.607] (-747.910) (-748.520) -- 0:00:38
807500 -- (-751.594) (-749.430) [-744.789] (-757.478) * (-749.355) (-746.819) [-749.431] (-747.573) -- 0:00:38
808000 -- [-746.065] (-746.396) (-751.237) (-751.448) * (-751.918) (-750.715) (-751.350) [-746.607] -- 0:00:38
808500 -- [-746.339] (-748.723) (-755.146) (-748.867) * (-747.840) (-748.198) (-756.543) [-743.565] -- 0:00:37
809000 -- [-754.649] (-755.993) (-749.677) (-748.070) * (-749.281) (-753.413) (-742.997) [-751.153] -- 0:00:37
809500 -- (-755.211) (-754.776) (-752.187) [-746.910] * (-753.263) (-756.475) (-752.881) [-749.900] -- 0:00:37
810000 -- (-752.949) (-754.334) (-749.193) [-748.988] * (-755.795) (-753.923) (-747.673) [-748.659] -- 0:00:37
Average standard deviation of split frequencies: 0.004458
810500 -- (-746.626) (-753.581) [-748.133] (-753.486) * (-747.645) [-744.869] (-754.562) (-757.708) -- 0:00:37
811000 -- (-750.504) (-747.601) (-750.209) [-750.641] * (-752.626) (-748.956) (-749.476) [-750.395] -- 0:00:37
811500 -- (-751.304) [-743.687] (-752.195) (-748.080) * [-751.705] (-753.191) (-759.434) (-748.909) -- 0:00:37
812000 -- [-745.655] (-747.584) (-746.067) (-749.517) * (-754.225) (-750.223) [-754.229] (-751.116) -- 0:00:37
812500 -- (-758.811) (-752.782) [-749.970] (-750.854) * (-756.410) (-750.693) (-749.411) [-747.926] -- 0:00:37
813000 -- (-757.843) (-744.184) (-747.773) [-749.366] * (-764.948) (-751.198) (-746.222) [-757.066] -- 0:00:37
813500 -- (-766.786) (-753.244) (-743.732) [-746.923] * (-755.669) (-761.057) [-746.749] (-745.706) -- 0:00:36
814000 -- (-758.051) [-752.478] (-755.522) (-750.233) * (-758.598) (-750.351) [-744.214] (-748.773) -- 0:00:36
814500 -- (-755.824) (-755.361) (-746.964) [-746.753] * [-754.406] (-747.599) (-743.179) (-747.976) -- 0:00:36
815000 -- (-746.770) (-755.422) [-750.855] (-745.415) * (-755.428) (-749.344) (-750.504) [-749.527] -- 0:00:36
Average standard deviation of split frequencies: 0.004622
815500 -- (-747.976) (-748.942) [-745.069] (-755.081) * (-749.471) [-747.323] (-755.373) (-773.275) -- 0:00:36
816000 -- (-758.706) (-754.981) (-754.028) [-747.946] * [-746.527] (-755.498) (-751.314) (-763.702) -- 0:00:36
816500 -- (-757.308) [-751.167] (-753.490) (-744.439) * (-755.162) [-750.580] (-750.920) (-754.130) -- 0:00:36
817000 -- (-753.095) (-750.048) [-755.341] (-746.005) * [-746.681] (-752.560) (-747.638) (-751.853) -- 0:00:36
817500 -- [-754.278] (-756.424) (-754.253) (-748.309) * (-754.550) [-744.654] (-752.898) (-753.688) -- 0:00:36
818000 -- (-756.896) [-745.806] (-753.115) (-749.670) * [-745.610] (-745.648) (-750.847) (-755.548) -- 0:00:36
818500 -- (-748.755) [-746.668] (-754.972) (-746.096) * (-748.145) (-758.696) [-743.726] (-746.552) -- 0:00:35
819000 -- (-749.416) [-748.515] (-757.940) (-755.768) * (-753.959) [-747.676] (-748.128) (-749.506) -- 0:00:35
819500 -- (-758.179) (-746.589) (-761.566) [-750.720] * (-753.471) [-744.387] (-750.944) (-754.838) -- 0:00:35
820000 -- (-751.850) (-752.349) (-758.231) [-747.875] * (-755.822) [-748.853] (-751.761) (-749.587) -- 0:00:35
Average standard deviation of split frequencies: 0.005074
820500 -- [-751.625] (-752.603) (-754.854) (-750.167) * (-770.720) (-749.921) [-749.208] (-747.333) -- 0:00:35
821000 -- (-754.724) [-749.900] (-758.433) (-746.956) * (-750.332) (-750.733) [-749.146] (-757.169) -- 0:00:35
821500 -- (-748.037) (-752.945) [-749.445] (-745.799) * [-747.810] (-750.244) (-749.071) (-745.923) -- 0:00:35
822000 -- (-748.022) [-747.559] (-752.964) (-744.306) * (-757.769) [-745.448] (-748.952) (-751.842) -- 0:00:35
822500 -- [-750.344] (-750.126) (-750.496) (-747.983) * (-752.881) (-751.862) [-746.633] (-756.839) -- 0:00:35
823000 -- [-754.906] (-747.874) (-747.377) (-752.920) * (-745.398) [-747.077] (-746.247) (-747.082) -- 0:00:35
823500 -- (-756.403) (-749.449) [-747.823] (-749.088) * (-745.778) [-749.387] (-762.313) (-750.382) -- 0:00:34
824000 -- [-753.943] (-754.061) (-752.746) (-749.454) * (-752.287) (-754.218) [-748.536] (-752.734) -- 0:00:34
824500 -- (-748.402) (-754.209) [-744.175] (-750.253) * (-747.787) (-753.918) [-750.903] (-749.266) -- 0:00:34
825000 -- (-749.216) [-749.840] (-755.106) (-744.030) * (-748.297) [-758.302] (-752.837) (-745.693) -- 0:00:34
Average standard deviation of split frequencies: 0.005422
825500 -- [-743.513] (-748.553) (-753.026) (-752.845) * [-747.126] (-758.642) (-751.930) (-752.444) -- 0:00:34
826000 -- (-751.834) (-750.258) (-759.799) [-749.848] * (-751.929) (-753.587) (-744.744) [-757.086] -- 0:00:34
826500 -- (-748.853) [-750.457] (-756.101) (-752.452) * (-746.177) (-747.525) [-742.888] (-755.009) -- 0:00:34
827000 -- [-757.252] (-751.339) (-754.046) (-751.415) * (-750.322) [-751.034] (-757.005) (-753.692) -- 0:00:34
827500 -- (-751.617) [-749.525] (-746.079) (-758.309) * (-755.428) [-752.490] (-752.763) (-748.601) -- 0:00:34
828000 -- (-757.308) (-745.074) (-758.176) [-752.834] * (-745.401) (-752.469) [-751.009] (-747.907) -- 0:00:34
828500 -- (-749.361) [-747.672] (-754.505) (-745.972) * (-756.412) (-750.331) [-744.526] (-754.069) -- 0:00:33
829000 -- (-747.027) (-746.383) [-744.970] (-752.119) * [-752.986] (-746.472) (-754.306) (-755.238) -- 0:00:33
829500 -- [-749.256] (-749.480) (-760.605) (-751.431) * (-750.540) (-749.892) [-748.230] (-753.852) -- 0:00:33
830000 -- (-748.617) (-754.076) (-754.773) [-747.758] * (-752.588) (-750.675) [-751.883] (-757.740) -- 0:00:33
Average standard deviation of split frequencies: 0.005675
830500 -- (-751.760) [-747.934] (-747.902) (-752.257) * (-752.458) [-749.768] (-746.214) (-751.044) -- 0:00:33
831000 -- (-750.554) [-747.927] (-746.896) (-749.535) * (-754.402) [-749.755] (-743.430) (-746.018) -- 0:00:33
831500 -- (-755.254) (-748.189) (-746.164) [-747.732] * (-755.004) (-761.112) (-755.713) [-749.023] -- 0:00:33
832000 -- [-745.439] (-751.458) (-747.957) (-756.903) * (-751.690) [-744.208] (-749.441) (-749.347) -- 0:00:33
832500 -- (-760.226) (-752.749) (-749.969) [-748.473] * (-760.809) (-743.987) (-745.137) [-749.204] -- 0:00:33
833000 -- (-749.377) [-747.745] (-749.440) (-742.966) * (-754.645) (-744.924) (-754.895) [-751.875] -- 0:00:33
833500 -- (-743.719) (-746.237) (-752.836) [-748.732] * [-755.184] (-752.918) (-762.960) (-747.511) -- 0:00:32
834000 -- [-753.373] (-748.303) (-751.817) (-749.485) * (-752.799) [-746.523] (-754.760) (-745.291) -- 0:00:32
834500 -- [-751.553] (-747.618) (-752.141) (-750.557) * (-748.711) [-750.421] (-750.142) (-763.458) -- 0:00:32
835000 -- (-749.756) (-752.100) (-753.036) [-745.947] * (-747.572) (-750.653) [-751.649] (-756.386) -- 0:00:32
Average standard deviation of split frequencies: 0.005263
835500 -- (-749.991) (-747.985) (-752.854) [-748.070] * (-749.798) (-751.783) [-748.359] (-762.583) -- 0:00:32
836000 -- (-751.584) (-743.133) (-749.634) [-747.994] * (-751.859) [-756.172] (-746.821) (-751.911) -- 0:00:32
836500 -- [-753.431] (-754.765) (-749.956) (-762.434) * (-752.636) (-756.437) [-751.664] (-754.855) -- 0:00:32
837000 -- (-753.183) [-754.745] (-744.305) (-746.226) * (-754.932) (-749.011) [-749.258] (-752.996) -- 0:00:32
837500 -- (-758.065) (-753.963) (-746.977) [-746.055] * (-750.038) [-746.566] (-749.626) (-753.724) -- 0:00:32
838000 -- (-752.625) [-743.874] (-754.113) (-752.276) * [-752.094] (-750.133) (-747.937) (-746.436) -- 0:00:32
838500 -- [-747.130] (-748.039) (-747.690) (-750.287) * (-756.635) [-749.672] (-751.994) (-749.842) -- 0:00:31
839000 -- [-750.789] (-750.862) (-754.417) (-750.979) * (-748.892) (-756.534) (-763.213) [-751.887] -- 0:00:31
839500 -- (-757.149) [-743.531] (-752.911) (-752.287) * [-751.442] (-748.474) (-756.445) (-752.845) -- 0:00:31
840000 -- [-758.486] (-750.093) (-747.434) (-747.543) * (-749.845) [-749.697] (-759.658) (-750.549) -- 0:00:31
Average standard deviation of split frequencies: 0.005327
840500 -- (-750.996) [-749.278] (-748.375) (-755.764) * (-757.591) [-746.250] (-753.839) (-755.377) -- 0:00:31
841000 -- (-754.449) (-747.531) (-752.911) [-751.385] * (-747.567) (-752.013) [-753.211] (-758.437) -- 0:00:31
841500 -- (-745.808) [-755.564] (-748.605) (-752.528) * [-750.980] (-754.549) (-747.713) (-751.249) -- 0:00:31
842000 -- [-745.035] (-748.560) (-749.288) (-759.160) * (-755.645) (-752.025) [-755.971] (-752.180) -- 0:00:31
842500 -- (-746.637) [-749.983] (-752.927) (-746.069) * (-754.883) (-747.261) [-762.019] (-753.590) -- 0:00:31
843000 -- (-751.100) (-757.625) (-748.322) [-746.183] * (-758.491) (-750.863) [-749.407] (-750.559) -- 0:00:31
843500 -- [-749.892] (-755.691) (-759.088) (-746.275) * (-757.322) [-751.525] (-748.424) (-752.425) -- 0:00:30
844000 -- [-749.057] (-747.434) (-762.728) (-755.221) * (-754.093) (-756.509) [-747.361] (-751.657) -- 0:00:30
844500 -- (-747.189) [-752.009] (-753.514) (-751.316) * [-746.812] (-755.452) (-746.713) (-747.812) -- 0:00:30
845000 -- (-754.086) (-752.064) [-744.801] (-751.375) * (-747.891) (-764.885) [-749.141] (-749.064) -- 0:00:30
Average standard deviation of split frequencies: 0.005665
845500 -- (-743.483) (-747.026) [-747.955] (-751.696) * (-757.006) (-758.469) (-759.880) [-745.000] -- 0:00:30
846000 -- (-755.680) (-747.106) [-749.768] (-744.414) * [-758.206] (-747.920) (-746.273) (-750.002) -- 0:00:30
846500 -- (-744.433) (-751.454) [-749.581] (-748.112) * (-759.911) (-751.218) [-746.665] (-750.474) -- 0:00:30
847000 -- [-748.464] (-749.118) (-748.262) (-756.473) * [-749.037] (-750.643) (-746.341) (-755.821) -- 0:00:30
847500 -- [-751.347] (-753.148) (-746.436) (-751.554) * (-746.678) (-757.183) (-744.069) [-755.467] -- 0:00:30
848000 -- (-747.190) [-754.352] (-751.730) (-752.731) * (-747.417) (-756.727) (-749.405) [-747.025] -- 0:00:30
848500 -- (-753.851) (-753.981) (-749.467) [-752.032] * (-746.998) (-745.932) [-743.074] (-755.369) -- 0:00:29
849000 -- [-749.797] (-756.875) (-748.218) (-752.205) * (-747.373) (-743.273) (-748.961) [-749.992] -- 0:00:29
849500 -- (-751.938) [-750.988] (-748.160) (-749.597) * (-744.473) (-753.268) [-751.503] (-757.061) -- 0:00:29
850000 -- [-746.728] (-745.155) (-750.345) (-756.404) * (-744.940) [-747.342] (-747.619) (-749.545) -- 0:00:29
Average standard deviation of split frequencies: 0.005542
850500 -- [-747.399] (-748.514) (-759.657) (-754.795) * (-752.882) [-745.362] (-747.083) (-750.823) -- 0:00:29
851000 -- [-745.033] (-749.614) (-751.405) (-757.018) * (-752.170) (-747.408) (-755.005) [-748.485] -- 0:00:29
851500 -- (-747.029) (-743.342) (-744.346) [-757.488] * (-753.215) (-746.907) [-750.196] (-761.650) -- 0:00:29
852000 -- (-749.302) (-747.237) [-749.115] (-760.686) * (-746.552) (-749.992) [-746.788] (-756.588) -- 0:00:29
852500 -- (-752.647) (-754.849) [-752.579] (-751.631) * (-743.826) (-753.915) [-746.982] (-747.291) -- 0:00:29
853000 -- (-747.150) (-749.692) [-747.017] (-754.099) * [-751.186] (-747.879) (-753.181) (-744.493) -- 0:00:29
853500 -- (-751.350) (-752.214) (-750.337) [-747.802] * (-750.339) (-752.652) [-746.680] (-754.441) -- 0:00:29
854000 -- (-752.276) [-746.324] (-751.115) (-753.032) * [-751.209] (-754.668) (-746.840) (-747.727) -- 0:00:28
854500 -- [-747.293] (-747.617) (-747.883) (-750.278) * (-746.668) (-748.808) [-754.497] (-745.880) -- 0:00:28
855000 -- (-752.928) (-744.958) [-748.364] (-751.669) * (-750.199) [-748.364] (-757.035) (-745.915) -- 0:00:28
Average standard deviation of split frequencies: 0.005782
855500 -- (-749.934) (-749.363) [-742.931] (-755.459) * (-750.440) (-754.584) (-766.444) [-744.387] -- 0:00:28
856000 -- (-749.210) (-748.252) [-745.572] (-755.564) * [-755.388] (-750.273) (-750.361) (-745.783) -- 0:00:28
856500 -- (-754.023) (-747.507) [-745.775] (-757.137) * (-749.853) [-755.428] (-751.786) (-745.658) -- 0:00:28
857000 -- [-748.539] (-751.568) (-760.497) (-756.365) * (-756.047) (-750.051) (-755.232) [-753.505] -- 0:00:28
857500 -- (-748.859) (-748.128) (-750.765) [-749.164] * (-753.717) (-747.214) (-752.831) [-746.745] -- 0:00:28
858000 -- (-749.962) [-745.878] (-748.552) (-749.728) * (-755.474) (-750.088) (-747.048) [-749.690] -- 0:00:28
858500 -- (-753.981) [-743.615] (-753.560) (-749.256) * (-753.490) (-752.099) [-753.716] (-747.404) -- 0:00:28
859000 -- (-754.844) [-747.867] (-745.925) (-748.306) * [-754.378] (-753.135) (-750.066) (-751.355) -- 0:00:27
859500 -- (-752.847) (-753.942) (-751.752) [-749.580] * (-749.842) (-748.904) [-754.709] (-755.963) -- 0:00:27
860000 -- (-746.644) (-750.663) [-746.277] (-749.958) * (-752.802) [-746.838] (-754.119) (-754.369) -- 0:00:27
Average standard deviation of split frequencies: 0.006573
860500 -- (-746.499) (-754.147) (-751.510) [-747.407] * (-746.723) (-756.082) [-754.176] (-749.031) -- 0:00:27
861000 -- (-757.695) [-751.253] (-755.839) (-750.206) * (-748.566) (-751.095) (-749.287) [-744.222] -- 0:00:27
861500 -- (-750.836) [-751.607] (-749.632) (-752.411) * (-749.947) [-750.457] (-748.205) (-752.482) -- 0:00:27
862000 -- (-757.340) [-748.207] (-751.773) (-746.676) * (-746.558) (-752.320) (-748.497) [-749.868] -- 0:00:27
862500 -- [-747.096] (-747.456) (-745.444) (-752.586) * [-748.833] (-750.403) (-748.783) (-745.437) -- 0:00:27
863000 -- (-745.475) (-745.635) (-758.550) [-752.565] * (-757.594) [-750.893] (-745.664) (-755.716) -- 0:00:27
863500 -- (-748.052) [-745.887] (-751.421) (-753.792) * [-744.111] (-750.288) (-756.399) (-751.645) -- 0:00:27
864000 -- (-751.378) (-747.582) (-752.118) [-747.177] * [-757.207] (-748.811) (-749.725) (-756.110) -- 0:00:26
864500 -- [-757.442] (-750.283) (-749.252) (-746.709) * [-751.532] (-751.608) (-745.285) (-751.851) -- 0:00:26
865000 -- (-747.408) (-752.323) (-745.568) [-750.505] * (-762.278) (-746.820) [-748.805] (-752.206) -- 0:00:26
Average standard deviation of split frequencies: 0.006714
865500 -- (-749.883) (-747.555) [-743.730] (-747.789) * (-752.113) (-764.244) (-747.675) [-752.946] -- 0:00:26
866000 -- [-748.893] (-746.981) (-754.034) (-754.445) * (-749.922) (-747.429) (-751.557) [-747.731] -- 0:00:26
866500 -- (-748.452) (-749.324) (-755.781) [-741.620] * (-749.326) [-745.929] (-749.163) (-749.975) -- 0:00:26
867000 -- (-753.681) (-756.869) (-759.381) [-753.703] * [-748.419] (-752.759) (-755.591) (-743.912) -- 0:00:26
867500 -- (-749.013) [-748.239] (-752.276) (-750.821) * [-754.089] (-750.668) (-747.505) (-751.847) -- 0:00:26
868000 -- (-752.160) (-747.888) (-749.931) [-751.796] * (-749.635) (-749.865) (-752.628) [-751.098] -- 0:00:26
868500 -- [-747.643] (-749.710) (-753.333) (-751.990) * (-748.971) (-749.019) (-747.458) [-753.300] -- 0:00:26
869000 -- (-749.383) [-747.183] (-747.229) (-752.836) * (-753.461) (-755.982) [-745.930] (-748.743) -- 0:00:25
869500 -- (-751.879) [-746.986] (-745.399) (-751.130) * (-752.505) (-749.413) (-747.975) [-748.134] -- 0:00:25
870000 -- (-748.144) (-747.194) (-754.112) [-747.495] * (-754.142) (-752.176) [-748.642] (-748.608) -- 0:00:25
Average standard deviation of split frequencies: 0.007309
870500 -- (-749.692) [-746.790] (-745.544) (-745.685) * (-756.831) (-751.337) (-752.720) [-749.054] -- 0:00:25
871000 -- [-748.445] (-751.918) (-759.353) (-742.617) * (-748.346) (-753.195) (-762.302) [-752.897] -- 0:00:25
871500 -- (-747.252) (-750.279) (-757.512) [-744.659] * [-744.160] (-751.917) (-749.931) (-752.553) -- 0:00:25
872000 -- (-747.215) [-746.138] (-751.330) (-753.394) * (-748.272) [-747.201] (-748.054) (-746.036) -- 0:00:25
872500 -- (-748.132) (-754.492) (-764.988) [-751.059] * [-748.617] (-751.548) (-748.813) (-744.038) -- 0:00:25
873000 -- [-748.691] (-757.693) (-757.173) (-746.433) * [-746.071] (-754.409) (-747.627) (-754.395) -- 0:00:25
873500 -- [-747.810] (-749.609) (-748.968) (-753.888) * (-753.031) (-755.625) (-747.183) [-745.923] -- 0:00:25
874000 -- [-750.670] (-749.720) (-749.301) (-747.263) * (-750.453) [-748.214] (-750.282) (-760.444) -- 0:00:24
874500 -- (-746.405) (-755.574) (-757.126) [-749.052] * (-754.972) (-751.315) (-748.341) [-743.457] -- 0:00:24
875000 -- (-755.423) (-751.803) (-748.889) [-754.484] * (-746.423) (-748.505) [-743.465] (-748.677) -- 0:00:24
Average standard deviation of split frequencies: 0.007624
875500 -- (-749.107) (-747.257) (-747.486) [-752.352] * [-747.290] (-748.577) (-749.839) (-752.425) -- 0:00:24
876000 -- (-755.566) [-745.973] (-749.348) (-748.295) * (-750.460) [-746.619] (-757.784) (-746.458) -- 0:00:24
876500 -- [-746.594] (-752.213) (-758.394) (-749.140) * (-751.458) (-749.594) [-754.561] (-753.945) -- 0:00:24
877000 -- [-748.604] (-750.464) (-755.027) (-744.891) * (-752.701) [-744.474] (-754.597) (-752.051) -- 0:00:24
877500 -- (-750.555) (-750.213) (-747.369) [-749.283] * (-753.314) [-750.851] (-752.574) (-754.385) -- 0:00:24
878000 -- (-746.945) (-750.570) [-748.826] (-748.432) * [-748.152] (-749.412) (-751.207) (-752.823) -- 0:00:24
878500 -- [-749.471] (-746.585) (-748.799) (-757.441) * (-750.000) (-747.722) [-748.036] (-749.935) -- 0:00:24
879000 -- [-749.243] (-753.788) (-751.087) (-752.957) * (-749.176) [-748.587] (-762.437) (-754.060) -- 0:00:23
879500 -- [-750.768] (-750.778) (-748.659) (-749.412) * (-748.621) (-752.208) [-747.646] (-748.455) -- 0:00:23
880000 -- (-748.203) (-748.962) (-751.404) [-747.055] * (-752.840) (-752.371) [-749.247] (-750.241) -- 0:00:23
Average standard deviation of split frequencies: 0.006780
880500 -- [-745.006] (-752.624) (-749.508) (-747.033) * (-755.021) (-750.374) [-752.498] (-750.824) -- 0:00:23
881000 -- [-752.692] (-747.045) (-755.350) (-755.724) * (-750.101) (-750.559) (-744.742) [-746.369] -- 0:00:23
881500 -- (-752.220) (-749.945) (-750.249) [-748.026] * (-748.563) (-753.253) (-763.043) [-746.836] -- 0:00:23
882000 -- (-752.768) [-747.526] (-749.465) (-753.968) * (-754.636) [-747.876] (-753.184) (-746.636) -- 0:00:23
882500 -- [-746.639] (-748.475) (-753.746) (-751.124) * (-754.661) (-758.139) (-756.965) [-747.545] -- 0:00:23
883000 -- (-748.798) (-750.144) (-753.922) [-750.532] * [-752.193] (-749.938) (-755.183) (-746.520) -- 0:00:23
883500 -- (-744.551) [-753.197] (-752.098) (-751.512) * (-747.112) (-750.875) (-745.140) [-746.426] -- 0:00:23
884000 -- (-753.655) (-746.698) (-757.304) [-749.640] * (-756.260) (-748.149) (-757.453) [-751.362] -- 0:00:22
884500 -- (-753.698) (-745.754) [-744.917] (-749.780) * (-743.189) [-748.911] (-750.231) (-749.506) -- 0:00:22
885000 -- (-753.898) (-762.300) (-751.990) [-745.715] * (-753.029) [-750.573] (-746.802) (-746.706) -- 0:00:22
Average standard deviation of split frequencies: 0.007449
885500 -- (-748.012) [-746.681] (-754.036) (-749.131) * (-753.114) [-751.028] (-748.194) (-751.331) -- 0:00:22
886000 -- (-748.427) [-749.434] (-751.897) (-747.748) * (-748.161) (-749.480) (-749.135) [-747.665] -- 0:00:22
886500 -- (-755.728) (-752.163) [-749.130] (-751.554) * (-743.453) (-745.834) (-752.918) [-749.742] -- 0:00:22
887000 -- (-752.285) (-747.163) [-746.109] (-748.561) * (-752.152) [-753.993] (-754.570) (-757.778) -- 0:00:22
887500 -- (-748.136) (-745.468) [-751.558] (-752.893) * [-751.585] (-759.323) (-750.915) (-757.004) -- 0:00:22
888000 -- [-748.366] (-745.289) (-752.208) (-746.691) * (-751.317) [-751.191] (-744.017) (-757.405) -- 0:00:22
888500 -- (-750.467) (-743.952) [-743.872] (-747.475) * (-748.006) [-746.720] (-749.393) (-751.661) -- 0:00:22
889000 -- (-755.715) [-754.236] (-746.048) (-755.483) * (-744.168) (-743.959) [-749.768] (-745.856) -- 0:00:21
889500 -- (-758.376) (-750.280) [-748.999] (-756.294) * [-745.119] (-755.844) (-749.986) (-748.240) -- 0:00:21
890000 -- (-748.280) (-751.116) [-746.328] (-749.898) * (-747.986) (-753.263) (-750.538) [-742.607] -- 0:00:21
Average standard deviation of split frequencies: 0.007851
890500 -- [-752.407] (-746.398) (-750.036) (-752.211) * [-752.960] (-758.198) (-752.771) (-750.603) -- 0:00:21
891000 -- [-752.167] (-748.616) (-746.802) (-748.508) * (-748.276) [-744.130] (-746.693) (-754.650) -- 0:00:21
891500 -- [-750.889] (-744.814) (-748.485) (-751.752) * (-752.285) (-749.114) [-746.940] (-749.445) -- 0:00:21
892000 -- [-748.024] (-751.092) (-747.899) (-748.882) * (-751.051) (-752.345) (-748.595) [-747.868] -- 0:00:21
892500 -- [-755.267] (-748.164) (-748.207) (-751.375) * (-753.572) (-745.506) (-748.911) [-750.465] -- 0:00:21
893000 -- (-753.690) [-743.996] (-745.108) (-752.954) * (-746.522) [-746.897] (-754.742) (-749.472) -- 0:00:21
893500 -- [-748.419] (-744.650) (-747.898) (-770.661) * [-746.961] (-754.901) (-752.296) (-747.766) -- 0:00:21
894000 -- (-748.761) (-746.672) [-745.580] (-758.343) * (-748.091) [-748.315] (-752.099) (-746.087) -- 0:00:20
894500 -- (-756.828) (-746.714) (-746.645) [-753.179] * (-750.484) (-756.096) [-750.731] (-753.680) -- 0:00:20
895000 -- (-751.435) (-750.720) [-750.288] (-746.643) * (-752.169) (-756.551) (-745.125) [-748.660] -- 0:00:20
Average standard deviation of split frequencies: 0.007366
895500 -- (-754.182) [-748.103] (-751.632) (-753.014) * (-748.281) [-756.221] (-747.064) (-748.934) -- 0:00:20
896000 -- [-750.766] (-758.119) (-747.395) (-750.161) * [-745.955] (-747.828) (-757.697) (-758.952) -- 0:00:20
896500 -- [-746.733] (-756.774) (-752.103) (-750.966) * [-750.581] (-748.038) (-750.375) (-744.451) -- 0:00:20
897000 -- (-754.862) (-760.357) [-748.332] (-748.348) * [-752.071] (-754.745) (-754.994) (-754.707) -- 0:00:20
897500 -- (-748.233) (-753.870) (-754.299) [-750.974] * [-750.163] (-747.908) (-746.463) (-748.255) -- 0:00:20
898000 -- (-748.640) [-754.262] (-750.929) (-755.819) * (-745.020) [-749.115] (-751.713) (-749.265) -- 0:00:20
898500 -- [-751.633] (-745.500) (-746.156) (-753.197) * (-749.143) (-753.829) [-745.962] (-747.710) -- 0:00:20
899000 -- (-752.307) (-753.848) [-752.413] (-748.961) * [-743.804] (-746.959) (-757.710) (-748.658) -- 0:00:19
899500 -- (-746.627) (-753.679) (-749.252) [-749.593] * [-745.909] (-753.999) (-746.322) (-753.952) -- 0:00:19
900000 -- (-751.956) (-751.625) (-753.765) [-747.189] * (-751.228) (-748.783) [-747.163] (-746.859) -- 0:00:19
Average standard deviation of split frequencies: 0.007589
900500 -- (-753.213) (-751.243) [-752.769] (-755.646) * (-748.693) [-746.683] (-750.090) (-754.006) -- 0:00:19
901000 -- [-749.341] (-746.205) (-748.472) (-752.179) * (-757.745) [-746.340] (-752.366) (-748.558) -- 0:00:19
901500 -- (-752.763) [-750.433] (-756.041) (-756.194) * (-759.439) [-746.305] (-745.353) (-748.545) -- 0:00:19
902000 -- [-746.764] (-746.506) (-753.440) (-751.549) * [-748.642] (-752.247) (-745.529) (-750.498) -- 0:00:19
902500 -- (-751.916) (-748.090) [-748.942] (-760.412) * (-751.799) (-749.692) [-753.823] (-746.867) -- 0:00:19
903000 -- [-744.415] (-754.069) (-747.745) (-748.748) * (-746.631) (-747.744) [-753.160] (-748.930) -- 0:00:19
903500 -- (-748.575) (-748.213) [-755.889] (-754.214) * (-744.640) (-743.732) (-751.621) [-750.435] -- 0:00:19
904000 -- (-748.446) [-747.940] (-749.731) (-746.753) * [-744.656] (-752.034) (-746.290) (-751.147) -- 0:00:19
904500 -- (-748.882) (-751.066) (-748.891) [-748.373] * (-750.952) (-752.621) (-749.582) [-753.844] -- 0:00:18
905000 -- (-748.043) (-758.394) (-747.612) [-746.251] * (-751.832) [-750.674] (-745.712) (-750.073) -- 0:00:18
Average standard deviation of split frequencies: 0.007805
905500 -- [-747.910] (-747.963) (-755.157) (-750.807) * (-749.807) (-749.472) [-748.772] (-753.018) -- 0:00:18
906000 -- (-750.834) (-746.343) [-748.576] (-750.554) * (-761.442) (-750.578) (-753.525) [-752.267] -- 0:00:18
906500 -- (-753.514) (-751.213) (-758.849) [-748.241] * (-758.135) [-748.194] (-746.239) (-753.048) -- 0:00:18
907000 -- (-760.870) [-751.393] (-754.637) (-747.285) * (-754.952) (-745.719) [-745.477] (-750.571) -- 0:00:18
907500 -- (-749.605) (-752.258) (-746.352) [-747.698] * (-752.502) [-747.727] (-744.717) (-750.414) -- 0:00:18
908000 -- (-749.417) (-752.977) [-750.259] (-750.880) * (-757.241) (-751.733) (-748.304) [-751.482] -- 0:00:18
908500 -- (-744.571) (-750.419) (-749.219) [-745.458] * (-749.245) (-748.384) (-747.546) [-752.555] -- 0:00:18
909000 -- (-744.607) (-756.945) [-748.898] (-750.689) * (-745.008) (-746.674) (-750.514) [-748.389] -- 0:00:18
909500 -- [-754.856] (-752.635) (-754.948) (-746.473) * [-753.261] (-751.040) (-746.476) (-744.110) -- 0:00:17
910000 -- (-749.437) (-753.313) [-748.722] (-751.345) * (-748.296) (-752.107) (-756.487) [-747.871] -- 0:00:17
Average standard deviation of split frequencies: 0.007678
910500 -- [-748.588] (-760.653) (-753.636) (-746.171) * (-748.256) (-758.577) [-744.151] (-746.198) -- 0:00:17
911000 -- (-746.442) (-749.773) (-747.131) [-752.557] * [-742.930] (-748.300) (-746.066) (-752.783) -- 0:00:17
911500 -- (-746.692) (-758.793) [-748.096] (-745.057) * (-750.563) [-750.885] (-754.965) (-748.502) -- 0:00:17
912000 -- (-748.147) [-752.817] (-750.050) (-753.101) * (-746.801) (-754.178) (-755.792) [-751.911] -- 0:00:17
912500 -- [-747.565] (-753.221) (-747.912) (-748.757) * [-753.073] (-749.855) (-749.661) (-751.202) -- 0:00:17
913000 -- [-749.804] (-752.617) (-753.534) (-746.242) * (-751.414) (-751.140) [-748.790] (-745.426) -- 0:00:17
913500 -- (-748.692) [-755.622] (-748.060) (-749.195) * (-754.789) [-745.112] (-743.185) (-751.359) -- 0:00:17
914000 -- (-751.437) (-754.199) (-753.359) [-744.972] * (-754.978) (-751.386) [-747.004] (-747.424) -- 0:00:17
914500 -- (-756.872) (-752.381) (-754.308) [-744.257] * (-751.897) (-754.328) (-752.174) [-745.250] -- 0:00:16
915000 -- (-750.350) [-746.305] (-749.898) (-747.995) * (-746.795) (-760.536) (-745.193) [-747.743] -- 0:00:16
Average standard deviation of split frequencies: 0.007805
915500 -- [-750.400] (-748.700) (-748.926) (-752.471) * [-743.308] (-759.850) (-746.459) (-747.433) -- 0:00:16
916000 -- [-744.743] (-757.657) (-750.969) (-746.059) * [-748.611] (-749.674) (-754.356) (-750.330) -- 0:00:16
916500 -- [-744.362] (-750.423) (-755.355) (-752.467) * (-753.387) (-753.725) (-758.986) [-750.840] -- 0:00:16
917000 -- (-752.034) (-749.463) [-757.387] (-749.320) * (-754.587) [-745.283] (-747.981) (-750.943) -- 0:00:16
917500 -- [-744.116] (-752.835) (-745.068) (-749.278) * (-753.083) (-744.839) [-749.449] (-747.643) -- 0:00:16
918000 -- (-745.856) (-754.512) [-746.186] (-748.155) * (-751.844) (-754.856) (-754.139) [-751.435] -- 0:00:16
918500 -- (-747.323) [-749.361] (-754.674) (-751.434) * (-744.859) [-750.267] (-747.067) (-753.388) -- 0:00:16
919000 -- (-748.471) (-751.931) [-751.636] (-750.393) * (-750.808) (-742.791) (-752.444) [-743.611] -- 0:00:16
919500 -- (-750.943) (-750.432) [-744.814] (-751.031) * (-745.026) (-745.152) (-754.365) [-749.409] -- 0:00:15
920000 -- (-750.490) [-752.368] (-749.398) (-751.301) * (-744.166) [-751.300] (-755.074) (-745.901) -- 0:00:15
Average standard deviation of split frequencies: 0.006912
920500 -- (-751.476) [-746.677] (-751.613) (-754.123) * (-745.885) [-747.418] (-751.020) (-753.723) -- 0:00:15
921000 -- [-748.809] (-753.353) (-749.068) (-750.365) * (-744.375) [-744.278] (-750.471) (-752.255) -- 0:00:15
921500 -- (-751.701) [-747.037] (-746.191) (-746.365) * (-746.239) (-753.083) [-751.689] (-745.130) -- 0:00:15
922000 -- (-749.129) (-747.795) [-744.878] (-749.906) * [-743.931] (-755.783) (-748.409) (-753.567) -- 0:00:15
922500 -- (-748.979) [-747.150] (-746.111) (-756.460) * [-749.133] (-749.174) (-751.766) (-750.267) -- 0:00:15
923000 -- (-757.116) [-753.240] (-750.826) (-748.584) * [-744.664] (-750.664) (-749.260) (-754.003) -- 0:00:15
923500 -- (-753.260) (-750.592) (-745.367) [-750.053] * (-750.639) [-755.738] (-749.688) (-760.620) -- 0:00:15
924000 -- (-754.711) (-757.109) (-751.254) [-750.743] * [-743.279] (-752.737) (-758.293) (-752.126) -- 0:00:15
924500 -- [-748.958] (-748.892) (-750.443) (-751.139) * (-751.684) (-750.195) (-752.665) [-749.354] -- 0:00:14
925000 -- (-750.258) (-751.122) [-746.958] (-754.560) * (-753.847) (-757.266) (-759.393) [-745.923] -- 0:00:14
Average standard deviation of split frequencies: 0.007042
925500 -- (-755.863) (-758.164) [-750.336] (-748.507) * (-748.609) (-759.948) [-746.390] (-756.084) -- 0:00:14
926000 -- (-753.323) (-750.583) [-743.002] (-747.460) * (-749.076) (-760.632) [-752.105] (-747.467) -- 0:00:14
926500 -- (-748.704) (-749.643) (-757.581) [-750.112] * (-749.055) (-756.069) (-749.972) [-744.796] -- 0:00:14
927000 -- (-754.290) (-750.314) [-745.724] (-747.284) * (-754.609) [-754.817] (-755.098) (-750.597) -- 0:00:14
927500 -- [-750.176] (-756.065) (-755.080) (-750.770) * (-748.266) [-749.181] (-751.418) (-755.279) -- 0:00:14
928000 -- (-749.988) (-754.662) [-746.446] (-752.844) * (-748.676) (-756.532) [-744.673] (-750.085) -- 0:00:14
928500 -- [-746.410] (-752.432) (-752.228) (-751.965) * (-756.415) (-754.111) [-751.793] (-750.112) -- 0:00:14
929000 -- (-753.640) [-754.371] (-751.135) (-748.306) * (-748.077) (-753.496) (-754.578) [-753.098] -- 0:00:14
929500 -- (-754.758) (-754.499) [-754.627] (-747.176) * (-749.589) [-749.628] (-746.892) (-755.039) -- 0:00:13
930000 -- (-755.576) (-747.779) (-752.655) [-750.941] * (-748.120) (-751.178) [-753.764] (-748.245) -- 0:00:13
Average standard deviation of split frequencies: 0.006838
930500 -- (-750.470) (-748.015) [-752.776] (-745.552) * (-748.604) (-760.333) [-750.964] (-745.652) -- 0:00:13
931000 -- (-743.793) (-752.273) [-748.038] (-754.320) * (-744.385) (-751.940) (-749.498) [-748.522] -- 0:00:13
931500 -- (-745.132) [-750.287] (-750.230) (-753.097) * [-744.894] (-756.441) (-754.351) (-747.978) -- 0:00:13
932000 -- [-752.775] (-748.962) (-754.949) (-755.178) * (-750.770) [-745.484] (-750.291) (-749.662) -- 0:00:13
932500 -- (-744.949) [-748.746] (-753.028) (-747.809) * (-747.616) (-751.957) (-754.745) [-745.647] -- 0:00:13
933000 -- (-752.465) (-751.128) (-752.807) [-752.008] * (-747.767) [-752.106] (-752.993) (-746.967) -- 0:00:13
933500 -- (-749.150) [-749.645] (-756.030) (-752.866) * [-753.367] (-753.311) (-749.339) (-754.219) -- 0:00:13
934000 -- (-753.878) [-745.404] (-749.037) (-747.071) * (-759.770) (-752.336) [-746.936] (-746.187) -- 0:00:13
934500 -- (-757.204) (-752.535) (-747.665) [-749.322] * (-747.809) [-746.638] (-746.430) (-751.880) -- 0:00:12
935000 -- (-752.294) [-758.879] (-749.906) (-753.189) * (-751.024) [-751.632] (-750.792) (-756.542) -- 0:00:12
Average standard deviation of split frequencies: 0.007471
935500 -- (-766.491) [-746.962] (-749.500) (-743.675) * [-748.223] (-748.370) (-752.502) (-752.484) -- 0:00:12
936000 -- (-756.827) (-749.880) (-753.958) [-755.586] * (-756.421) (-758.673) [-744.658] (-759.905) -- 0:00:12
936500 -- [-748.518] (-749.880) (-749.680) (-761.316) * [-745.537] (-745.780) (-745.654) (-751.839) -- 0:00:12
937000 -- (-762.403) (-750.033) (-746.284) [-750.407] * (-747.882) [-754.507] (-753.292) (-758.426) -- 0:00:12
937500 -- (-752.433) (-759.718) (-748.681) [-747.470] * (-750.382) [-744.047] (-749.875) (-750.036) -- 0:00:12
938000 -- (-760.287) [-744.200] (-743.890) (-758.579) * (-756.175) [-750.909] (-747.355) (-754.772) -- 0:00:12
938500 -- (-745.123) (-753.802) [-747.413] (-760.718) * [-752.982] (-746.372) (-752.412) (-751.483) -- 0:00:12
939000 -- (-750.370) (-749.795) (-749.714) [-750.411] * (-750.773) [-745.537] (-757.630) (-757.321) -- 0:00:12
939500 -- (-755.885) (-751.763) [-746.199] (-750.658) * [-750.570] (-751.154) (-749.251) (-752.626) -- 0:00:11
940000 -- (-742.821) (-748.410) [-748.263] (-746.612) * (-756.898) (-744.801) [-747.117] (-752.144) -- 0:00:11
Average standard deviation of split frequencies: 0.007517
940500 -- [-756.066] (-750.023) (-747.763) (-753.873) * (-749.996) (-748.640) (-745.905) [-750.378] -- 0:00:11
941000 -- (-747.576) [-752.302] (-751.476) (-751.916) * (-750.809) (-743.157) (-746.792) [-751.129] -- 0:00:11
941500 -- (-747.633) (-759.203) [-749.030] (-746.482) * [-747.561] (-749.165) (-751.612) (-749.340) -- 0:00:11
942000 -- [-745.870] (-749.916) (-747.045) (-751.142) * (-749.603) [-745.875] (-755.079) (-748.701) -- 0:00:11
942500 -- (-743.879) (-751.341) [-754.492] (-752.517) * (-753.356) (-752.073) (-766.928) [-747.283] -- 0:00:11
943000 -- (-748.745) (-753.096) [-745.431] (-747.619) * [-745.097] (-748.939) (-754.090) (-752.440) -- 0:00:11
943500 -- (-748.801) (-748.030) [-743.965] (-750.299) * [-744.884] (-746.976) (-752.644) (-748.427) -- 0:00:11
944000 -- [-747.551] (-751.823) (-746.988) (-750.177) * (-748.958) (-746.008) (-744.733) [-747.458] -- 0:00:11
944500 -- (-747.547) (-752.266) [-747.499] (-750.628) * (-750.689) [-750.507] (-748.478) (-748.708) -- 0:00:10
945000 -- (-750.538) (-754.248) [-747.327] (-750.968) * (-750.243) [-749.485] (-750.690) (-754.141) -- 0:00:10
Average standard deviation of split frequencies: 0.007973
945500 -- (-745.555) (-746.359) (-757.377) [-744.803] * [-750.136] (-754.260) (-749.369) (-749.220) -- 0:00:10
946000 -- [-749.004] (-749.107) (-748.019) (-745.895) * [-750.264] (-752.190) (-750.418) (-750.305) -- 0:00:10
946500 -- [-744.281] (-748.333) (-751.836) (-747.150) * (-750.674) [-749.463] (-754.110) (-757.834) -- 0:00:10
947000 -- (-747.284) (-749.433) (-755.449) [-749.594] * (-748.577) (-754.926) [-746.333] (-752.981) -- 0:00:10
947500 -- [-745.758] (-750.345) (-749.229) (-751.476) * (-750.573) [-749.878] (-752.287) (-748.541) -- 0:00:10
948000 -- (-750.466) [-746.535] (-750.173) (-749.103) * (-746.029) (-748.767) (-755.466) [-747.502] -- 0:00:10
948500 -- (-753.488) (-747.600) [-749.893] (-752.165) * (-749.835) [-757.857] (-750.304) (-750.043) -- 0:00:10
949000 -- (-747.438) (-744.466) [-750.840] (-750.943) * [-758.157] (-745.680) (-748.331) (-754.520) -- 0:00:10
949500 -- (-752.715) (-744.672) [-752.381] (-748.839) * (-751.484) (-756.023) [-753.756] (-748.082) -- 0:00:09
950000 -- (-746.210) [-749.729] (-751.955) (-748.431) * [-748.958] (-744.462) (-755.096) (-752.115) -- 0:00:09
Average standard deviation of split frequencies: 0.008017
950500 -- (-745.213) [-757.300] (-744.632) (-751.738) * (-748.428) (-753.307) (-763.565) [-748.140] -- 0:00:09
951000 -- (-755.576) [-745.921] (-746.251) (-746.426) * (-749.739) (-750.774) [-753.349] (-747.311) -- 0:00:09
951500 -- (-757.776) (-744.877) (-751.776) [-749.198] * (-748.778) (-750.067) (-755.372) [-751.779] -- 0:00:09
952000 -- (-751.440) [-752.286] (-748.056) (-753.880) * (-753.953) (-748.029) (-755.676) [-748.354] -- 0:00:09
952500 -- (-752.565) (-753.393) (-750.838) [-748.471] * (-750.697) (-746.732) (-751.046) [-746.296] -- 0:00:09
953000 -- (-752.520) (-751.898) [-746.963] (-747.597) * [-748.484] (-751.675) (-760.955) (-748.322) -- 0:00:09
953500 -- (-748.062) (-751.305) (-745.907) [-745.429] * (-747.361) (-748.526) (-750.029) [-749.118] -- 0:00:09
954000 -- (-747.626) (-751.707) [-744.515] (-749.224) * (-756.009) (-746.195) (-751.828) [-747.337] -- 0:00:09
954500 -- (-752.403) (-749.115) [-750.352] (-750.358) * (-748.664) (-745.648) [-746.659] (-747.934) -- 0:00:09
955000 -- (-746.863) (-747.540) [-747.350] (-753.133) * (-749.663) (-747.296) [-743.747] (-755.494) -- 0:00:08
Average standard deviation of split frequencies: 0.007561
955500 -- (-746.945) (-744.746) (-764.766) [-752.706] * [-754.045] (-756.304) (-746.114) (-747.860) -- 0:00:08
956000 -- [-745.045] (-750.523) (-751.530) (-752.923) * (-748.252) (-753.933) [-747.678] (-749.469) -- 0:00:08
956500 -- (-749.084) [-746.326] (-751.422) (-752.703) * [-746.288] (-742.960) (-749.407) (-751.694) -- 0:00:08
957000 -- [-746.413] (-752.240) (-760.488) (-750.743) * (-753.591) (-745.714) (-748.956) [-746.805] -- 0:00:08
957500 -- (-747.996) [-748.213] (-751.859) (-746.338) * (-753.464) [-746.040] (-749.147) (-748.472) -- 0:00:08
958000 -- (-748.820) (-758.131) (-760.086) [-745.678] * (-751.271) (-747.891) [-755.029] (-758.429) -- 0:00:08
958500 -- (-746.811) (-749.552) [-747.872] (-746.557) * (-755.471) [-747.909] (-748.021) (-749.458) -- 0:00:08
959000 -- (-750.274) (-749.462) [-748.089] (-754.569) * [-752.392] (-749.960) (-747.947) (-746.279) -- 0:00:08
959500 -- (-752.531) (-749.526) [-747.419] (-747.742) * (-750.416) (-757.116) [-744.198] (-747.606) -- 0:00:08
960000 -- (-751.726) (-752.046) [-750.707] (-749.628) * [-745.642] (-749.221) (-750.049) (-751.497) -- 0:00:07
Average standard deviation of split frequencies: 0.007770
960500 -- (-751.388) (-747.420) (-750.247) [-751.757] * [-749.087] (-752.756) (-746.347) (-748.625) -- 0:00:07
961000 -- (-751.528) (-753.926) [-745.692] (-754.626) * (-753.666) [-753.588] (-749.768) (-748.264) -- 0:00:07
961500 -- (-756.033) (-753.348) [-749.909] (-755.762) * (-750.647) (-748.781) (-750.353) [-749.730] -- 0:00:07
962000 -- (-746.498) (-746.031) [-749.586] (-743.774) * (-748.361) (-753.267) [-747.022] (-750.744) -- 0:00:07
962500 -- (-757.285) [-749.865] (-750.151) (-750.586) * (-754.384) [-751.269] (-750.789) (-750.092) -- 0:00:07
963000 -- [-751.438] (-748.334) (-750.157) (-751.691) * (-753.798) (-746.806) (-756.974) [-745.358] -- 0:00:07
963500 -- [-746.684] (-746.632) (-748.086) (-751.981) * [-751.134] (-754.565) (-750.130) (-754.954) -- 0:00:07
964000 -- (-749.833) (-756.575) [-748.001] (-751.251) * (-753.510) (-745.962) (-746.645) [-750.066] -- 0:00:07
964500 -- (-750.517) (-754.682) [-744.125] (-757.400) * (-748.460) [-741.640] (-753.508) (-747.173) -- 0:00:07
965000 -- [-745.187] (-748.578) (-750.851) (-751.875) * (-755.003) (-745.760) (-751.352) [-749.574] -- 0:00:06
Average standard deviation of split frequencies: 0.007239
965500 -- (-747.920) (-755.670) [-751.675] (-751.154) * (-759.429) (-753.325) [-746.184] (-744.674) -- 0:00:06
966000 -- (-746.636) (-747.636) [-747.651] (-744.486) * (-748.177) [-754.650] (-749.873) (-753.488) -- 0:00:06
966500 -- (-747.462) (-763.360) [-746.202] (-744.746) * (-757.553) (-745.944) (-754.855) [-746.884] -- 0:00:06
967000 -- (-755.720) (-746.437) [-749.347] (-746.476) * (-760.257) (-749.823) [-752.122] (-755.718) -- 0:00:06
967500 -- (-751.604) (-760.120) [-748.741] (-749.882) * (-750.826) (-744.923) [-746.307] (-746.170) -- 0:00:06
968000 -- (-746.429) (-748.711) (-750.681) [-744.620] * (-743.695) [-746.978] (-748.726) (-749.799) -- 0:00:06
968500 -- (-750.559) (-742.836) (-749.132) [-745.887] * (-750.898) (-749.122) [-751.671] (-750.825) -- 0:00:06
969000 -- (-749.705) [-745.818] (-746.691) (-749.864) * (-753.363) [-751.032] (-749.880) (-752.251) -- 0:00:06
969500 -- (-751.188) (-748.678) [-746.061] (-747.972) * (-746.243) [-749.049] (-752.136) (-755.239) -- 0:00:06
970000 -- (-752.653) (-753.697) (-749.153) [-754.562] * (-751.659) (-755.917) (-752.411) [-751.136] -- 0:00:05
Average standard deviation of split frequencies: 0.007609
970500 -- [-752.568] (-752.865) (-749.520) (-752.890) * [-743.841] (-749.202) (-748.703) (-748.930) -- 0:00:05
971000 -- (-751.520) [-748.371] (-742.361) (-755.679) * (-744.012) (-744.363) [-750.618] (-746.436) -- 0:00:05
971500 -- (-764.919) (-748.536) (-750.318) [-755.618] * [-743.749] (-744.175) (-744.337) (-751.240) -- 0:00:05
972000 -- (-750.991) [-748.075] (-753.677) (-752.419) * (-742.941) (-755.139) [-756.629] (-751.870) -- 0:00:05
972500 -- (-751.686) [-750.354] (-759.760) (-750.921) * [-751.802] (-745.459) (-749.085) (-745.269) -- 0:00:05
973000 -- (-752.087) (-747.798) [-750.536] (-751.946) * (-745.585) [-749.846] (-755.296) (-751.140) -- 0:00:05
973500 -- (-749.816) (-750.688) (-752.118) [-746.706] * (-748.704) [-748.414] (-753.317) (-749.951) -- 0:00:05
974000 -- (-751.563) (-746.087) [-748.313] (-746.721) * [-749.572] (-753.731) (-748.319) (-752.180) -- 0:00:05
974500 -- [-749.427] (-753.628) (-745.612) (-757.463) * (-751.941) (-754.411) (-748.708) [-749.891] -- 0:00:05
975000 -- [-750.475] (-756.633) (-745.140) (-746.317) * (-753.994) (-744.424) [-745.443] (-750.383) -- 0:00:04
Average standard deviation of split frequencies: 0.007567
975500 -- [-750.383] (-753.052) (-750.011) (-751.939) * [-752.208] (-752.822) (-750.074) (-756.755) -- 0:00:04
976000 -- (-751.364) [-748.962] (-752.103) (-745.577) * (-754.079) (-749.210) [-753.518] (-752.743) -- 0:00:04
976500 -- (-749.589) (-747.341) [-751.771] (-750.496) * (-747.862) (-755.145) (-747.350) [-745.477] -- 0:00:04
977000 -- (-750.232) (-763.448) [-746.504] (-745.484) * (-752.441) (-752.039) (-748.637) [-748.636] -- 0:00:04
977500 -- [-749.611] (-753.710) (-749.671) (-749.268) * (-747.964) (-749.607) (-747.724) [-743.900] -- 0:00:04
978000 -- (-752.281) [-751.891] (-755.093) (-752.724) * (-749.652) (-745.228) [-743.549] (-758.230) -- 0:00:04
978500 -- (-751.020) (-757.417) [-742.408] (-750.493) * (-750.721) (-759.079) (-757.474) [-744.698] -- 0:00:04
979000 -- (-754.157) (-757.233) [-747.965] (-750.028) * (-752.449) (-751.205) (-748.887) [-747.569] -- 0:00:04
979500 -- (-754.282) [-744.537] (-752.508) (-753.662) * (-752.881) [-749.209] (-748.395) (-754.725) -- 0:00:04
980000 -- [-748.105] (-749.440) (-751.635) (-753.396) * (-748.458) (-755.652) [-748.931] (-752.222) -- 0:00:03
Average standard deviation of split frequencies: 0.007210
980500 -- (-742.031) [-747.403] (-755.204) (-749.929) * (-751.952) (-758.125) [-751.671] (-751.940) -- 0:00:03
981000 -- [-745.667] (-746.430) (-752.235) (-752.900) * (-752.892) [-750.372] (-751.298) (-750.896) -- 0:00:03
981500 -- (-748.507) [-745.004] (-753.615) (-751.129) * (-755.541) (-748.127) [-752.258] (-747.410) -- 0:00:03
982000 -- (-747.803) [-748.645] (-752.197) (-747.422) * (-752.600) (-756.545) [-747.398] (-749.878) -- 0:00:03
982500 -- (-744.939) (-753.922) [-744.971] (-748.934) * (-755.540) (-754.245) [-749.364] (-760.536) -- 0:00:03
983000 -- (-747.853) [-747.455] (-746.644) (-748.798) * (-749.902) (-752.939) [-748.631] (-754.662) -- 0:00:03
983500 -- (-748.657) (-751.260) [-748.004] (-749.775) * (-747.849) (-751.966) [-742.896] (-748.735) -- 0:00:03
984000 -- (-763.533) [-751.023] (-751.181) (-756.441) * (-748.974) (-753.604) (-749.662) [-748.451] -- 0:00:03
984500 -- (-753.461) [-748.608] (-749.686) (-749.920) * (-751.022) [-747.718] (-754.832) (-750.323) -- 0:00:03
985000 -- (-747.355) (-757.642) (-754.122) [-749.443] * (-750.362) [-753.927] (-755.757) (-754.672) -- 0:00:02
Average standard deviation of split frequencies: 0.006853
985500 -- (-746.600) (-752.347) (-744.996) [-746.581] * (-746.375) [-751.302] (-750.470) (-755.445) -- 0:00:02
986000 -- (-754.034) (-752.648) (-751.668) [-747.384] * [-753.699] (-748.213) (-749.013) (-754.474) -- 0:00:02
986500 -- (-751.515) (-750.144) (-749.736) [-750.081] * (-752.591) (-750.081) [-746.439] (-755.126) -- 0:00:02
987000 -- (-750.412) (-753.171) [-755.298] (-747.618) * (-755.159) (-745.589) [-749.227] (-762.692) -- 0:00:02
987500 -- (-750.450) (-750.680) (-748.834) [-744.742] * (-749.660) (-748.380) (-753.241) [-755.956] -- 0:00:02
988000 -- (-750.324) (-750.572) (-759.322) [-749.071] * (-748.097) (-743.451) [-748.900] (-753.904) -- 0:00:02
988500 -- (-753.029) (-747.848) [-747.065] (-749.535) * [-750.057] (-750.431) (-747.930) (-751.978) -- 0:00:02
989000 -- [-748.167] (-743.393) (-756.936) (-749.450) * [-751.020] (-749.407) (-750.026) (-746.878) -- 0:00:02
989500 -- [-748.376] (-753.074) (-753.425) (-748.728) * (-748.351) (-752.032) (-749.225) [-743.950] -- 0:00:02
990000 -- (-748.159) (-748.324) [-747.071] (-753.080) * (-757.149) [-752.980] (-751.794) (-749.130) -- 0:00:01
Average standard deviation of split frequencies: 0.006741
990500 -- (-757.792) [-747.679] (-745.182) (-750.962) * (-747.414) (-753.349) (-749.228) [-749.002] -- 0:00:01
991000 -- (-751.922) (-750.665) (-755.531) [-746.421] * (-748.015) [-757.533] (-751.534) (-745.243) -- 0:00:01
991500 -- (-757.374) (-754.032) (-747.790) [-749.079] * (-750.510) [-747.315] (-749.872) (-748.615) -- 0:00:01
992000 -- (-749.091) [-744.261] (-744.072) (-746.117) * [-748.838] (-750.090) (-751.021) (-745.494) -- 0:00:01
992500 -- (-747.319) (-754.852) (-750.748) [-748.573] * (-754.318) [-745.815] (-754.284) (-748.709) -- 0:00:01
993000 -- (-746.033) (-745.373) [-747.239] (-747.281) * (-752.504) [-756.541] (-746.363) (-756.548) -- 0:00:01
993500 -- [-746.150] (-752.252) (-749.986) (-752.915) * (-754.162) [-756.302] (-744.443) (-754.140) -- 0:00:01
994000 -- (-753.868) (-749.039) [-746.925] (-749.987) * (-753.020) [-750.039] (-746.510) (-753.187) -- 0:00:01
994500 -- (-755.491) [-747.128] (-751.157) (-756.344) * (-752.619) (-748.554) (-748.975) [-750.426] -- 0:00:01
995000 -- (-748.961) [-745.332] (-750.032) (-763.962) * (-755.300) (-752.112) (-745.067) [-748.153] -- 0:00:00
Average standard deviation of split frequencies: 0.006784
995500 -- (-754.529) (-746.533) [-753.597] (-749.843) * (-749.945) (-754.742) (-749.972) [-753.026] -- 0:00:00
996000 -- (-755.104) (-752.501) [-747.188] (-764.044) * (-745.662) (-752.276) [-747.837] (-747.077) -- 0:00:00
996500 -- (-751.916) (-747.932) (-758.866) [-749.344] * (-753.512) [-747.509] (-746.941) (-756.236) -- 0:00:00
997000 -- [-747.189] (-755.030) (-747.667) (-761.777) * [-744.973] (-753.499) (-751.441) (-748.224) -- 0:00:00
997500 -- (-750.538) (-750.432) (-746.620) [-746.357] * (-744.692) [-754.131] (-751.123) (-755.865) -- 0:00:00
998000 -- (-754.591) [-753.081] (-752.367) (-755.657) * (-753.095) (-754.112) (-756.992) [-746.335] -- 0:00:00
998500 -- (-751.417) [-745.904] (-753.390) (-756.724) * (-751.799) (-745.529) [-751.805] (-745.660) -- 0:00:00
999000 -- (-754.217) (-755.829) [-748.323] (-753.424) * (-750.843) (-748.386) (-749.950) [-754.677] -- 0:00:00
999500 -- (-749.340) (-744.652) (-757.177) [-756.425] * (-751.804) (-748.283) (-754.335) [-749.640] -- 0:00:00
1000000 -- [-750.986] (-752.056) (-752.079) (-759.660) * (-752.339) (-745.066) (-757.164) [-751.781] -- 0:00:00
Average standard deviation of split frequencies: 0.007302
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -750.986145 -- 14.938246
Chain 1 -- -750.986146 -- 14.938246
Chain 2 -- -752.055521 -- 18.266130
Chain 2 -- -752.055524 -- 18.266130
Chain 3 -- -752.079144 -- 12.024936
Chain 3 -- -752.079144 -- 12.024936
Chain 4 -- -759.660236 -- 20.249927
Chain 4 -- -759.660236 -- 20.249927
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -752.338922 -- 19.436846
Chain 1 -- -752.338923 -- 19.436846
Chain 2 -- -745.065512 -- 16.277953
Chain 2 -- -745.065516 -- 16.277953
Chain 3 -- -757.163946 -- 17.475591
Chain 3 -- -757.163945 -- 17.475591
Chain 4 -- -751.780874 -- 18.689862
Chain 4 -- -751.780874 -- 18.689862
Analysis completed in 3 mins 18 seconds
Analysis used 197.30 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -739.39
Likelihood of best state for "cold" chain of run 2 was -739.39
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
63.4 % ( 61 %) Dirichlet(Revmat{all})
76.5 % ( 66 %) Slider(Revmat{all})
35.6 % ( 33 %) Dirichlet(Pi{all})
36.2 % ( 18 %) Slider(Pi{all})
52.9 % ( 29 %) Multiplier(Alpha{1,2})
52.2 % ( 27 %) Multiplier(Alpha{3})
73.5 % ( 50 %) Slider(Pinvar{all})
17.6 % ( 14 %) ExtSPR(Tau{all},V{all})
8.5 % ( 5 %) ExtTBR(Tau{all},V{all})
17.3 % ( 11 %) NNI(Tau{all},V{all})
14.3 % ( 10 %) ParsSPR(Tau{all},V{all})
26.9 % ( 21 %) Multiplier(V{all})
40.0 % ( 50 %) Nodeslider(V{all})
26.2 % ( 20 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
64.3 % ( 49 %) Dirichlet(Revmat{all})
76.9 % ( 79 %) Slider(Revmat{all})
36.8 % ( 25 %) Dirichlet(Pi{all})
36.3 % ( 32 %) Slider(Pi{all})
53.7 % ( 22 %) Multiplier(Alpha{1,2})
52.3 % ( 23 %) Multiplier(Alpha{3})
73.7 % ( 52 %) Slider(Pinvar{all})
17.5 % ( 20 %) ExtSPR(Tau{all},V{all})
8.4 % ( 9 %) ExtTBR(Tau{all},V{all})
17.4 % ( 16 %) NNI(Tau{all},V{all})
14.3 % ( 8 %) ParsSPR(Tau{all},V{all})
26.9 % ( 31 %) Multiplier(V{all})
39.8 % ( 53 %) Nodeslider(V{all})
26.3 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.48
2 | 165896 0.81 0.65
3 | 166631 166308 0.83
4 | 166397 166801 167967
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.80 0.62 0.47
2 | 166753 0.81 0.65
3 | 166954 166115 0.82
4 | 166787 166903 166488
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -747.28
| 1 1 |
| 2 1 2 |
| 1 1 2 2 1 |
| 1 1 2 2 1|
| 2 1 21 1 1 1 2 1 1 1 |
|121 1 2 2*22 1 22 1 2 1 11 |
| 2 2 1 2 2 1 * 2 2 |
| 1 1 2 2 1 2 2 2 2 2 2 |
|2 1 2 1 11 1 2 12 1 1 2 |
| 2 211 *1 1 2 *22 2 1 2 1 2 |
| 1 2 2 1 1 1 1 |
| 2 2 12 1 2 1 1 |
| 1 2 |
| 2 2 22 |
| 1 1 2|
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -750.72
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -745.66 -756.02
2 -745.85 -756.44
--------------------------------------
TOTAL -745.75 -756.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.670063 0.019780 0.435403 0.965635 0.649173 1220.36 1280.36 1.000
r(A<->C){all} 0.055204 0.000708 0.008642 0.106611 0.051794 611.20 719.11 1.001
r(A<->G){all} 0.218578 0.004070 0.106325 0.347110 0.213521 404.58 481.49 1.001
r(A<->T){all} 0.080711 0.001986 0.005823 0.167304 0.074263 560.44 631.89 1.002
r(C<->G){all} 0.054583 0.001207 0.000007 0.117678 0.050115 562.32 809.92 1.003
r(C<->T){all} 0.394690 0.006668 0.240479 0.556010 0.391208 589.93 603.89 1.000
r(G<->T){all} 0.196234 0.004703 0.061776 0.322174 0.189339 591.04 612.68 1.004
pi(A){all} 0.323383 0.000702 0.270951 0.374311 0.323386 995.24 1074.20 1.000
pi(C){all} 0.280706 0.000610 0.231817 0.327500 0.280038 1032.84 1105.53 1.001
pi(G){all} 0.233521 0.000545 0.186129 0.276670 0.232525 931.81 1052.08 1.000
pi(T){all} 0.162390 0.000416 0.124464 0.202944 0.161538 1185.79 1192.52 1.000
alpha{1,2} 0.123088 0.006711 0.000268 0.250459 0.116768 1158.95 1235.82 1.000
alpha{3} 1.388007 0.444204 0.355061 2.670950 1.258338 1401.24 1437.42 1.000
pinvar{all} 0.241802 0.017815 0.000050 0.465975 0.235945 1253.32 1290.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
Key to taxon bipartitions (saved to file "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-------------
1 -- .******
2 -- .*.....
3 -- ..*....
4 -- ...*...
5 -- ....*..
6 -- .....*.
7 -- ......*
8 -- .**....
9 -- ...****
10 -- ...**..
11 -- ...**.*
12 -- ...***.
13 -- .....**
-------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
8 2999 0.999001 0.000471 0.998668 0.999334 2
9 2937 0.978348 0.005182 0.974684 0.982012 2
10 2863 0.953698 0.007066 0.948701 0.958694 2
11 1265 0.421386 0.014604 0.411059 0.431712 2
12 1139 0.379414 0.015546 0.368421 0.390406 2
13 598 0.199201 0.000942 0.198534 0.199867 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.049265 0.000543 0.010366 0.095744 0.045064 1.000 2
length{all}[2] 0.007436 0.000045 0.000007 0.021035 0.005531 1.000 2
length{all}[3] 0.007053 0.000040 0.000000 0.019348 0.005331 1.000 2
length{all}[4] 0.024409 0.000161 0.003098 0.049241 0.022393 1.000 2
length{all}[5] 0.020315 0.000141 0.000890 0.043001 0.018296 1.000 2
length{all}[6] 0.026725 0.000267 0.000106 0.057318 0.024159 1.000 2
length{all}[7] 0.341291 0.010258 0.167234 0.535946 0.325884 1.000 2
length{all}[8] 0.050559 0.000526 0.012029 0.095165 0.047137 1.000 2
length{all}[9] 0.074490 0.000995 0.019446 0.139037 0.070839 1.000 2
length{all}[10] 0.047325 0.000544 0.008538 0.096542 0.043870 1.000 2
length{all}[11] 0.025561 0.000478 0.000007 0.068728 0.019642 1.000 2
length{all}[12] 0.027295 0.000670 0.000047 0.080701 0.019028 1.000 2
length{all}[13] 0.013566 0.000174 0.000005 0.039709 0.009734 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.007302
Maximum standard deviation of split frequencies = 0.015546
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.000
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------ C2 (2)
|----------------------100----------------------+
| \------------------------ C3 (3)
+
| /------------------------ C4 (4)
| /-----------95----------+
| | \------------------------ C5 (5)
| |
\-----------98----------+------------------------------------------------ C6 (6)
|
\------------------------------------------------ C7 (7)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
| /- C2 (2)
|--------+
| \- C3 (3)
+
| /---- C4 (4)
| /-------+
| | \--- C5 (5)
| |
\------------+---- C6 (6)
|
\----------------------------------------------------------- C7 (7)
|--------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (10 trees sampled):
50 % credible set contains 2 trees
90 % credible set contains 3 trees
95 % credible set contains 4 trees
99 % credible set contains 6 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 7 ls = 270
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Sequences read..
Counting site patterns.. 0:00
69 patterns at 90 / 90 sites (100.0%), 0:00
Counting codons..
168 bytes for distance
67344 bytes for conP
9384 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (2, 3), ((4, 5), 6, 7)); MP score: 74
134688 bytes for conP, adjusted
0.083315 0.089634 0.000000 0.011769 0.097793 0.083852 0.056283 0.028299 0.079344 0.472056 0.300000 1.300000
ntime & nrate & np: 10 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 12
lnL0 = -814.162478
Iterating by ming2
Initial: fx= 814.162478
x= 0.08332 0.08963 0.00000 0.01177 0.09779 0.08385 0.05628 0.02830 0.07934 0.47206 0.30000 1.30000
1 h-m-p 0.0000 0.0000 122.4043 ++ 814.162289 m 0.0000 17 | 1/12
2 h-m-p 0.0000 0.0007 1110.6399 +++YCCCC 796.193388 4 0.0005 42 | 1/12
3 h-m-p 0.0003 0.0016 229.2237 +YYCCC 790.002961 4 0.0010 64 | 1/12
4 h-m-p 0.0007 0.0034 104.1591 YCYCCC 783.462025 5 0.0019 87 | 1/12
5 h-m-p 0.0002 0.0011 122.8170 +YYCYCC 780.580141 5 0.0008 110 | 1/12
6 h-m-p 0.0002 0.0018 441.3998 +YCCYC 749.646337 4 0.0016 133 | 1/12
7 h-m-p 0.0000 0.0000 8757.1570 CYCCCC 748.507458 5 0.0000 157 | 1/12
8 h-m-p 0.0039 0.0392 11.7263 YCCC 748.271071 3 0.0027 177 | 1/12
9 h-m-p 0.0129 0.1362 2.4705 CCCC 747.952210 3 0.0120 198 | 1/12
10 h-m-p 0.0043 0.0233 6.8365 +YCYCCC 744.681568 5 0.0124 222 | 1/12
11 h-m-p 0.0010 0.0048 51.8591 YCCCCC 740.514313 5 0.0023 246 | 1/12
12 h-m-p 0.0087 0.0466 13.5341 YCCC 740.191378 3 0.0036 266 | 1/12
13 h-m-p 0.1062 2.1179 0.4540 +CYCC 734.656082 3 0.4629 287 | 1/12
14 h-m-p 0.4659 2.3294 0.1631 +YYCYCC 726.561132 5 1.6697 321 | 1/12
15 h-m-p 0.1228 0.6140 0.2299 +YYYYCCC 723.422102 6 0.4764 356 | 1/12
16 h-m-p 0.6901 8.0000 0.1587 CCCC 722.173245 3 0.6486 388 | 1/12
17 h-m-p 0.3547 1.7736 0.0494 +YYYCCC 720.091935 5 1.3193 422 | 1/12
18 h-m-p 0.3937 3.5739 0.1655 +YYCC 718.069236 3 1.2351 453 | 1/12
19 h-m-p 1.0972 5.4861 0.1458 CYCCC 716.248899 4 1.4107 486 | 1/12
20 h-m-p 0.4840 2.4201 0.0830 +YCYCCC 715.233034 5 1.4378 521 | 1/12
21 h-m-p 0.9710 4.8552 0.0949 CCC 714.714594 2 0.9565 551 | 1/12
22 h-m-p 1.5017 7.5084 0.0464 YYC 714.535942 2 1.2500 579 | 1/12
23 h-m-p 1.6000 8.0000 0.0202 CCC 714.483593 2 1.8170 609 | 1/12
24 h-m-p 1.6000 8.0000 0.0061 CC 714.472227 1 1.8832 637 | 1/12
25 h-m-p 1.6000 8.0000 0.0047 YC 714.457583 1 3.7517 664 | 1/12
26 h-m-p 1.6000 8.0000 0.0099 +C 714.400199 0 6.4351 691 | 1/12
27 h-m-p 1.6000 8.0000 0.0318 CC 714.344348 1 2.5061 719 | 1/12
28 h-m-p 1.6000 8.0000 0.0054 YC 714.334522 1 1.2684 746 | 1/12
29 h-m-p 1.6000 8.0000 0.0035 CC 714.333115 1 1.8627 774 | 1/12
30 h-m-p 1.6000 8.0000 0.0007 YC 714.333062 1 1.1542 801 | 1/12
31 h-m-p 1.6000 8.0000 0.0001 C 714.333061 0 1.5096 827 | 1/12
32 h-m-p 1.6000 8.0000 0.0001 Y 714.333061 0 1.0280 853 | 1/12
33 h-m-p 1.6000 8.0000 0.0000 C 714.333061 0 1.6000 879 | 1/12
34 h-m-p 1.6000 8.0000 0.0000 Y 714.333061 0 1.0743 905 | 1/12
35 h-m-p 1.6000 8.0000 0.0000 -C 714.333061 0 0.0999 932 | 1/12
36 h-m-p 0.2850 8.0000 0.0000 --------------Y 714.333061 0 0.0000 972
Out..
lnL = -714.333061
973 lfun, 973 eigenQcodon, 9730 P(t)
Time used: 0:03
Model 1: NearlyNeutral
TREE # 1
(1, (2, 3), ((4, 5), 6, 7)); MP score: 74
0.083571 0.089316 0.000000 0.011837 0.096901 0.083833 0.056644 0.028272 0.079153 0.468964 1.373314 0.877411 0.315445
ntime & nrate & np: 10 2 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 10.037914
np = 13
lnL0 = -732.999881
Iterating by ming2
Initial: fx= 732.999881
x= 0.08357 0.08932 0.00000 0.01184 0.09690 0.08383 0.05664 0.02827 0.07915 0.46896 1.37331 0.87741 0.31544
1 h-m-p 0.0000 0.0000 110.2907 ++ 732.999721 m 0.0000 18 | 1/13
2 h-m-p 0.0000 0.0000 182519.7760 +YYYCYCCCC 709.864592 8 0.0000 47 | 1/13
3 h-m-p 0.0001 0.0003 209.8677 CYCCC 708.923300 4 0.0001 70 | 1/13
4 h-m-p 0.0002 0.0008 68.4144 CYCCC 708.462286 4 0.0003 93 | 1/13
5 h-m-p 0.0017 0.0166 11.5486 YCCC 708.246286 3 0.0030 114 | 1/13
6 h-m-p 0.0007 0.0034 32.7146 YCCC 708.160874 3 0.0005 135 | 1/13
7 h-m-p 0.0012 0.0414 12.4107 YCCC 708.120442 3 0.0008 156 | 1/13
8 h-m-p 0.0011 0.0500 8.9067 ++YYCC 707.555623 3 0.0140 178 | 1/13
9 h-m-p 0.0017 0.0245 71.8408 +YYYCC 705.599894 4 0.0068 200 | 1/13
10 h-m-p 0.0025 0.0124 20.0457 YYYC 705.393558 3 0.0024 219 | 1/13
11 h-m-p 0.0040 0.0255 12.1992 CCCC 705.048265 3 0.0068 241 | 1/13
12 h-m-p 0.0036 0.0191 22.9714 YYCC 704.800333 3 0.0028 261 | 1/13
13 h-m-p 0.0386 0.5245 1.6573 +CCCCC 703.665013 4 0.1917 286 | 0/13
14 h-m-p 0.0003 0.0015 372.9160 YCCC 703.594132 3 0.0001 307 | 0/13
15 h-m-p 1.6000 8.0000 0.0308 YCCC 703.462354 3 0.9945 328 | 0/13
16 h-m-p 0.2078 1.0389 0.0840 ++ 703.335402 m 1.0389 357 | 1/13
17 h-m-p 0.3381 5.7235 0.2578 YCCC 703.306005 3 0.1797 391 | 1/13
18 h-m-p 1.0999 6.2270 0.0421 CYC 703.254966 2 1.0723 422 | 1/13
19 h-m-p 1.6000 8.0000 0.0221 CCC 703.205110 2 2.3100 454 | 1/13
20 h-m-p 1.6000 8.0000 0.0146 +CC 703.031255 1 5.6636 485 | 1/13
21 h-m-p 0.9708 8.0000 0.0854 +YCCC 702.789528 3 2.7202 519 | 1/13
22 h-m-p 1.6000 8.0000 0.0192 YCC 702.731096 2 1.2051 550 | 1/13
23 h-m-p 1.5187 8.0000 0.0152 CC 702.724992 1 1.4269 580 | 1/13
24 h-m-p 1.6000 8.0000 0.0052 YC 702.723818 1 1.2124 609 | 1/13
25 h-m-p 1.6000 8.0000 0.0016 Y 702.723757 0 1.2343 637 | 1/13
26 h-m-p 1.6000 8.0000 0.0006 C 702.723748 0 1.4864 665 | 1/13
27 h-m-p 1.6000 8.0000 0.0001 C 702.723747 0 1.4942 693 | 1/13
28 h-m-p 1.6000 8.0000 0.0000 C 702.723747 0 1.6731 721 | 1/13
29 h-m-p 1.6000 8.0000 0.0000 Y 702.723747 0 1.1142 749 | 1/13
30 h-m-p 1.6000 8.0000 0.0000 Y 702.723747 0 1.1740 777 | 1/13
31 h-m-p 1.6000 8.0000 0.0000 Y 702.723747 0 1.6000 805 | 1/13
32 h-m-p 1.6000 8.0000 0.0000 ---C 702.723747 0 0.0063 836
Out..
lnL = -702.723747
837 lfun, 2511 eigenQcodon, 16740 P(t)
Time used: 0:08
Model 2: PositiveSelection
TREE # 1
(1, (2, 3), ((4, 5), 6, 7)); MP score: 74
initial w for M2:NSpselection reset.
0.081640 0.088041 0.000000 0.014510 0.096602 0.082732 0.058017 0.027885 0.077693 0.460149 1.506996 1.591876 0.136540 0.318247 2.382499
ntime & nrate & np: 10 3 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 6.343429
np = 15
lnL0 = -741.372241
Iterating by ming2
Initial: fx= 741.372241
x= 0.08164 0.08804 0.00000 0.01451 0.09660 0.08273 0.05802 0.02788 0.07769 0.46015 1.50700 1.59188 0.13654 0.31825 2.38250
1 h-m-p 0.0000 0.0000 100.0935 ++ 741.372091 m 0.0000 20 | 1/15
2 h-m-p 0.0000 0.0006 695.1235 +++ 716.157565 m 0.0006 39 | 1/15
3 h-m-p -0.0000 -0.0000 48.4742
h-m-p: -2.18606655e-19 -1.09303327e-18 4.84742217e+01 716.157565
.. | 1/15
4 h-m-p 0.0000 0.0017 60.2286 +++CYCYC 713.114091 4 0.0014 82 | 1/15
5 h-m-p 0.0001 0.0003 91.6050 YCYCCC 712.714718 5 0.0002 108 | 1/15
6 h-m-p 0.0002 0.0012 57.8832 +CYCC 711.911648 3 0.0008 132 | 1/15
7 h-m-p 0.0009 0.0096 51.5194 +YYCC 710.214018 3 0.0030 155 | 1/15
8 h-m-p 0.0013 0.0063 52.9468 YCYCCC 708.577246 5 0.0030 181 | 1/15
9 h-m-p 0.0039 0.0397 40.8230 CYCCC 707.727328 4 0.0031 206 | 1/15
10 h-m-p 0.0098 0.1131 12.8081 YCCC 707.389286 3 0.0064 229 | 1/15
11 h-m-p 0.0048 0.0241 16.6537 CYCCC 706.953907 4 0.0073 254 | 1/15
12 h-m-p 0.0050 0.0361 24.2849 YCCCC 706.143706 4 0.0108 279 | 1/15
13 h-m-p 0.0032 0.0159 35.5265 YYC 705.908707 2 0.0024 299 | 1/15
14 h-m-p 0.0320 0.1600 2.1883 YYC 705.810646 2 0.0256 319 | 1/15
15 h-m-p 0.0027 0.0877 20.6350 ++CCCC 703.984215 3 0.0446 345 | 1/15
16 h-m-p 0.1465 0.7327 1.1819 YCCC 703.440583 3 0.3417 368 | 1/15
17 h-m-p 0.0313 0.1566 1.9352 ++ 702.920512 m 0.1566 386 | 2/15
18 h-m-p 0.1157 8.0000 0.3833 YCCC 702.802651 3 0.2671 409 | 2/15
19 h-m-p 0.4537 8.0000 0.2256 CYC 702.740814 2 0.4958 443 | 2/15
20 h-m-p 0.6664 8.0000 0.1679 CCC 702.724801 2 0.5423 478 | 2/15
21 h-m-p 1.6000 8.0000 0.0089 CC 702.723826 1 0.5188 511 | 2/15
22 h-m-p 1.4657 8.0000 0.0031 YC 702.723753 1 0.8346 543 | 2/15
23 h-m-p 1.5207 8.0000 0.0017 Y 702.723747 0 0.6228 574 | 2/15
24 h-m-p 1.6000 8.0000 0.0002 Y 702.723747 0 0.7568 605 | 2/15
25 h-m-p 1.6000 8.0000 0.0000 Y 702.723747 0 0.6759 636 | 2/15
26 h-m-p 1.6000 8.0000 0.0000 Y 702.723747 0 0.6600 667 | 2/15
27 h-m-p 1.6000 8.0000 0.0000 --------Y 702.723747 0 0.0000 706
Out..
lnL = -702.723747
707 lfun, 2828 eigenQcodon, 21210 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -713.275795 S = -672.212078 -33.337309
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 69 patterns 0:14
did 20 / 69 patterns 0:14
did 30 / 69 patterns 0:14
did 40 / 69 patterns 0:14
did 50 / 69 patterns 0:14
did 60 / 69 patterns 0:14
did 69 / 69 patterns 0:14
Time used: 0:14
Model 3: discrete
TREE # 1
(1, (2, 3), ((4, 5), 6, 7)); MP score: 74
0.083720 0.089994 0.000000 0.011677 0.097449 0.083604 0.056221 0.028283 0.079097 0.472773 1.506995 0.465673 0.549129 0.039292 0.087454 0.163376
ntime & nrate & np: 10 4 16
Bounds (np=16):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 19.254227
np = 16
lnL0 = -712.806852
Iterating by ming2
Initial: fx= 712.806852
x= 0.08372 0.08999 0.00000 0.01168 0.09745 0.08360 0.05622 0.02828 0.07910 0.47277 1.50699 0.46567 0.54913 0.03929 0.08745 0.16338
1 h-m-p 0.0000 0.0000 94.8496 ++ 712.806739 m 0.0000 21 | 1/16
2 h-m-p 0.0000 0.0000 8387.0294 ++ 709.009857 m 0.0000 40 | 2/16
3 h-m-p 0.0002 0.0011 121.9172 +YYYYYYCCCC 705.908529 9 0.0009 72 | 1/16
4 h-m-p 0.0000 0.0000 1486.2324 ++ 704.772382 m 0.0000 91 | 2/16
5 h-m-p 0.0004 0.0052 83.2885 +YCCC 704.022977 3 0.0010 116 | 2/16
6 h-m-p 0.0000 0.0000 160.1272 ++ 703.969899 m 0.0000 135 | 2/16
7 h-m-p 0.0002 0.0009 19.9353 +CC 703.833735 1 0.0007 157 | 2/16
8 h-m-p 0.0001 0.0003 32.3472 ++ 703.754548 m 0.0003 176 | 2/16
9 h-m-p 0.0000 0.0000 126.6745
h-m-p: 2.42941443e-21 1.21470722e-20 1.26674492e+02 703.754548
.. | 2/16
10 h-m-p 0.0000 0.0112 387.7303 CYCCC 703.087503 4 0.0000 218 | 2/16
11 h-m-p 0.0000 0.0002 38.6662 ++ 702.815457 m 0.0002 237 | 3/16
12 h-m-p 0.0001 0.0051 51.7964 +CCC 702.532287 2 0.0005 261 | 3/16
13 h-m-p 0.0007 0.0034 38.5417 CYCCC 702.003029 4 0.0013 287 | 3/16
14 h-m-p 0.0047 0.0238 10.2877 YCCC 701.895344 3 0.0025 311 | 3/16
15 h-m-p 0.0014 0.0133 18.1896 CCC 701.796921 2 0.0016 334 | 3/16
16 h-m-p 0.0014 0.0101 22.1616 CCC 701.707045 2 0.0014 357 | 3/16
17 h-m-p 0.0019 0.0189 16.0541 YCC 701.665433 2 0.0011 379 | 3/16
18 h-m-p 0.0052 0.0404 3.4168 YC 701.656055 1 0.0021 399 | 3/16
19 h-m-p 0.0046 1.9325 1.6064 ++CCC 701.541508 2 0.1113 424 | 3/16
20 h-m-p 0.0042 0.0212 27.0098 YCCC 701.506113 3 0.0021 448 | 3/16
21 h-m-p 0.0265 1.4640 2.0949 YCC 701.490741 2 0.0155 470 | 3/16
22 h-m-p 0.1279 6.1318 0.2541 YC 701.476925 1 0.2493 490 | 3/16
23 h-m-p 1.4168 7.0841 0.0447 YC 701.459951 1 0.6367 523 | 3/16
24 h-m-p 1.6000 8.0000 0.0056 YC 701.456819 1 0.8893 556 | 3/16
25 h-m-p 1.6000 8.0000 0.0012 YC 701.456633 1 0.9841 589 | 3/16
26 h-m-p 1.6000 8.0000 0.0003 Y 701.456629 0 1.1424 621 | 3/16
27 h-m-p 1.6000 8.0000 0.0001 Y 701.456628 0 1.1619 653 | 3/16
28 h-m-p 1.6000 8.0000 0.0000 Y 701.456628 0 0.8767 685 | 3/16
29 h-m-p 1.6000 8.0000 0.0000 C 701.456628 0 1.5120 717 | 3/16
30 h-m-p 1.6000 8.0000 0.0000 ---Y 701.456628 0 0.0063 752
Out..
lnL = -701.456628
753 lfun, 3012 eigenQcodon, 22590 P(t)
Time used: 0:21
Model 7: beta
TREE # 1
(1, (2, 3), ((4, 5), 6, 7)); MP score: 74
0.083763 0.090016 0.000000 0.011824 0.097491 0.083632 0.056135 0.028097 0.078958 0.472627 1.370677 0.702842 1.818396
ntime & nrate & np: 10 1 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 12.541240
np = 13
lnL0 = -719.423483
Iterating by ming2
Initial: fx= 719.423483
x= 0.08376 0.09002 0.00000 0.01182 0.09749 0.08363 0.05614 0.02810 0.07896 0.47263 1.37068 0.70284 1.81840
1 h-m-p 0.0000 0.0000 74.4114 ++ 719.423402 m 0.0000 18 | 1/13
2 h-m-p 0.0000 0.0017 300.5966 ++YYCCC 718.281268 4 0.0002 42 | 1/13
3 h-m-p 0.0005 0.0026 72.8470 +YYCCCC 715.752120 5 0.0017 67 | 1/13
4 h-m-p 0.0007 0.0035 173.4547 +YYCYCCC 707.053201 6 0.0022 93 | 1/13
5 h-m-p 0.0005 0.0025 65.9070 CYCCC 706.271867 4 0.0009 116 | 1/13
6 h-m-p 0.0038 0.0191 7.1164 YCCC 706.206079 3 0.0024 137 | 1/13
7 h-m-p 0.0014 0.0306 12.5354 YCC 706.116972 2 0.0023 156 | 1/13
8 h-m-p 0.0021 0.0353 13.8126 +YCC 705.897013 2 0.0058 176 | 1/13
9 h-m-p 0.0099 0.0494 5.2008 YCCC 705.842171 3 0.0048 197 | 1/13
10 h-m-p 0.0035 0.0716 6.9974 +YYC 705.660160 2 0.0124 216 | 1/13
11 h-m-p 0.0056 0.0325 15.4938 YYC 705.527443 2 0.0043 234 | 1/13
12 h-m-p 0.2775 1.5049 0.2404 YCCC 703.901820 3 0.6173 255 | 1/13
13 h-m-p 0.3064 1.5318 0.3699 YCYCCC 703.434457 5 0.7264 291 | 1/13
14 h-m-p 0.3242 2.2653 0.8287 +YYYYYYCYCC 702.209751 10 1.4894 332 | 1/13
15 h-m-p 0.1014 0.5069 1.2968 YYYCCCCC 702.088647 7 0.1097 371 | 1/13
16 h-m-p 1.1129 7.7206 0.1278 YCC 701.913857 2 0.8860 390 | 1/13
17 h-m-p 0.2595 2.4999 0.4364 CCC 701.872742 2 0.2406 422 | 1/13
18 h-m-p 1.1034 6.8637 0.0952 YC 701.856741 1 0.5750 451 | 1/13
19 h-m-p 1.0073 8.0000 0.0543 YCC 701.845394 2 0.8374 482 | 1/13
20 h-m-p 1.6000 8.0000 0.0155 YC 701.841506 1 1.1386 511 | 1/13
21 h-m-p 1.6000 8.0000 0.0027 CC 701.840133 1 1.9334 541 | 1/13
22 h-m-p 1.6000 8.0000 0.0017 C 701.839873 0 1.4395 569 | 1/13
23 h-m-p 1.6000 8.0000 0.0012 Y 701.839867 0 0.7083 597 | 1/13
24 h-m-p 1.6000 8.0000 0.0002 Y 701.839866 0 0.9252 625 | 1/13
25 h-m-p 1.6000 8.0000 0.0000 Y 701.839866 0 1.1697 653 | 1/13
26 h-m-p 1.6000 8.0000 0.0000 Y 701.839866 0 0.8613 681 | 1/13
27 h-m-p 1.6000 8.0000 0.0000 C 701.839866 0 1.6000 709 | 1/13
28 h-m-p 1.6000 8.0000 0.0000 -C 701.839866 0 0.1000 738 | 1/13
29 h-m-p 0.1383 8.0000 0.0000 ---C 701.839866 0 0.0005 769
Out..
lnL = -701.839866
770 lfun, 8470 eigenQcodon, 77000 P(t)
Time used: 0:42
Model 8: beta&w>1
TREE # 1
(1, (2, 3), ((4, 5), 6, 7)); MP score: 74
initial w for M8:NSbetaw>1 reset.
0.083825 0.089231 0.000000 0.012271 0.096625 0.084051 0.057327 0.029703 0.079126 0.465603 1.394573 0.900000 1.017304 1.339697 2.499728
ntime & nrate & np: 10 2 15
Bounds (np=15):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.193612
np = 15
lnL0 = -737.439908
Iterating by ming2
Initial: fx= 737.439908
x= 0.08383 0.08923 0.00000 0.01227 0.09662 0.08405 0.05733 0.02970 0.07913 0.46560 1.39457 0.90000 1.01730 1.33970 2.49973
1 h-m-p 0.0000 0.0000 103.6234 ++ 737.439736 m 0.0000 20 | 1/15
2 h-m-p 0.0000 0.0004 328.1595 +++ 732.919651 m 0.0004 39 | 2/15
3 h-m-p 0.0020 0.0138 36.3992 +YCYCCCC 727.746429 6 0.0091 68 | 2/15
4 h-m-p 0.0003 0.0013 671.7108 +YYYCCCC 714.016256 6 0.0009 96 | 2/15
5 h-m-p 0.0001 0.0007 258.8705 CCCCC 713.415676 4 0.0002 122 | 2/15
6 h-m-p 0.0006 0.0032 29.5964 CCCCC 713.124037 4 0.0009 148 | 1/15
7 h-m-p 0.0004 0.0135 76.2381 CYCCC 711.874881 4 0.0005 173 | 1/15
8 h-m-p 0.0021 0.0262 16.5399 +CYC 709.466042 2 0.0129 195 | 1/15
9 h-m-p 0.0018 0.0091 21.7325 YCCCC 708.711657 4 0.0039 220 | 1/15
10 h-m-p 0.0061 0.0304 8.5443 YCC 708.559474 2 0.0038 241 | 1/15
11 h-m-p 0.0085 0.0877 3.8432 +YYYCCCCC 708.059291 7 0.0377 271 | 1/15
12 h-m-p 0.0054 0.0269 14.0702 YCC 707.925897 2 0.0033 292 | 1/15
13 h-m-p 0.0218 0.2507 2.1034 +YYC 707.484943 2 0.0708 313 | 1/15
14 h-m-p 0.0845 0.4812 1.7630 +YYCCC 705.172803 4 0.2889 338 | 1/15
15 h-m-p 0.3446 1.7230 1.3330 CYCCCC 703.756688 5 0.5340 365 | 1/15
16 h-m-p 0.1406 0.7031 1.2547 +YCCC 703.027738 3 0.4520 389 | 1/15
17 h-m-p 0.0597 0.2984 1.0448 ++ 702.617705 m 0.2984 407 | 1/15
18 h-m-p 0.4883 2.4416 0.2829 CCC 702.427267 2 0.5568 429 | 1/15
19 h-m-p 0.1126 0.5629 0.1329 ++ 702.284710 m 0.5629 461 | 2/15
20 h-m-p 0.2738 4.5697 0.1424 +YCC 702.140566 2 0.7842 497 | 2/15
21 h-m-p 1.5736 8.0000 0.0710 YCCC 702.062934 3 1.0438 533 | 2/15
22 h-m-p 0.7181 8.0000 0.1031 CCC 702.036128 2 0.9453 568 | 2/15
23 h-m-p 1.6000 8.0000 0.0577 YC 702.025850 1 1.1086 600 | 2/15
24 h-m-p 1.0372 8.0000 0.0617 +CYC 701.993863 2 3.7031 635 | 2/15
25 h-m-p 1.6000 8.0000 0.1255 CCCC 701.963274 3 1.8898 672 | 2/15
26 h-m-p 0.4890 2.7442 0.4849 CYCCCC 701.912422 5 0.7423 712 | 2/15
27 h-m-p 1.3875 6.9374 0.1025 CCC 701.854939 2 1.1006 747 | 2/15
28 h-m-p 1.1331 5.6655 0.0944 CCC 701.841052 2 0.3690 782 | 2/15
29 h-m-p 0.5678 8.0000 0.0613 C 701.836746 0 0.5623 813 | 2/15
30 h-m-p 0.3587 8.0000 0.0961 CCC 701.832926 2 0.5870 848 | 2/15
31 h-m-p 1.6000 8.0000 0.0115 CC 701.826060 1 1.7655 881 | 2/15
32 h-m-p 0.8464 8.0000 0.0240 CC 701.823286 1 1.0171 914 | 2/15
33 h-m-p 1.6000 8.0000 0.0018 YC 701.823079 1 0.8355 946 | 2/15
34 h-m-p 0.7895 8.0000 0.0020 C 701.823063 0 1.2159 977 | 2/15
35 h-m-p 1.6000 8.0000 0.0003 Y 701.823059 0 1.1986 1008 | 2/15
36 h-m-p 1.3771 8.0000 0.0003 Y 701.823059 0 1.0219 1039 | 2/15
37 h-m-p 1.6000 8.0000 0.0000 Y 701.823059 0 0.9055 1070 | 2/15
38 h-m-p 1.6000 8.0000 0.0000 Y 701.823059 0 0.9589 1101 | 2/15
39 h-m-p 1.6000 8.0000 0.0000 Y 701.823059 0 3.1291 1132 | 2/15
40 h-m-p 1.5047 8.0000 0.0000 -C 701.823059 0 0.0940 1164 | 2/15
41 h-m-p 0.0378 8.0000 0.0000 --Y 701.823059 0 0.0006 1197
Out..
lnL = -701.823059
1198 lfun, 14376 eigenQcodon, 131780 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -713.626777 S = -673.224939 -33.226720
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 69 patterns 1:19
did 20 / 69 patterns 1:20
did 30 / 69 patterns 1:20
did 40 / 69 patterns 1:20
did 50 / 69 patterns 1:20
did 60 / 69 patterns 1:20
did 69 / 69 patterns 1:20
Time used: 1:20
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=7, Len=90
D_melanogaster_Z600-PA MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS
D_sechellia_Z600-PA MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
D_simulans_Z600-PA MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS
D_yakuba_Z600-PA MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
D_yakuba_Z600-PA MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
D_erecta_Z600-PA MSSTNETNQVLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS
D_takahashii_Z600-PA MSMINETNQMLQRLNSLKIVETPKEQRELGSRECYSLDSKKYALVPATPS
** *****:****************:*:*.***********:*******
D_melanogaster_Z600-PA SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF
D_sechellia_Z600-PA SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
D_simulans_Z600-PA SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF
D_yakuba_Z600-PA SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
D_yakuba_Z600-PA SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF
D_erecta_Z600-PA SGGHGKFQTELKKRRKNKLNRMCTYEADKLFIKARKSLNF
D_takahashii_Z600-PA TGGPGKFQTELKKRRKNKLNRMYTYEADKHFIKARKSLNF
:.* **************:**: ****** **********
>D_melanogaster_Z600-PA ATGTCGTCGACAAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT GAAAATCGTGGAAACCCCAAAGGAGCAGCATGAGTTCGGAAAACGCGAGT GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC AGCTCAGGACACGGAAAGTTCCAAACCGAACTCAAAAAGCGCCGCAAAAA CAAACTGAATCGCATGTACACTTACGAGGCTGATAAGAATTTCATCAAGG CTCGCAAATCTTTGAACTTC >D_sechellia_Z600-PA ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT GAAAATCGTGGAAACCCCAAAGGAGCAGAAGGAATTTGGAAAACGCGAGT GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC AGCTCAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAACGTCGCAAGAA CAAACTGAATCGCCTTTACACTTACGAGGCTGACAAGAATTTCATCAAGG CGCGCAAGTCTTTAAACTTC >D_simulans_Z600-PA ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTGAACAGCCT GAAAATCGTGGAAACCCCAAAGGAGCAGAAGGAATTTGGAAAACGCGAGT GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCCAGC AGCTCAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAACGCCGCAAGAA CAAACTGAATCGCCTTTACACTTACGAGGCTGACAAGAATTTCATCAAGG CGCGCAAGTCTTTAAACTTC >D_yakuba_Z600-PA ATGTCGTCGACCAATGAAACCAACCAACTGCTGCAGCGCTTGAACAGCTT GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCAACCCCTAGC AGCGGAGGACTTGGAAAGTTCCAAACCGAACTCAAGAAACGTCGCAAAAA CAAAGTGAATCGCATGTGCACTTACGAGGCTGACAAGCAATTCATCAAGG CACGCAAATCATTGAATTTC >D_yakuba_Z600-PA ATGTCGTCGACCAATGAAACCAACCAACTGCTGCAGCGCCTGAACAGCTT GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCGAGC AGCGGAGGGCTCGGAAAGTTCCAAACTGAACTCAAAAAACGTCGCAAAAA CAAAGTGAATCGCATGTGCACTTACGAGGCTGACAAGCAATTCATCAAGG CACGCAAATCATTGAATTTC >D_erecta_Z600-PA ATGTCGTCGACCAATGAAACCAACCAAGTGCTGCAGCGCCTAAACAGCTT GAAAATCGTGGAAACCCCAAAGGAGCAGAGGGAGTTGGGGAAACGCGAGT GCTACTCCCTGGACAGCAAGAAGTATTCCCTGGTACCAGCCACCCCTAGC AGCGGAGGACACGGAAAGTTCCAAACCGAGCTCAAAAAGCGTCGCAAAAA CAAACTGAATCGCATGTGCACTTACGAGGCTGACAAGCTTTTTATCAAGG CGCGCAAATCCTTGAATTTC >D_takahashii_Z600-PA ATGTCGATGATCAACGAAACCAACCAAATGTTGCAGCGCCTGAACAGCCT GAAAATTGTGGAAACCCCCAAGGAGCAACGCGAATTGGGCAGTCGGGAGT GTTACTCTCTGGACAGCAAGAAGTATGCCCTGGTACCAGCCACCCCGAGC ACCGGAGGACCCGGAAAGTTCCAAACCGAACTGAAGAAACGTCGCAAAAA CAAACTCAACCGAATGTACACCTACGAGGCGGACAAACACTTTATCAAGG CTCGCAAGTCTTTGAATTTC
>D_melanogaster_Z600-PA MSSTNETNQVLQRLNSLKIVETPKEQHEFGKRECYSLDSKKYSLVPATPS SSGHGKFQTELKKRRKNKLNRMYTYEADKNFIKARKSLNF >D_sechellia_Z600-PA MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF >D_simulans_Z600-PA MSSTNETNQVLQRLNSLKIVETPKEQKEFGKRECYSLDSKKYSLVPATPS SSGHGKFQTELKKRRKNKLNRLYTYEADKNFIKARKSLNF >D_yakuba_Z600-PA MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF >D_yakuba_Z600-PA MSSTNETNQLLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS SGGLGKFQTELKKRRKNKVNRMCTYEADKQFIKARKSLNF >D_erecta_Z600-PA MSSTNETNQVLQRLNSLKIVETPKEQRELGKRECYSLDSKKYSLVPATPS SGGHGKFQTELKKRRKNKLNRMCTYEADKLFIKARKSLNF >D_takahashii_Z600-PA MSMINETNQMLQRLNSLKIVETPKEQRELGSRECYSLDSKKYALVPATPS TGGPGKFQTELKKRRKNKLNRMYTYEADKHFIKARKSLNF
#NEXUS
[ID: 0641715986]
begin taxa;
dimensions ntax=7;
taxlabels
D_melanogaster_Z600-PA
D_sechellia_Z600-PA
D_simulans_Z600-PA
D_yakuba_Z600-PA
D_yakuba_Z600-PA
D_erecta_Z600-PA
D_takahashii_Z600-PA
;
end;
begin trees;
translate
1 D_melanogaster_Z600-PA,
2 D_sechellia_Z600-PA,
3 D_simulans_Z600-PA,
4 D_yakuba_Z600-PA,
5 D_yakuba_Z600-PA,
6 D_erecta_Z600-PA,
7 D_takahashii_Z600-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.04506413,(2:0.005530785,3:0.005330718)0.999:0.04713672,((4:0.02239267,5:0.01829593)0.954:0.04386967,6:0.02415904,7:0.3258837)0.978:0.07083936);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.04506413,(2:0.005530785,3:0.005330718):0.04713672,((4:0.02239267,5:0.01829593):0.04386967,6:0.02415904,7:0.3258837):0.07083936);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -745.66 -756.02
2 -745.85 -756.44
--------------------------------------
TOTAL -745.75 -756.25
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/442/Z600-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.670063 0.019780 0.435403 0.965635 0.649173 1220.36 1280.36 1.000
r(A<->C){all} 0.055204 0.000708 0.008642 0.106611 0.051794 611.20 719.11 1.001
r(A<->G){all} 0.218578 0.004070 0.106325 0.347110 0.213521 404.58 481.49 1.001
r(A<->T){all} 0.080711 0.001986 0.005823 0.167304 0.074263 560.44 631.89 1.002
r(C<->G){all} 0.054583 0.001207 0.000007 0.117678 0.050115 562.32 809.92 1.003
r(C<->T){all} 0.394690 0.006668 0.240479 0.556010 0.391208 589.93 603.89 1.000
r(G<->T){all} 0.196234 0.004703 0.061776 0.322174 0.189339 591.04 612.68 1.004
pi(A){all} 0.323383 0.000702 0.270951 0.374311 0.323386 995.24 1074.20 1.000
pi(C){all} 0.280706 0.000610 0.231817 0.327500 0.280038 1032.84 1105.53 1.001
pi(G){all} 0.233521 0.000545 0.186129 0.276670 0.232525 931.81 1052.08 1.000
pi(T){all} 0.162390 0.000416 0.124464 0.202944 0.161538 1185.79 1192.52 1.000
alpha{1,2} 0.123088 0.006711 0.000268 0.250459 0.116768 1158.95 1235.82 1.000
alpha{3} 1.388007 0.444204 0.355061 2.670950 1.258338 1401.24 1437.42 1.000
pinvar{all} 0.241802 0.017815 0.000050 0.465975 0.235945 1253.32 1290.95 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/442/Z600-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 7 ls = 90
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 0 1 1 0 0 1 | Ser TCT 1 1 1 0 0 0 | Tyr TAT 1 1 1 1 1 1 | Cys TGT 0 0 0 0 0 0
TTC 4 3 3 3 3 2 | TCC 2 2 2 2 2 3 | TAC 3 3 3 2 2 2 | TGC 1 1 1 2 2 2
Leu TTA 0 1 1 0 0 0 | TCA 1 1 1 1 1 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 0 0 4 3 3 | TCG 2 2 2 2 2 2 | TAG 0 0 0 0 0 0 | Trp TGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 0 1 1 1 0 1 | Pro CCT 0 0 0 1 0 1 | His CAT 1 0 0 0 0 0 | Arg CGT 0 1 0 1 1 1
CTC 1 1 1 1 2 1 | CCC 1 1 1 0 0 0 | CAC 1 1 1 0 0 1 | CGC 6 5 6 5 5 5
CTA 0 0 0 0 0 1 | CCA 2 2 2 2 2 2 | Gln CAA 2 2 2 3 3 2 | CGA 0 0 0 0 0 0
CTG 6 6 6 4 5 4 | CCG 0 0 0 0 1 0 | CAG 2 2 2 2 2 2 | CGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 0 0 0 0 0 0 | Thr ACT 1 1 1 1 2 1 | Asn AAT 3 3 3 3 3 3 | Ser AGT 0 0 0 0 0 0
ATC 2 2 2 2 2 2 | ACC 4 5 5 5 4 5 | AAC 4 4 4 3 3 3 | AGC 4 4 4 4 4 4
ATA 0 0 0 0 0 0 | ACA 1 0 0 0 0 0 | Lys AAA 6 5 5 6 7 6 | Arg AGA 0 0 0 0 0 0
Met ATG 2 1 1 2 2 2 | ACG 0 0 0 0 0 0 | AAG 7 9 9 7 6 7 | AGG 0 0 0 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 0 0 0 0 0 0 | Ala GCT 2 1 1 1 1 1 | Asp GAT 1 0 0 0 0 0 | Gly GGT 0 0 0 0 0 0
GTC 0 0 0 0 0 0 | GCC 1 1 1 0 1 1 | GAC 1 2 2 2 2 2 | GGC 0 0 0 0 0 0
GTA 1 1 1 1 1 1 | GCA 0 0 0 2 1 0 | Glu GAA 3 3 3 3 3 2 | GGA 3 3 3 3 2 3
GTG 2 2 2 2 2 2 | GCG 0 1 1 0 0 1 | GAG 4 4 4 4 4 5 | GGG 0 0 0 1 2 1
--------------------------------------------------------------------------------------------------------------------------------------
------------------------------------------------------
Phe TTT 1 | Ser TCT 2 | Tyr TAT 1 | Cys TGT 1
TTC 2 | TCC 0 | TAC 3 | TGC 0
Leu TTA 0 | TCA 0 | *** TAA 0 | *** TGA 0
TTG 3 | TCG 1 | TAG 0 | Trp TGG 0
------------------------------------------------------
Leu CTT 0 | Pro CCT 0 | His CAT 0 | Arg CGT 1
CTC 1 | CCC 2 | CAC 1 | CGC 4
CTA 0 | CCA 1 | Gln CAA 3 | CGA 1
CTG 5 | CCG 1 | CAG 1 | CGG 1
------------------------------------------------------
Ile ATT 1 | Thr ACT 0 | Asn AAT 1 | Ser AGT 1
ATC 2 | ACC 6 | AAC 5 | AGC 3
ATA 0 | ACA 0 | Lys AAA 5 | Arg AGA 0
Met ATG 4 | ACG 0 | AAG 7 | AGG 0
------------------------------------------------------
Val GTT 0 | Ala GCT 1 | Asp GAT 0 | Gly GGT 0
GTC 0 | GCC 2 | GAC 2 | GGC 1
GTA 1 | GCA 0 | Glu GAA 4 | GGA 3
GTG 1 | GCG 1 | GAG 3 | GGG 0
------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Z600-PA
position 1: T:0.17778 C:0.24444 A:0.37778 G:0.20000
position 2: T:0.21111 C:0.20000 A:0.43333 G:0.15556
position 3: T:0.11111 C:0.38889 A:0.21111 G:0.28889
Average T:0.16667 C:0.27778 A:0.34074 G:0.21481
#2: D_sechellia_Z600-PA
position 1: T:0.17778 C:0.24444 A:0.37778 G:0.20000
position 2: T:0.21111 C:0.20000 A:0.43333 G:0.15556
position 3: T:0.11111 C:0.38889 A:0.20000 G:0.30000
Average T:0.16667 C:0.27778 A:0.33704 G:0.21852
#3: D_simulans_Z600-PA
position 1: T:0.17778 C:0.24444 A:0.37778 G:0.20000
position 2: T:0.21111 C:0.20000 A:0.43333 G:0.15556
position 3: T:0.10000 C:0.40000 A:0.20000 G:0.30000
Average T:0.16296 C:0.28148 A:0.33704 G:0.21852
#4: D_yakuba_Z600-PA
position 1: T:0.18889 C:0.22222 A:0.37778 G:0.21111
position 2: T:0.22222 C:0.18889 A:0.40000 G:0.18889
position 3: T:0.10000 C:0.34444 A:0.23333 G:0.32222
Average T:0.17037 C:0.25185 A:0.33704 G:0.24074
#5: D_yakuba_Z600-PA
position 1: T:0.17778 C:0.23333 A:0.37778 G:0.21111
position 2: T:0.22222 C:0.18889 A:0.40000 G:0.18889
position 3: T:0.08889 C:0.35556 A:0.22222 G:0.33333
Average T:0.16296 C:0.25926 A:0.33333 G:0.24444
#6: D_erecta_Z600-PA
position 1: T:0.17778 C:0.23333 A:0.37778 G:0.21111
position 2: T:0.22222 C:0.18889 A:0.40000 G:0.18889
position 3: T:0.11111 C:0.36667 A:0.18889 G:0.33333
Average T:0.17037 C:0.26296 A:0.32222 G:0.24444
#7: D_takahashii_Z600-PA
position 1: T:0.15556 C:0.24444 A:0.38889 G:0.21111
position 2: T:0.23333 C:0.18889 A:0.40000 G:0.17778
position 3: T:0.11111 C:0.37778 A:0.20000 G:0.31111
Average T:0.16667 C:0.27037 A:0.32963 G:0.23333
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 4 | Ser S TCT 5 | Tyr Y TAT 7 | Cys C TGT 1
TTC 20 | TCC 13 | TAC 18 | TGC 9
Leu L TTA 2 | TCA 5 | *** * TAA 0 | *** * TGA 0
TTG 14 | TCG 13 | TAG 0 | Trp W TGG 0
------------------------------------------------------------------------------
Leu L CTT 4 | Pro P CCT 2 | His H CAT 1 | Arg R CGT 5
CTC 8 | CCC 5 | CAC 5 | CGC 36
CTA 1 | CCA 13 | Gln Q CAA 17 | CGA 1
CTG 36 | CCG 2 | CAG 13 | CGG 1
------------------------------------------------------------------------------
Ile I ATT 1 | Thr T ACT 7 | Asn N AAT 19 | Ser S AGT 1
ATC 14 | ACC 34 | AAC 26 | AGC 27
ATA 0 | ACA 1 | Lys K AAA 40 | Arg R AGA 0
Met M ATG 14 | ACG 0 | AAG 52 | AGG 3
------------------------------------------------------------------------------
Val V GTT 0 | Ala A GCT 8 | Asp D GAT 1 | Gly G GGT 0
GTC 0 | GCC 7 | GAC 13 | GGC 1
GTA 7 | GCA 3 | Glu E GAA 21 | GGA 20
GTG 13 | GCG 4 | GAG 28 | GGG 4
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.17619 C:0.23810 A:0.37937 G:0.20635
position 2: T:0.21905 C:0.19365 A:0.41429 G:0.17302
position 3: T:0.10476 C:0.37460 A:0.20794 G:0.31270
Average T:0.16667 C:0.26878 A:0.33386 G:0.23069
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Z600-PA
D_sechellia_Z600-PA 0.0773 (0.0169 0.2186)
D_simulans_Z600-PA 0.0859 (0.0169 0.1969)-1.0000 (0.0000 0.0165)
D_yakuba_Z600-PA 0.1957 (0.0569 0.2908) 0.1831 (0.0571 0.3118) 0.1693 (0.0571 0.3371)
D_yakuba_Z600-PA 0.2355 (0.0570 0.2420) 0.2181 (0.0572 0.2621) 0.2001 (0.0572 0.2857)-1.0000 (0.0000 0.1256)
D_erecta_Z600-PA 0.1720 (0.0417 0.2424) 0.1745 (0.0418 0.2396) 0.1593 (0.0418 0.2625) 0.1103 (0.0218 0.1975) 0.1244 (0.0218 0.1754)
D_takahashii_Z600-PA 0.0956 (0.0698 0.7301) 0.1350 (0.0859 0.6365) 0.1271 (0.0859 0.6761) 0.0944 (0.0646 0.6850) 0.1011 (0.0647 0.6401) 0.0823 (0.0595 0.7237)
Model 0: one-ratio
TREE # 1: (1, (2, 3), ((4, 5), 6, 7)); MP score: 74
lnL(ntime: 10 np: 12): -714.333061 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..6 10..7
0.085669 0.089664 0.000004 0.010745 0.132879 0.085351 0.044530 0.032945 0.056819 0.521827 1.373314 0.078585
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.06043
(1: 0.085669, (2: 0.000004, 3: 0.010745): 0.089664, ((4: 0.044530, 5: 0.032945): 0.085351, 6: 0.056819, 7: 0.521827): 0.132879);
(D_melanogaster_Z600-PA: 0.085669, (D_sechellia_Z600-PA: 0.000004, D_simulans_Z600-PA: 0.010745): 0.089664, ((D_yakuba_Z600-PA: 0.044530, D_yakuba_Z600-PA: 0.032945): 0.085351, D_erecta_Z600-PA: 0.056819, D_takahashii_Z600-PA: 0.521827): 0.132879);
Detailed output identifying parameters
kappa (ts/tv) = 1.37331
omega (dN/dS) = 0.07858
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.086 221.7 48.3 0.0786 0.0092 0.1173 2.0 5.7
8..9 0.090 221.7 48.3 0.0786 0.0097 0.1228 2.1 5.9
9..2 0.000 221.7 48.3 0.0786 0.0000 0.0000 0.0 0.0
9..3 0.011 221.7 48.3 0.0786 0.0012 0.0147 0.3 0.7
8..10 0.133 221.7 48.3 0.0786 0.0143 0.1820 3.2 8.8
10..11 0.085 221.7 48.3 0.0786 0.0092 0.1169 2.0 5.6
11..4 0.045 221.7 48.3 0.0786 0.0048 0.0610 1.1 2.9
11..5 0.033 221.7 48.3 0.0786 0.0035 0.0451 0.8 2.2
10..6 0.057 221.7 48.3 0.0786 0.0061 0.0778 1.4 3.8
10..7 0.522 221.7 48.3 0.0786 0.0562 0.7148 12.5 34.5
tree length for dN: 0.1141
tree length for dS: 1.4525
Time used: 0:03
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6, 7)); MP score: 74
lnL(ntime: 10 np: 13): -702.723747 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..6 10..7
0.090292 0.096619 0.000004 0.011227 0.141205 0.087166 0.047819 0.035142 0.063072 0.575020 1.506996 0.868632 0.014234
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14757
(1: 0.090292, (2: 0.000004, 3: 0.011227): 0.096619, ((4: 0.047819, 5: 0.035142): 0.087166, 6: 0.063072, 7: 0.575020): 0.141205);
(D_melanogaster_Z600-PA: 0.090292, (D_sechellia_Z600-PA: 0.000004, D_simulans_Z600-PA: 0.011227): 0.096619, ((D_yakuba_Z600-PA: 0.047819, D_yakuba_Z600-PA: 0.035142): 0.087166, D_erecta_Z600-PA: 0.063072, D_takahashii_Z600-PA: 0.575020): 0.141205);
Detailed output identifying parameters
kappa (ts/tv) = 1.50700
dN/dS (w) for site classes (K=2)
p: 0.86863 0.13137
w: 0.01423 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.090 220.5 49.5 0.1437 0.0144 0.1001 3.2 5.0
8..9 0.097 220.5 49.5 0.1437 0.0154 0.1071 3.4 5.3
9..2 0.000 220.5 49.5 0.1437 0.0000 0.0000 0.0 0.0
9..3 0.011 220.5 49.5 0.1437 0.0018 0.0125 0.4 0.6
8..10 0.141 220.5 49.5 0.1437 0.0225 0.1566 5.0 7.7
10..11 0.087 220.5 49.5 0.1437 0.0139 0.0967 3.1 4.8
11..4 0.048 220.5 49.5 0.1437 0.0076 0.0530 1.7 2.6
11..5 0.035 220.5 49.5 0.1437 0.0056 0.0390 1.2 1.9
10..6 0.063 220.5 49.5 0.1437 0.0101 0.0699 2.2 3.5
10..7 0.575 220.5 49.5 0.1437 0.0916 0.6376 20.2 31.5
Time used: 0:08
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6, 7)); MP score: 74
lnL(ntime: 10 np: 15): -702.723747 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..6 10..7
0.090292 0.096619 0.000004 0.011227 0.141205 0.087166 0.047819 0.035143 0.063072 0.575019 1.506995 0.868632 0.079410 0.014234 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.14757
(1: 0.090292, (2: 0.000004, 3: 0.011227): 0.096619, ((4: 0.047819, 5: 0.035143): 0.087166, 6: 0.063072, 7: 0.575019): 0.141205);
(D_melanogaster_Z600-PA: 0.090292, (D_sechellia_Z600-PA: 0.000004, D_simulans_Z600-PA: 0.011227): 0.096619, ((D_yakuba_Z600-PA: 0.047819, D_yakuba_Z600-PA: 0.035143): 0.087166, D_erecta_Z600-PA: 0.063072, D_takahashii_Z600-PA: 0.575019): 0.141205);
Detailed output identifying parameters
kappa (ts/tv) = 1.50699
dN/dS (w) for site classes (K=3)
p: 0.86863 0.07941 0.05196
w: 0.01423 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.090 220.5 49.5 0.1437 0.0144 0.1001 3.2 5.0
8..9 0.097 220.5 49.5 0.1437 0.0154 0.1071 3.4 5.3
9..2 0.000 220.5 49.5 0.1437 0.0000 0.0000 0.0 0.0
9..3 0.011 220.5 49.5 0.1437 0.0018 0.0125 0.4 0.6
8..10 0.141 220.5 49.5 0.1437 0.0225 0.1566 5.0 7.7
10..11 0.087 220.5 49.5 0.1437 0.0139 0.0967 3.1 4.8
11..4 0.048 220.5 49.5 0.1437 0.0076 0.0530 1.7 2.6
11..5 0.035 220.5 49.5 0.1437 0.0056 0.0390 1.2 1.9
10..6 0.063 220.5 49.5 0.1437 0.0101 0.0699 2.2 3.5
10..7 0.575 220.5 49.5 0.1437 0.0916 0.6376 20.2 31.5
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Z600-PA)
Pr(w>1) post mean +- SE for w
27 H 0.576 1.865 +- 1.375
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.485 0.206 0.103 0.059 0.039 0.029 0.023 0.020 0.018 0.017
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.004
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008 0.285
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.030 0.223 0.449
sum of density on p0-p1 = 1.000000
Time used: 0:14
Model 3: discrete (3 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6, 7)); MP score: 74
lnL(ntime: 10 np: 16): -701.456628 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..6 10..7
0.089315 0.093940 0.000004 0.011185 0.138430 0.086974 0.046437 0.034216 0.059764 0.561587 1.370677 0.385176 0.413521 0.000001 0.000001 0.500444
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.12185
(1: 0.089315, (2: 0.000004, 3: 0.011185): 0.093940, ((4: 0.046437, 5: 0.034216): 0.086974, 6: 0.059764, 7: 0.561587): 0.138430);
(D_melanogaster_Z600-PA: 0.089315, (D_sechellia_Z600-PA: 0.000004, D_simulans_Z600-PA: 0.011185): 0.093940, ((D_yakuba_Z600-PA: 0.046437, D_yakuba_Z600-PA: 0.034216): 0.086974, D_erecta_Z600-PA: 0.059764, D_takahashii_Z600-PA: 0.561587): 0.138430);
Detailed output identifying parameters
kappa (ts/tv) = 1.37068
dN/dS (w) for site classes (K=3)
p: 0.38518 0.41352 0.20130
w: 0.00000 0.00000 0.50044
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.089 221.7 48.3 0.1007 0.0115 0.1139 2.5 5.5
8..9 0.094 221.7 48.3 0.1007 0.0121 0.1198 2.7 5.8
9..2 0.000 221.7 48.3 0.1007 0.0000 0.0000 0.0 0.0
9..3 0.011 221.7 48.3 0.1007 0.0014 0.0143 0.3 0.7
8..10 0.138 221.7 48.3 0.1007 0.0178 0.1765 3.9 8.5
10..11 0.087 221.7 48.3 0.1007 0.0112 0.1109 2.5 5.4
11..4 0.046 221.7 48.3 0.1007 0.0060 0.0592 1.3 2.9
11..5 0.034 221.7 48.3 0.1007 0.0044 0.0436 1.0 2.1
10..6 0.060 221.7 48.3 0.1007 0.0077 0.0762 1.7 3.7
10..7 0.562 221.7 48.3 0.1007 0.0721 0.7159 16.0 34.5
Naive Empirical Bayes (NEB) analysis
Time used: 0:21
Model 7: beta (10 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6, 7)); MP score: 74
lnL(ntime: 10 np: 13): -701.839866 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..6 10..7
0.089135 0.095451 0.000004 0.011156 0.140198 0.087262 0.046900 0.034547 0.060983 0.568719 1.394573 0.067100 0.538477
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.13436
(1: 0.089135, (2: 0.000004, 3: 0.011156): 0.095451, ((4: 0.046900, 5: 0.034547): 0.087262, 6: 0.060983, 7: 0.568719): 0.140198);
(D_melanogaster_Z600-PA: 0.089135, (D_sechellia_Z600-PA: 0.000004, D_simulans_Z600-PA: 0.011156): 0.095451, ((D_yakuba_Z600-PA: 0.046900, D_yakuba_Z600-PA: 0.034547): 0.087262, D_erecta_Z600-PA: 0.060983, D_takahashii_Z600-PA: 0.568719): 0.140198);
Detailed output identifying parameters
kappa (ts/tv) = 1.39457
Parameters in M7 (beta):
p = 0.06710 q = 0.53848
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00002 0.00042 0.00500 0.04155 0.24335 0.81342
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.089 221.5 48.5 0.1104 0.0121 0.1100 2.7 5.3
8..9 0.095 221.5 48.5 0.1104 0.0130 0.1178 2.9 5.7
9..2 0.000 221.5 48.5 0.1104 0.0000 0.0000 0.0 0.0
9..3 0.011 221.5 48.5 0.1104 0.0015 0.0138 0.3 0.7
8..10 0.140 221.5 48.5 0.1104 0.0191 0.1730 4.2 8.4
10..11 0.087 221.5 48.5 0.1104 0.0119 0.1077 2.6 5.2
11..4 0.047 221.5 48.5 0.1104 0.0064 0.0579 1.4 2.8
11..5 0.035 221.5 48.5 0.1104 0.0047 0.0426 1.0 2.1
10..6 0.061 221.5 48.5 0.1104 0.0083 0.0753 1.8 3.6
10..7 0.569 221.5 48.5 0.1104 0.0775 0.7019 17.2 34.0
Time used: 0:42
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (2, 3), ((4, 5), 6, 7)); MP score: 74
lnL(ntime: 10 np: 15): -701.823059 +0.000000
8..1 8..9 9..2 9..3 8..10 10..11 11..4 11..5 10..6 10..7
0.088770 0.095156 0.000004 0.011110 0.139623 0.086856 0.046710 0.034404 0.060759 0.567601 1.400963 0.954842 0.066485 0.842087 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.13099
(1: 0.088770, (2: 0.000004, 3: 0.011110): 0.095156, ((4: 0.046710, 5: 0.034404): 0.086856, 6: 0.060759, 7: 0.567601): 0.139623);
(D_melanogaster_Z600-PA: 0.088770, (D_sechellia_Z600-PA: 0.000004, D_simulans_Z600-PA: 0.011110): 0.095156, ((D_yakuba_Z600-PA: 0.046710, D_yakuba_Z600-PA: 0.034404): 0.086856, D_erecta_Z600-PA: 0.060759, D_takahashii_Z600-PA: 0.567601): 0.139623);
Detailed output identifying parameters
kappa (ts/tv) = 1.40096
Parameters in M8 (beta&w>1):
p0 = 0.95484 p = 0.06649 q = 0.84209
(p1 = 0.04516) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.09548 0.09548 0.09548 0.09548 0.09548 0.09548 0.09548 0.09548 0.09548 0.09548 0.04516
w: 0.00000 0.00000 0.00000 0.00000 0.00001 0.00016 0.00203 0.01743 0.11282 0.55301 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
8..1 0.089 221.5 48.5 0.1106 0.0121 0.1094 2.7 5.3
8..9 0.095 221.5 48.5 0.1106 0.0130 0.1173 2.9 5.7
9..2 0.000 221.5 48.5 0.1106 0.0000 0.0000 0.0 0.0
9..3 0.011 221.5 48.5 0.1106 0.0015 0.0137 0.3 0.7
8..10 0.140 221.5 48.5 0.1106 0.0190 0.1721 4.2 8.4
10..11 0.087 221.5 48.5 0.1106 0.0118 0.1070 2.6 5.2
11..4 0.047 221.5 48.5 0.1106 0.0064 0.0576 1.4 2.8
11..5 0.034 221.5 48.5 0.1106 0.0047 0.0424 1.0 2.1
10..6 0.061 221.5 48.5 0.1106 0.0083 0.0749 1.8 3.6
10..7 0.568 221.5 48.5 0.1106 0.0774 0.6995 17.1 33.9
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Z600-PA)
Pr(w>1) post mean +- SE for w
27 H 0.765 1.973 +- 1.402
80 N 0.611 1.648 +- 1.350
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008 0.992
p : 0.996 0.004 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.003 0.024 0.065 0.112 0.156 0.190 0.216 0.234
ws: 0.521 0.240 0.106 0.051 0.028 0.018 0.012 0.010 0.008 0.007
Time used: 1:20
Model 1: NearlyNeutral -702.723747 Model 2: PositiveSelection -702.723747 Model 0: one-ratio -714.333061 Model 3: discrete -701.456628 Model 7: beta -701.839866 Model 8: beta&w>1 -701.823059 Model 0 vs 1 23.21862800000008 Model 2 vs 1 0.0 Model 8 vs 7 0.03361400000017056
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
