--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Dec 08 05:10:58 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/418/Tlk-PL/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/418/Tlk-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/418/Tlk-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/418/Tlk-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -8704.20         -8720.47
2      -8704.06         -8721.77
--------------------------------------
TOTAL    -8704.13         -8721.32
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/418/Tlk-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/418/Tlk-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/418/Tlk-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.612424    0.001220    0.548074    0.681657    0.611346   1465.98   1482.38    1.000
r(A<->C){all}   0.101472    0.000149    0.077306    0.125405    0.101260   1036.76   1047.26    1.001
r(A<->G){all}   0.296383    0.000514    0.252935    0.339228    0.296095    997.79   1063.61    1.000
r(A<->T){all}   0.100553    0.000265    0.070518    0.133222    0.100226    820.93    965.68    1.000
r(C<->G){all}   0.039275    0.000043    0.026630    0.051488    0.038828   1069.62   1118.92    1.000
r(C<->T){all}   0.386520    0.000676    0.337604    0.438030    0.385848    907.22    973.49    1.001
r(G<->T){all}   0.075799    0.000134    0.054300    0.099760    0.075170   1104.35   1188.78    1.000
pi(A){all}      0.256556    0.000056    0.243356    0.272001    0.256566   1025.29   1232.49    1.000
pi(C){all}      0.290039    0.000058    0.275255    0.305056    0.289977    999.62   1166.64    1.001
pi(G){all}      0.283886    0.000058    0.268540    0.298175    0.283764   1186.23   1224.35    1.000
pi(T){all}      0.169518    0.000039    0.157993    0.182902    0.169287    953.73   1044.80    1.000
alpha{1,2}      0.115744    0.000193    0.089467    0.142541    0.115897   1255.20   1276.18    1.000
alpha{3}        5.079049    1.363341    2.932735    7.453834    4.944138   1453.47   1477.24    1.000
pinvar{all}     0.431197    0.000927    0.372464    0.489102    0.432463   1443.01   1472.01    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-7642.29202
Model 2: PositiveSelection	-7642.292021
Model 0: one-ratio	-7690.53082
Model 3: discrete	-7632.506219
Model 7: beta	-7633.374744
Model 8: beta&w>1	-7633.374845


Model 0 vs 1	96.47760000000017

Model 2 vs 1	2.0000006770715117E-6

Model 8 vs 7	2.0200000108161476E-4
>C1
MDQFQTSLNPRKLELLESRITGVRMSPGAHLQMSPQNTSSLSQHHPHQQQ
QLQPPQQQQQHFPNHHSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQ
HLHKHPHQLQLHQQQQQQLHQQQQQHFHQQSLQGLHQGSSNPDSNMSTGS
SHSEKDVNDMLSGGAATPGAAAAAIQQQHPAFAPTLGMQQPPPPPPQHSN
NGGEMGYLSAGTTTTTSVLTVGKPRTPAERKRKRKMPPCATSADEAGSGG
GSGGAGATVVNNSSLKGKSLAFRDMPKVNMSLNLGDRLGGSAGSGVGAGG
AGSGGGGAGSGSGSGGGKSARLMLPVSDNKKINDYFNKQQTGVGVGVPGG
AGGNTAGLRGSHTGGGSKSPSSAQQQQTAAQQQGSGVATGGSAGGSAGNQ
VQVQTSSAYALYPPASPQTQTSQQQQQQQPGSDFHYVNSSKAQQQQQRQQ
QQTSNQMVPPHVVVGLGGHPLSLASIQQQTPLSQQQQQQQQQQQQQQLGP
PTTSTASVVPTHPHQLGSLGVVGMVGVGVGVGVGVNVGVGPPLPPPPPMA
MPAAIITYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKSQIV
GNQKTIDQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFV
TQRVGATFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVAC
KVHQLNKDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSF
CTVLEYCDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIH
YDLKPGNILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGT
YWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATI
LEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEY
IQPPIPKHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAH
MFGNMNQSSSSoooooooooooooooooooooo
>C2
MDQFQTSLNPRKLELLESRITGVRMSPGAHLQMSPQNTSSLSQHHPHQQQ
QLQPPQQQQQHFPNHHSAQQQSHQQQEQQNPQQQAQQQQQILPHQHLQHL
HKHPHQLQLHQQQQQQLHQQQQQHFHQQSLQGLHQGSSNPDSNMSTGSSH
SEKDVNDMLSGGAATPGAAAAAIQQQHPAFAPTLGMQQPPPPPPQHSNNG
GEMGYLSAGTTTTTSVLTVGKPRTPAERKRKRKMPPCATSADEAGSGGGS
GGAGATVVNNSSLKGKSLAFRDMPKVNMSLNLGDRLGGSAGSGVGAGGAG
SGGGGAGSGSGSGGGKSARLMLPVTDNKKINDYFNKQQTGVGVGVAGGAG
GNTAGLRGSHTGGGSKSPSSAQQQQQQQQTAAQQQGSGVATGGSAGGSAG
NQVQVQTSSAYALYPPASPQTQTSQQQQQQQPGSDFHYVNSSKAQQQQQR
QQQQTSNQMVPPHVVVGLGGHPLSLASIQQQTPLSQQQQQQQQQQQQQQL
GPPTTSTASVVPTHPHQLGSLGVVGMVGVGVGVGVNVGVGPPLPPPPPMA
MPAAIITYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKSQIV
GNQKTIDQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFV
TQRVGATFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVAC
KVHQLNKDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSF
CTVLEYCDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIH
YDLKPGNILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGT
YWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATI
LEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEY
IQPPIPKHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAH
MFGNMNQSSSSoooooooooooooooooooooo
>C3
MDQFQTSLNPRKLELLESRITGVRMSPGAHLQMSPQNTSSLSQHHPHQQQ
QLQPPQQQQQHFPNHHSAQQQSQQQQQQEQQNPQQQAQQQQQILPHQHLQ
HLHKHPHQLQLHQQQQQQLHQQQQQHFHQQSLQGLHQGSSNPDSNMSTGS
SHSEKDVNDMLSGGAATPGAAAAAIQQQHPAFAPTLGMQQPPPPPPQHSN
NGGEMGYLSAGTTTTTSVLTVGKPRTPAERKRKRKMPPCATSADEAGSGG
GSGGAGATVVNNSSLKGKSLAFRDMPKVNMSLNLGDRLGGSAGSGVGAGG
SGSGGGGAGSGSGSGGGKSARLMLPVTDNKKINDYFNKQQTGVGVGVAGG
AGGNTAGLRGSHTGGGSKSPSSAQQQQQQQQTAAQQQGSGVATGGSAGGS
AGNQVQVQTSSAYALYPPASPQTQTSQQQQQQQPGSDFHYVNSSKAQQQQ
QRQQQQTSNQMVPPHVVVGLGGHPLSLASIQQQTPLSQQQQQQQQQQQQQ
QLGPPTTSTASVVPTHPHQLGSLGVVGMVGVGVGVGVGVNVGVGPPLPPP
PPMAMPAAIITYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQK
SQIVGNQKTIDQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRL
GQFVTQRVGATFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQR
YVACKVHQLNKDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEID
ANSFCTVLEYCDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKP
PVIHYDLKPGNILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQ
GAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQS
QATILEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALA
RHEYIQPPIPKHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTS
FSAHMFGNMNQSSSSoooooooooooooooooo
>C4
MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
QLQPPQQQQPQPPPPQQQHFANHHSAQQQSQQQQQEQQNPQQQAQQQQIL
PQQHLQHLHKHPHQLQLHQQQQQQLHQQQQHFHQQSLQGLHQGSSNPDSN
MSTGSSHSEKDVNDMLSGGAATPGAGTSAIQQQQQQHPAFAPALGMQQPP
PPPPQHSNNGGEMGYLSAGTTTTTSVLTVGKPRTPAERKRKRKMPPCATS
ADEAGSGGGSGGAGATVVNNSTLKGKSLAFRDMPKVNMGLNLGDRLGASA
GSGGGAGGAGSGGGGAGSGSGSGGGKSARLMLPVSDNKKINDYFNKQQTG
VGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQQQQQQQTAAQQQGSGVAT
GGSAGGSAGNQVQVQTSSAYALYPPASPQTQTPQQQQQQQPGADFHYVNS
SKAQQQQQRQQQQTSNQMVPPHVVVGLGGHPLSLASIQQQTPLSQQQQQQ
QQQQQQQQQLGPPTTSTASVVPTHPHQLGSLGVVGMVGVGVGVNVGVGPP
LPPPPPMAMPAAIITYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLS
DEQKSQIVGNQKTIDQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQN
RLRLGQFVTQRVGATFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDL
KEQRYVACKVHQLNKDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDV
FEIDANSFCTVLEYCDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLN
EIKPPVIHYDLKPGNILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMD
LTSQGAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFG
HNQSQATILEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDV
FALARHEYIQPPIPKHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANST
GQTSFSAHMFGNMNQSSSSoooooooooooooo
>C5
MDQFQTSLNPRKQELLEARIMGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
QLQPPQQQQPQPPPPQQQHFANHHSAQQQSQQQQQEQQNPQQQAQQQQQI
LPQQHLQHLHKHPHQLQLHQQQQQQLHQQQQHFHQQSLQGLHQGSSNPDS
NMSTGSSHSEKDVNDMLSGGAATPGAGTSAIQQQQQQHPAFAPALGMQQP
PPPPPQHSNNGGEMGYLSAGTTTTTSVLTVGKPRTPAERKRKRKMPPCAT
SADEAGSGGGSGGAGATVVNNSTLKGKSLAFRDMPKVNMSLNLGDRLGGS
ASSGGGAGVAGSGGGGAGSGSGSGGGKSARLMLPVNDNKKINDYFNKQQT
SVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQQQQQQQVQQQTAAQQQG
SGVATGGSAGGSAGNQVQVQTSSAYALYPPASPQTQTPQQQQQQQQPGAD
FHYVNSTKAQQQQQRQQQQTSNQMVPPHVVVGLGGHPLSLASIQQQTPLS
QQQQQQQQQQQQQQQLGPPTTSTASVVPTHPHQLGSLGVVGMVGVGVGVG
VGVNVGVGPPLPPPPQMAMPAAIITYCKATQTEVSLHELQEREAEHESGK
VKLDEMTRLSDEQKSQIVGNQKTIDQHKCHIAKCIDVVKKLLKEKSSIEK
KEARQKCMQNRLRLGQFVTQRVGATFQSRFNNHPVLNDRYLLLMLLGKGG
FSEVHKAFDLKEQRYVACKVHQLNKDWKEDKKANYIKHALREYNIHKALD
HPRVVKLYDVFEIDANSFCTVLEYCDGHDLDFYLKQHKTIPEREARSIIM
QVVSALKYLNEIKPPVIHYDLKPGNILLTEGNVCGEIKITDFGLSKVMDD
ENYNPDHGMDLTSQGAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFY
QCLYGKKPFGHNQSQATILEENTILKATEVQFSNKPTVSNEAKSFIRGCL
AYRKEDRMDVFALARHEYIQPPIPKHGRGSLNQQQQAQQQQQQQQQQQQQ
QSSTSQANSTGQTSFSAHMFGNMNQSSSSoooo
>C6
MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
QLQPPQQQQQHFANHHSAQQQQTQQQQQQEQQNPQQQQQQQQAQQQILPQ
QHLQHLHKHPQQLHQQQLHQQQLHQQQHFHQQQQQSLQGLHQGSSNPDSN
MSTGSSHSEKDVNDMLSGGGATPGAAAAAAAAAAIQQQQQQHPAFAPALG
MQQPPPPPPQHSNNGGEMTYLTAGTTTTASVTTVGKPRTPAERKRKRKMP
HTSADEAGSGGGSGGAGATVVNNSSLKGKSLAFRDMPKVNMGLNLGDRLG
GSAGSGGGAGGAGSGGSGAGSGSGSGGGKSARLMLPVNDNKKINDYFNKQ
QTGVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQQQQQQQQQQTAQQQQ
ASGVATGGGAGGAAGNQVQVQTSSAYALYPPASPQTQTPQQQQQQQPPGA
DFHYVNSSKAQQQQQQQQQRQQQQTSNQMVPPHVVMAGHPLSMAAIQQQQ
QTPLSQQQQQQQQQQQQQQLGPPTTSTASVVPTHPHQLGSLGVVGMVGVG
VGVGVGVNVGVGPPLPPPPPMAMPAAIITYSKATQTEVSLHELQEREAEH
ESGKVKLDEMTRLSDEQKCQIVGNQKTIDQHKSHIAKCIDVVKKLLKEKS
SIEKKEARQKCMQNRLRLGQFVTQRVGATFQSRFNNHPVLNDRYLLLMLL
GKGGFSEVHKAFDLKEQRYVACKVHQLNKDWKEDKKANYIKHALREYNIH
KALDHPRVVKLYDVFEIDANSFCTVLEYCDGHDLDFYLKQHKTIPEREAR
SIIMQVVSALKYLNEIKPPVIHYDLKPGNILLTEGNVCGEIKITDFGLSK
VMDDENYNPDHGMDLTSQGAGTYWYLPPECFVVGKNPPKISSKVDVWSVG
VIFYQCLYGKKPFGHNQSQATILEENTILKATEVQFSNKPTVSNEAKSFI
RGCLAYRKEDRMDVFALARHEYIQPPIPKHGRGSLNQQQQAQQQQQQQQQ
QQQQQSSTSQANSTGQTSFSAHMFGNMNQSSSS
>C7
MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
QLQPPQQQQQHFANHHSAQQQTQQQQQEQQNPQQQQQQQAQQQILPQQHL
QHLHKHPHQLQLHQQQQQLHQQQQHFHQQQQQSLQGLHQGSSNPDSNMST
GSSHSEKDVNDMLSGGATPGAAAAAAAAIQQQQQQHPAFAPALGMQQPPP
PPPQHSNNGGEMAYLTAGTTTTASVTAVGKPRTPAERKRKRKMPHSSADE
AGSGGGSGGAGATVVNNSSLKGKSLAFRDMPKVNMSLNLGDRLGGSAGSG
GGAGGAGSGGSGAGSGSGSGGGKSARIMLPVSDNKKINDYFNKQTGVGVG
VPGGAGGNTAGLRGSHTGGGSKSPSSAQQQQQQQQTAQQQQASGGARGGG
AGGAAGNQVQVQTSSAYALYPPASPQTQTPQQQQQQQPPGADFHYVNSSK
AQQQQQQQRQQQQTSNQMVPPHVVVGLGGHPLSLASIQQQQTPLSQQQQQ
QQQQQQQQQQLGPPTTSTASVVPTHPHQLGSLGVVGMVGVGVGVGVGVNV
GVGPPLPPPPPMAMPAAIITYSKATQTEVSLHELQEREAEHESGKVKLDE
MTRLSDEQKCQIVGNQKTIDQHKSHIAKCIDVVKKLLKEKSSIEKKEARQ
KCMQNRLRLGQFVTQRVGATFQSRFNNHPVLNDRYLLLMLLGKGGFSEVH
KAFDLKEQRYVACKVHQLNKDWKEDKKANYIKHALREYNIHKALDHPRVV
KLYDVFEIDANSFCTVLEYCDGHDLDFYLKQHKTIPEREARSIIMQVVSA
LKYLNEIKPPVIHYDLKPGNILLTEGNVCGEIKITDFGLSKVMDDENYNP
DHGMDLTSQGAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCLYG
KKPFGHNQSQATILEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRKE
DRMDVFALARHEYIQPPIPKHGRGSLNQQQQAQQQQQQQQQQQQQQSSTS
QANSTGQTSFSAHMFGNMNQSSSSooooooooo
>C8
MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
QLQPPQQQQQHFANHHSAQQQPQQQQEQQNPQQQQQQAQQQILPHQHLQH
LHKHPHQLQLHQQQQQQLHQQQQHFHQQQQQSLQGLHQGSSNPDSNMSTG
SSHSEKDVNDMLSSGGATPGAAVAAIQQQHPAFAPALGMQQPPPPPPQHS
NNGGEMAYLTAGTTTTTSVTAVGKPRTPAERKRKRKMPHTSSDEAGSGGG
SGGAGATVVNNSSLKGKSLAFRDMPKVNMSLNLGDRLGGSAGSGGGAGGA
GSGSGAGSGSGSGGGKSARLMLPVSDNKKINDYFNKQQTGVGVGVPGGAG
GNTAGLRGSHTGGGSKSPSSAQQQQQQQQTGQQQQASGVATGGGAGGAAG
NQVQVQTSSAYALYPPASPQTQTPQQQQQQQPGADFHYVNSSKAQQQQQR
QQQQTSNQMVPPHVVVGLGGHSLSLASIQQQQQTPLSQQQQQQQQQQQQQ
QQQLGPPTTSTASVVPTHPHQLGSLGVVGMVGVGVGVGVNVGVGPPLPPP
PPMAMPAAIITYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQK
CQIVGNQKTIDQHKSHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRL
GQFVTQRVGATFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQR
YVACKVHQLNKDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEID
ANSFCTVLEYCDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKP
PVIHYDLKPGNILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQ
GAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQS
QATILEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALA
RHEYIQPPIPKHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTS
FSAHMFGNMNQSSSSoooooooooooooooooo
>C9
MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
QLQPPQQQQQHFANHHSNQQSQQQEQQNPQQAQQQQIIPQQHLQHLHKHP
HQLQQQLHQQQQLHQQQHFHQQQQQSLQGLHQGSSNPDSNMSTGSSHSEK
DVNDMLSGGGATPGGAAAAAAAAAAIQQQQQQHPAFPPTLGMQQPPPPPP
QHSNNGGEMAYLTAGTTTTASVTAGVGKPRTPAERKRKRKMPHTSADEAG
SGGGSGGAGTTVVNNSNLKGKSLAFRDMPKVNMSLNIGDRLGGSAGSGGG
AGGAGSGGSGAGSGSGSGGGKSARLMLPVNDNKKINDYFNKQQTGVGVGV
GVPGGAGGNTAGLRGSHTGGGSKSPSSAQQQQQQTAQQASGVATGGNAGG
AAGNQVQVQTSSAYALYPPASPQTQTPQQQQQQPPGAADFHYVNSSKAQQ
QQQQQRQQQQTSNQMVPPHVVVGLGGHPLSLASIQQQQQTPLSQQQQQQQ
QQQQQQQQQLGPPTTSTASVVPTHPHQLGSLGVVGMVGVGVGVGVGVGVN
VGVGPPLPPPPPMAMQAAIITYSKATQTEVSLHELQEREAEHESGKVKLD
EMTRLSDEQKCQIVGNQKTIDQHKSHIVKCIDVVKKLLKEKSSIEKKEAR
QKCMQNRLRLGQFVTQRVGATFQSRFNNHPVLNDRYLLLMLLGKGGFSEV
HKAFDLKEQRYVACKVHQLNKDWKEDKKANYIKHALREYNIHKALDHPRV
VKLYDVFEIDANSFCTVLEYCDGHDLDFYLKQHKTIPEREARSIIMQVVS
ALKYLNEIKPPVIHYDLKPGNILLTEGNVCGEIKITDFGLSKVMDDENYN
PDHGMDLTSQGAGTYWYLPPECFVVGKNPPKISSKVDVWSVGVIFYQCLY
GKKPFGHNQSQATILEENTILKATEVQFSNKPTVSNEAKSFIRGCLAYRK
EDRMDVFALARHEYIQPPIPKHGRGSLNQQQQAQQQQQQQQQQQQQQSST
SQANSTGQTSFSAHMFGNMNQSSSSoooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=99, Nseq=9, Len=1077 

C1              MDQFQTSLNPRKLELLESRITGVRMSPGAHLQMSPQNTSSLSQHHPHQQQ
C2              MDQFQTSLNPRKLELLESRITGVRMSPGAHLQMSPQNTSSLSQHHPHQQQ
C3              MDQFQTSLNPRKLELLESRITGVRMSPGAHLQMSPQNTSSLSQHHPHQQQ
C4              MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
C5              MDQFQTSLNPRKQELLEARIMGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
C6              MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
C7              MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
C8              MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
C9              MDQFQTSLNPRKQELLEARFIGVRMSAGAQLQMAPQTTSALSHHHPNQQQ
                ************ ****:*: *****.**:***:**.**:**:***:***

C1              QLQPPQQQQ--------QHFPNHHSAQQQSQ-QQQQQEQQNPQQQAQQQQ
C2              QLQPPQQQQ--------QHFPNHHSAQQQSH-QQQ--EQQNPQQQAQQQQ
C3              QLQPPQQQQ--------QHFPNHHSAQQQSQ-QQQQQEQQNPQQQAQQQQ
C4              QLQPPQQQQPQPPPPQQQHFANHHSAQQQSQ-QQQQ-EQQNPQQQAQQQQ
C5              QLQPPQQQQPQPPPPQQQHFANHHSAQQQSQ-QQQQ-EQQNPQQQAQQQQ
C6              QLQPPQQQQ--------QHFANHHSAQQQQTQQQQQQEQQNPQQQQQQQQ
C7              QLQPPQQQQ--------QHFANHHSAQQQTQ--QQQQEQQNPQQQQQQQA
C8              QLQPPQQQQ--------QHFANHHSAQQQP---QQQQEQQNPQQQQQQAQ
C9              QLQPPQQQQ--------QHFANHHSNQQS-----QQQEQQNPQQAQQQQ-
                *********        ***.**** **.     *  *******  **  

C1              Q---ILPHQHLQHLHKHPHQLQLHQQQQQQLHQQQQQHFHQQ--SLQGLH
C2              Q---ILPHQHLQHLHKHPHQLQLHQQQQQQLHQQQQQHFHQQ--SLQGLH
C3              Q---ILPHQHLQHLHKHPHQLQLHQQQQQQLHQQQQQHFHQQ--SLQGLH
C4              ----ILPQQHLQHLHKHPHQLQLHQQQQQQLHQQQQ-HFHQQ--SLQGLH
C5              Q---ILPQQHLQHLHKHPHQLQLHQQQQQQLHQQQQ-HFHQQ--SLQGLH
C6              AQQQILPQQHLQHLHKHPQQLHQQQLHQQQLH-QQQHFHQQQQQSLQGLH
C7              Q-QQILPQQHLQHLHKHPHQLQLHQ-QQQQLHQQQQHFHQQQQQSLQGLH
C8              --QQILPHQHLQHLHKHPHQLQLHQQQQQQLHQQQQHFHQQQQQSLQGLH
C9              ----IIPQQHLQHLHKHPHQLQQQLHQQQQLH-QQQHFHQQQQQSLQGLH
                    *:*:**********:**: :  :***** *** ..:**  ******

C1              QGSSNPDSNMSTGSSHSEKDVNDMLSGGAATPG------AAAAAIQQQ--
C2              QGSSNPDSNMSTGSSHSEKDVNDMLSGGAATPG------AAAAAIQQQ--
C3              QGSSNPDSNMSTGSSHSEKDVNDMLSGGAATPG------AAAAAIQQQ--
C4              QGSSNPDSNMSTGSSHSEKDVNDMLSGGAATPG------AGTSAIQQQQQ
C5              QGSSNPDSNMSTGSSHSEKDVNDMLSGGAATPG------AGTSAIQQQQQ
C6              QGSSNPDSNMSTGSSHSEKDVNDMLSGGGATPG-AAAAAAAAAAIQQQQQ
C7              QGSSNPDSNMSTGSSHSEKDVNDMLS-GGATPG---AAAAAAAAIQQQQQ
C8              QGSSNPDSNMSTGSSHSEKDVNDMLSSGGATPG------AAVAAIQQQ--
C9              QGSSNPDSNMSTGSSHSEKDVNDMLSGGGATPGGAAAAAAAAAAIQQQQQ
                ************************** *.****      *..:*****  

C1              -HPAFAPTLGMQQPPPPPPQHSNNGGEMGYLSAGTTTTTSVLT-VGKPRT
C2              -HPAFAPTLGMQQPPPPPPQHSNNGGEMGYLSAGTTTTTSVLT-VGKPRT
C3              -HPAFAPTLGMQQPPPPPPQHSNNGGEMGYLSAGTTTTTSVLT-VGKPRT
C4              QHPAFAPALGMQQPPPPPPQHSNNGGEMGYLSAGTTTTTSVLT-VGKPRT
C5              QHPAFAPALGMQQPPPPPPQHSNNGGEMGYLSAGTTTTTSVLT-VGKPRT
C6              QHPAFAPALGMQQPPPPPPQHSNNGGEMTYLTAGTTTTASVTT-VGKPRT
C7              QHPAFAPALGMQQPPPPPPQHSNNGGEMAYLTAGTTTTASVTA-VGKPRT
C8              -HPAFAPALGMQQPPPPPPQHSNNGGEMAYLTAGTTTTTSVTA-VGKPRT
C9              QHPAFPPTLGMQQPPPPPPQHSNNGGEMAYLTAGTTTTASVTAGVGKPRT
                 ****.*:******************** **:******:** : ******

C1              PAERKRKRKMPPCATSADEAGSGGGSGGAGATVVNNSSLKGKSLAFRDMP
C2              PAERKRKRKMPPCATSADEAGSGGGSGGAGATVVNNSSLKGKSLAFRDMP
C3              PAERKRKRKMPPCATSADEAGSGGGSGGAGATVVNNSSLKGKSLAFRDMP
C4              PAERKRKRKMPPCATSADEAGSGGGSGGAGATVVNNSTLKGKSLAFRDMP
C5              PAERKRKRKMPPCATSADEAGSGGGSGGAGATVVNNSTLKGKSLAFRDMP
C6              PAERKRKRKMP--HTSADEAGSGGGSGGAGATVVNNSSLKGKSLAFRDMP
C7              PAERKRKRKMP--HSSADEAGSGGGSGGAGATVVNNSSLKGKSLAFRDMP
C8              PAERKRKRKMP--HTSSDEAGSGGGSGGAGATVVNNSSLKGKSLAFRDMP
C9              PAERKRKRKMP--HTSADEAGSGGGSGGAGTTVVNNSNLKGKSLAFRDMP
                ***********   :*:*************:******.************

C1              KVNMSLNLGDRLGGSAGSGVGAGGAGSGGGGAGSGSGSGGGKSARLMLPV
C2              KVNMSLNLGDRLGGSAGSGVGAGGAGSGGGGAGSGSGSGGGKSARLMLPV
C3              KVNMSLNLGDRLGGSAGSGVGAGGSGSGGGGAGSGSGSGGGKSARLMLPV
C4              KVNMGLNLGDRLGASAGSGGGAGGAGSGGGGAGSGSGSGGGKSARLMLPV
C5              KVNMSLNLGDRLGGSASSGGGAGVAGSGGGGAGSGSGSGGGKSARLMLPV
C6              KVNMGLNLGDRLGGSAGSGGGAGGAGSGGSGAGSGSGSGGGKSARLMLPV
C7              KVNMSLNLGDRLGGSAGSGGGAGGAGSGGSGAGSGSGSGGGKSARIMLPV
C8              KVNMSLNLGDRLGGSAGSGGGAGGAGSG-SGAGSGSGSGGGKSARLMLPV
C9              KVNMSLNIGDRLGGSAGSGGGAGGAGSGGSGAGSGSGSGGGKSARLMLPV
                ****.**:*****.**.** *** :*** .***************:****

C1              SDNKKINDYFNKQQT--GVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQ
C2              TDNKKINDYFNKQQT--GVGVGVAGGAGGNTAGLRGSHTGGGSKSPSSAQ
C3              TDNKKINDYFNKQQT--GVGVGVAGGAGGNTAGLRGSHTGGGSKSPSSAQ
C4              SDNKKINDYFNKQQT--GVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQ
C5              NDNKKINDYFNKQQT--SVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQ
C6              NDNKKINDYFNKQQT--GVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQ
C7              SDNKKINDYFNKQTG---VGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQ
C8              SDNKKINDYFNKQQT--GVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQ
C9              NDNKKINDYFNKQQTGVGVGVGVPGGAGGNTAGLRGSHTGGGSKSPSSAQ
                .************     *****.**************************

C1              Q-------QQTAAQQQGSGVATGGSAGGSAGNQVQVQTSSAYALYPPASP
C2              QQQQQ---QQTAAQQQGSGVATGGSAGGSAGNQVQVQTSSAYALYPPASP
C3              QQQQQ---QQTAAQQQGSGVATGGSAGGSAGNQVQVQTSSAYALYPPASP
C4              QQQQQ----QTAAQQQGSGVATGGSAGGSAGNQVQVQTSSAYALYPPASP
C5              QQQQQQVQQQTAAQQQGSGVATGGSAGGSAGNQVQVQTSSAYALYPPASP
C6              QQQQQQQ-QQTAQQQQASGVATGGGAGGAAGNQVQVQTSSAYALYPPASP
C7              QQQQQQ---QTAQQQQASGGARGGGAGGAAGNQVQVQTSSAYALYPPASP
C8              QQQQQQ---QTGQQQQASGVATGGGAGGAAGNQVQVQTSSAYALYPPASP
C9              QQQQQ-------TAQQASGVATGGNAGGAAGNQVQVQTSSAYALYPPASP
                *             **.** * **.***:*********************

C1              QTQTSQQQQQQQ-PGSDFHYVNSSKAQQQQQRQ----QQQTSNQMVPPHV
C2              QTQTSQQQQQQQ-PGSDFHYVNSSKAQQQQQRQ----QQQTSNQMVPPHV
C3              QTQTSQQQQQQQ-PGSDFHYVNSSKAQQQQQRQ----QQQTSNQMVPPHV
C4              QTQTPQQQQQQQ-PGADFHYVNSSKAQQQQQRQ----QQQTSNQMVPPHV
C5              QTQTPQQQQQQQQPGADFHYVNSTKAQQQQQRQ----QQQTSNQMVPPHV
C6              QTQTPQQQQQQQPPGADFHYVNSSKAQQQQQQQQQRQQQQTSNQMVPPHV
C7              QTQTPQQQQQQQPPGADFHYVNSSKAQQQQQQQ--RQQQQTSNQMVPPHV
C8              QTQTPQQQQQQQPG-ADFHYVNSSKAQQQQQRQ----QQQTSNQMVPPHV
C9              QTQTPQQQQQQPPGAADFHYVNSSKAQQQQQQQ--RQQQQTSNQMVPPHV
                ****.******    :*******:*******:*    *************

C1              VVGLGGHPLSLASIQQQT--PLSQQQQQQQQQQQQQQ--LGPPTTSTASV
C2              VVGLGGHPLSLASIQQQT--PLSQQQQQQQQQQQQQQ--LGPPTTSTASV
C3              VVGLGGHPLSLASIQQQT--PLSQQQQQQQQQQQQQQ--LGPPTTSTASV
C4              VVGLGGHPLSLASIQQQT--PLSQQQQQQQQQQQQQQQ-LGPPTTSTASV
C5              VVGLGGHPLSLASIQQQT--PLSQQQQQQQQQQQQQQQ-LGPPTTSTASV
C6              VM--AGHPLSMAAIQQQQQTPLSQQQQQQQQQQQQQQ--LGPPTTSTASV
C7              VVGLGGHPLSLASIQQQQ-TPLSQQQQQQQQQQQQQQQ-LGPPTTSTASV
C8              VVGLGGHSLSLASIQQQQQTPLSQQQQQQQQQQQQQQQQLGPPTTSTASV
C9              VVGLGGHPLSLASIQQQQQTPLSQQQQQQQQQQQQQQQQLGPPTTSTASV
                *:  .**.**:*:****   *****************  ***********

C1              VPTHPHQLGSLGVVGMVGVGVGVGVGVN--VGVGPPLPPPPPMAMPAAII
C2              VPTHPHQLGSLGVVGMVGVGVGVGV--N--VGVGPPLPPPPPMAMPAAII
C3              VPTHPHQLGSLGVVGMVGVGVGVGVGVN--VGVGPPLPPPPPMAMPAAII
C4              VPTHPHQLGSLGVVGMVGVGVGV----N--VGVGPPLPPPPPMAMPAAII
C5              VPTHPHQLGSLGVVGMVGVGVGVGVGVN--VGVGPPLPPPPQMAMPAAII
C6              VPTHPHQLGSLGVVGMVGVGVGVGVGVN--VGVGPPLPPPPPMAMPAAII
C7              VPTHPHQLGSLGVVGMVGVGVGVGVGVN--VGVGPPLPPPPPMAMPAAII
C8              VPTHPHQLGSLGVVGMVGVGVGVGVNV----GVGPPLPPPPPMAMPAAII
C9              VPTHPHQLGSLGVVGMVGVGVGVGVGVGVNVGVGPPLPPPPPMAMQAAII
                ***********************        ********** *** ****

C1              TYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKSQIVGNQKTI
C2              TYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKSQIVGNQKTI
C3              TYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKSQIVGNQKTI
C4              TYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKSQIVGNQKTI
C5              TYCKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKSQIVGNQKTI
C6              TYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKCQIVGNQKTI
C7              TYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKCQIVGNQKTI
C8              TYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKCQIVGNQKTI
C9              TYSKATQTEVSLHELQEREAEHESGKVKLDEMTRLSDEQKCQIVGNQKTI
                **.*************************************.*********

C1              DQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
C2              DQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
C3              DQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
C4              DQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
C5              DQHKCHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
C6              DQHKSHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
C7              DQHKSHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
C8              DQHKSHIAKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
C9              DQHKSHIVKCIDVVKKLLKEKSSIEKKEARQKCMQNRLRLGQFVTQRVGA
                ****.**.******************************************

C1              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
C2              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
C3              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
C4              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
C5              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
C6              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
C7              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
C8              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
C9              TFQSRFNNHPVLNDRYLLLMLLGKGGFSEVHKAFDLKEQRYVACKVHQLN
                **************************************************

C1              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
C2              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
C3              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
C4              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
C5              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
C6              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
C7              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
C8              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
C9              KDWKEDKKANYIKHALREYNIHKALDHPRVVKLYDVFEIDANSFCTVLEY
                **************************************************

C1              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
C2              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
C3              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
C4              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
C5              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
C6              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
C7              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
C8              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
C9              CDGHDLDFYLKQHKTIPEREARSIIMQVVSALKYLNEIKPPVIHYDLKPG
                **************************************************

C1              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
C2              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
C3              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
C4              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
C5              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
C6              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
C7              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
C8              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
C9              NILLTEGNVCGEIKITDFGLSKVMDDENYNPDHGMDLTSQGAGTYWYLPP
                **************************************************

C1              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
C2              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
C3              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
C4              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
C5              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
C6              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
C7              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
C8              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
C9              ECFVVGKNPPKISSKVDVWSVGVIFYQCLYGKKPFGHNQSQATILEENTI
                **************************************************

C1              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
C2              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
C3              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
C4              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
C5              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
C6              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
C7              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
C8              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
C9              LKATEVQFSNKPTVSNEAKSFIRGCLAYRKEDRMDVFALARHEYIQPPIP
                **************************************************

C1              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
C2              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
C3              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
C4              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
C5              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
C6              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
C7              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
C8              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
C9              KHGRGSLNQQQQAQQQQQQQQQQQQQQSSTSQANSTGQTSFSAHMFGNMN
                **************************************************

C1              QSSSSoooooooooooooooooooooo
C2              QSSSSoooooooooooooooooooooo
C3              QSSSSoooooooooooooooooo----
C4              QSSSSoooooooooooooo--------
C5              QSSSSoooo------------------
C6              QSSSS----------------------
C7              QSSSSooooooooo-------------
C8              QSSSSoooooooooooooooooo----
C9              QSSSSoooooooo--------------
                *****                      




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 1033 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
ins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 1033 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 1033 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 1033 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 1033 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 1033 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 1033 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 1033 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 9 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 1033 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/418/Tlk-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.cl