--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Thu Dec 08 01:42:39 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/412/tacc-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/412/tacc-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/412/tacc-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/412/tacc-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -8037.74         -8047.44
2      -8037.77         -8047.07
--------------------------------------
TOTAL    -8037.75         -8047.27
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/412/tacc-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/412/tacc-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/412/tacc-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.235759    0.000220    0.208185    0.266069    0.235599   1131.15   1316.07    1.000
r(A<->C){all}   0.103563    0.000210    0.075507    0.131568    0.102832   1083.20   1127.47    1.000
r(A<->G){all}   0.242143    0.000421    0.202684    0.282294    0.241357   1082.62   1210.86    1.000
r(A<->T){all}   0.102883    0.000215    0.075659    0.131765    0.102306   1046.48   1167.50    1.000
r(C<->G){all}   0.082336    0.000203    0.056040    0.111397    0.081430   1154.51   1174.15    1.000
r(C<->T){all}   0.345736    0.000668    0.296136    0.396621    0.345073    848.56    982.85    1.000
r(G<->T){all}   0.123340    0.000286    0.092081    0.157259    0.122865   1286.05   1330.03    1.000
pi(A){all}      0.312119    0.000053    0.297438    0.326038    0.312200   1254.73   1351.89    1.000
pi(C){all}      0.233095    0.000044    0.219178    0.245262    0.233198   1044.18   1109.85    1.000
pi(G){all}      0.243310    0.000044    0.229566    0.255292    0.243319   1230.23   1328.34    1.000
pi(T){all}      0.211476    0.000041    0.198100    0.223599    0.211565   1366.25   1376.90    1.000
alpha{1,2}      0.105576    0.005329    0.000119    0.235892    0.097140   1232.49   1247.70    1.000
alpha{3}        2.445518    0.678519    1.067996    4.108226    2.327241   1501.00   1501.00    1.000
pinvar{all}     0.056744    0.002561    0.000041    0.155093    0.041861   1130.50   1315.75    1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-7664.962769
Model 2: PositiveSelection	-7664.66764
Model 0: one-ratio	-7677.250888
Model 3: discrete	-7664.398649
Model 7: beta	-7665.009415
Model 8: beta&w>1	-7664.506577


Model 0 vs 1	24.57623799999965

Model 2 vs 1	0.5902580000001763

Model 8 vs 7	1.0056760000006761
>C1
MEFDDAENGLGMGFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGLKPEDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
LKSNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSVS
TLGAEFNDPLAVSQHNNVSYEAMDVDDLNETMEMLKDVLNAEDRHLMQTH
ILSVTQSKPENNFVHYHPNQEQNRVELDQLAKHSKPNSDAKESESLVESV
LSEESGTQSFEPKLTLSALDSTKDLAKHQEEMQTNTKDIFQKEKHHPVSS
AQVKDAQNPKEPEKALNLKEASSELSTKSAKSLEYPNQEKQFSVAVESME
RPCTAISLEQNASPAMEATEDRTVEELDQMDVDESMKVDDATVLNSCRQE
QINAHSPVSSKFFLKLCVQNDTDCQDNKMDQKTAGKESALKMTEIELPVE
SVPSASLSPPTPALQAKIIELSLSPPIPTHRPKTAEELEFLALRELPLPD
GVSTAGKVECKQLSHGLVPIVAVLPTPLYLDLKGNTTTASLPEPTSPSFP
IKEPAEKQSHFPRSPRAQLEQKDMPYLEEAVVERSSHRKQSDFGVIAKSP
IVFELTQPSPEKQHLNETLPMSEISPTSSNMTFDSGSITEDKSQKGTENI
EPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCMENENPRRTF
CMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSHQQTWKERQAPI
SNSPPIPTHQRLNRPPEAISPVSPLGNGTVVLEEQTLSAKEQATLSASDE
KDDVFLEHFGAISPVSDDMFKTSSASNNQAKFRVNADEETGGKGASAMIR
KRSGTAGEQEEIFDAEFHDGVNNQNLILNSSDFDYLYTKGSNSVPIDRSS
LLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLLSPTLEEHETSD
GNQSFGVISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDNDCNKTFDNSNT
NTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELREEALIKRITEK
DKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANYHHL
TSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQRYD
KMKNHAMQQLEIANKKLDTYSREHADETKKLKALLKKEEISRVSMTEQLQ
QKSRENADLLKICEELIYGKGQGGSSooo
>C2
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLDAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHLMQT
HILSVTQPKPENNSVHLPNQEQNRVELDQLAKHSKRNSNAKEPPFVESVL
SEESGTQLLEPELTLSALDSTKDLAKHHEEKQTDTEDVFQKEDHHPVSSA
QMEEAQNPEEPKIALNLKEASSELSTKLANNLECPYQEKQLESMERTCTA
ISLEQSASPAMEATEDRNVEELDHMDVDESMRVDDAPVLNSCRQEQMHTL
SPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPVESVPSA
PLSPPIPTLQAKMMELPRSPPIPTHRPKTAEELEFLALRELPLPDDDPTA
EKVVFKQLSHGRVPVVAVSPTPLSLDLKGNTTTASLPEPTSPSFPIKEPA
EKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDFGAGVIAKSPIVF
QLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITEDKSQKGTENIEPS
SNFAVSLGSVDDKQRRTFSVVQATKEEEEAKSRRTFCMEKENTRRTFCMQ
QNASPAVEATEDTGADEVMDVDISMRADEVAVMNSPQQTWKERQAPISNS
PPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSAKEQATLSASDEK
DDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEETGVKGASAMIRK
RSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTKGSNSAPIDRSSL
LLKFDPLLGAPVPVNHPNQQEKALQNILGSNQHQNRLLSPTLEEHETSDG
NQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDNDCNKTFDNSNTN
TEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELREEALIKRITEKD
KTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANYHHLT
SLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQRYDK
MKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEEISRVSMTEQLQQ
KSRENADLLKICEELIYGKGQGGSSoooo
>C3
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLTTDMDTQ
LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLEAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHFMQT
HILSVTQPKPENNSVHLPNQEQNGVELDQLAKHSKRNSNAKEPPFVESVL
SEESGTQLLEPELTLSALDSTKDLAKHHEEEQTDTEDVFQKEDHHPVSSA
QMKEAQNPEEAKMALNLKEASSELSTKLANNLECPNQEKQFSVAVESMER
TCTAISLEQSASPAMEATEDRTVEELDHMDVDESMRVDDAPVLNSCRQEQ
MHALSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPVES
VPSAPLSPPIPTLQAKMMELPLSPPIPTHRPKTAEELEFLALRELPLPDD
DPTAEKVVFKQLSHGRVPVVAVSPTPLSLDLKGNTNTARLPEPTSPSFPI
KEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDFGAGVIAKS
PIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITEDKSQKGTEN
IEPSSTFAVSLGSVDNKQRRTFSLVQPTKEEEEAKSRRTFCMEKENTRRT
FCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSPQQTWKERQAP
ISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSAKEQATLSA
SDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEETGVKGASA
MIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTKGSNSAPID
RSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLLSPTLEEHE
TSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDNDCNKTFDN
SNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELREEALIKRI
TEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANY
HHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQ
RYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEEISRVSMTE
QLQQKSRENADLLKICEELIYGKGQGGSS
>C4
MEFDGAENGLGMEFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMEQQK
AMAAALGHQAAVAGSLQLDAVKVPKFGGLPEFDEMQIPELAPLSTDIDTQ
LKCNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLEADFKDPLAVSQHNNVSYEAMDVDDINETMEMLKDVLDPEDHQLMQTH
ILSVSQPKTETISVQYNQNQEQKRIEQDQLAKYPESNSDATKPSLLESVF
PDQPVTPLLEPNLNLTALDYTKELAKHRDENQKDTKDEPQKEDHQPICSA
QMENANSEEPLNLNEATEPSTYPAKTPKCLNQDMPFAVAVESMEKTFTPI
SHEQNASPAMEATEDRTVTELEHMEVDDFMRVSEAIVLTSSRQEQVNAHS
PVSRKSCLNLCGKNDMDFQDNKMDHKTAGLESQLKMTEIELPAAQISTPI
PTLQTRSKELPFSPPIPTHRPKAAEELEFRTLRELPLPDDVPSGGKVGVK
QISHGRAPFVAVTPTQLRSTTHNSLDLDGKTTSAISPEPTSPSFPIRGPA
ETQSHFPRSPRAPLEQKDMPYLEEAVVEPSSDRNQSVFGAGVIEKSAIVF
QLTQPSPQKQNLNETLPMSEMSPTSSNMAFDSENISENKPQNDTDTFAVS
VGSVDNKQRRTFSVIQSPTEEEESKSRRIFCMEKENPRHTFCIQHKASPA
VGATEDTGADDVMDVDVSMRAYDVAVLKSPQQTWKEPQAPISNSPPIPSH
QHLKRPPIHETNSPVSPLRNGTVALEEQALSAKEQATLSASDEKDDVFLE
HFGAISPVSDDMFKTISGSNNQEKIRVNANREIEGKPAPALSKQRGGAPG
ELEAIIDAEFHDGASNQNLILKSSDFDYLYTKGSNNAPIDRSSLLLKFDP
LLGAPVPVNHPNQQEQALQNILGSNQYQNRVLSPTLEEHETSDGNQSFGL
ISSCKDISVKWDCKPPVDTSKHVKMSVDVIDNDCNKTFDNFNANTEDKTH
NYNNMDELEKKIKNEVTRSEDIEKKLKEGEQREEALIKRITEKDKTNAKL
NGVIEAYEKAIAELISEKEQQAQLHERQLQEVQADRDANYHHLTSLETTF
SDLHVKYEKSKEMTSQLKSNEESLLAERKQMMDNLRLQEQRYDKMKNHAM
QQLEIANKKLDTYAREHADETKKLKALLKKEEISRVSMTEQLQQKSRENA
DLLKICEELIYGKGQGGSSoooooooooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=4, Len=1247 

C1              MEFDDAENGLGMGFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMDQQK
C2              MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
C3              MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
C4              MEFDGAENGLGMEFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMEQQK
                ****.******* *****:***************************:***

C1              AMAAALGHQTAVPGGLKPEDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
C2              AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
C3              AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLTTDMDTQ
C4              AMAAALGHQAAVAGSLQLDAVKVPKFGGLPEFDEMQIPELAPLSTDIDTQ
                *********:**.*. : :   ************ ********:**:***

C1              LKSNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSVS
C2              LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
C3              LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
C4              LKCNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
                ** *********************************************.*

C1              TLGAEFNDPLAVSQHNNVSYEAMDVDD-LNETMEMLKDVLNAEDRHLMQT
C2              TLDAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHLMQT
C3              TLEAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHFMQT
C4              TLEADFKDPLAVSQHNNVSYEAMDVDD-INETMEMLKDVLDPEDHQLMQT
                ** * *:************** ***** :********* *:.**:::***

C1              HILSVTQSKPENNFVHYHPNQEQNRVELDQLAKHSKPNSDAKESESLVES
C2              HILSVTQPKPENNSVH-LPNQEQNRVELDQLAKHSKRNSNAKEP-PFVES
C3              HILSVTQPKPENNSVH-LPNQEQNGVELDQLAKHSKRNSNAKEP-PFVES
C4              HILSVSQPKTETISVQYNQNQEQKRIEQDQLAKYPESNSDATKP-SLLES
                *****:*.*.*.  *:   ****: :* *****:.: **:*.:. .::**

C1              VLSEESGTQSFEPKLTLSALDSTKDLAKHQEEMQTNTKDIFQKEKHHPVS
C2              VLSEESGTQLLEPELTLSALDSTKDLAKHHEEKQTDTEDVFQKEDHHPVS
C3              VLSEESGTQLLEPELTLSALDSTKDLAKHHEEEQTDTEDVFQKEDHHPVS
C4              VFPDQPVTPLLEPNLNLTALDYTKELAKHRDENQKDTKDEPQKEDHQPIC
                *:.::. *  :**:*.*:*** **:****::* *.:*:*  ***.*:*:.

C1              SAQVKDAQNPKEPEKALNLKEASSELSTKSAKSLEYPNQEKQFSVAVESM
C2              SAQMEEAQNPEEPKIALNLKEASSELSTKLANNLECPYQEKQ----LESM
C3              SAQMKEAQNPEEAKMALNLKEASSELSTKLANNLECPNQEKQFSVAVESM
C4              SAQMENANS-EEP---LNLNEAT-EPSTYPAKTPKCLNQDMPFAVAVESM
                ***:::*:. :*.   ***:**: * **  *:. :   *:      :***

C1              ERPCTAISLEQNASPAMEATEDRTVEELDQMDVDESMKVDDATVLNSCRQ
C2              ERTCTAISLEQSASPAMEATEDRNVEELDHMDVDESMRVDDAPVLNSCRQ
C3              ERTCTAISLEQSASPAMEATEDRTVEELDHMDVDESMRVDDAPVLNSCRQ
C4              EKTFTPISHEQNASPAMEATEDRTVTELEHMEVDDFMRVSEAIVLTSSRQ
                *:. *.** **.***********.* **::*:**: *:*.:* **.*.**

C1              EQINAHSPVSSKFFLKLCVQNDTDCQDNKMDQKTAGKESALKMTEIELPV
C2              EQMHTLSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPV
C3              EQMHALSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPV
C4              EQVNAHSPVSRKSCLNLCGKNDMDFQDNKMDHKTAGLESQLKMTEIEL--
                **::: **** *   : * :** * *:****:**** ** ********  

C1              ESVPSASLSPPTPALQAKIIELSLSPPIPTHRPKTAEELEFLALRELPLP
C2              ESVPSAPLSPPIPTLQAKMMELPRSPPIPTHRPKTAEELEFLALRELPLP
C3              ESVPSAPLSPPIPTLQAKMMELPLSPPIPTHRPKTAEELEFLALRELPLP
C4              ---PAAQISTPIPTLQTRSKELPFSPPIPTHRPKAAEELEFRTLRELPLP
                   *:* :*.* *:**::  **. **********:****** :*******

C1              DGVSTAGKVECKQLSHGLVPIVAVLPTPLY------LDLKGNTTTASLPE
C2              DDDPTAEKVVFKQLSHGRVPVVAVSPTPLS------LDLKGNTTTASLPE
C3              DDDPTAEKVVFKQLSHGRVPVVAVSPTPLS------LDLKGNTNTARLPE
C4              DDVPSGGKVGVKQISHGRAPFVAVTPTQLRSTTHNSLDLDGKTTSAISPE
                *. .:. **  **:*** .*.*** ** *       ***.*:*.:*  **

C1              PTSPSFPIKEPAEKQSHFPRSPRAQLEQKDMPYLEEAVVERSSHRKQSDF
C2              PTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDF
C3              PTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDF
C4              PTSPSFPIRGPAETQSHFPRSPRAPLEQKDMPYLEEAVVEPSSDRNQSVF
                ********: ***.**********  ************** **.*:** *

C1              G--VIAKSPIVFELTQPSPEKQHLNETLPMSEISPTSSNMTFDSGSITED
C2              GAGVIAKSPIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITED
C3              GAGVIAKSPIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITED
C4              GAGVIEKSAIVFQLTQPSPQKQNLNETLPMSEMSPTSSNMAFDSENISEN
                *  ** **.***:******:**:*********:***.***:*** .*:*:

C1              KSQKGTENIEPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCM
C2              KSQKGTENIEPSSNFAVSLGSVDDKQRRTFSVVQATKEEEEAKSRRTFCM
C3              KSQKGTENIEPSSTFAVSLGSVDNKQRRTFSLVQPTKEEEEAKSRRTFCM
C4              KPQNDTD------TFAVSVGSVDNKQRRTFSVIQSPTEEEESKSRRIFCM
                *.*:.*:      .:***:****:*******::*...****:**** ***

C1              ENENPRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSHQQ
C2              EKENTRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMNSPQQ
C3              EKENTRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSPQQ
C4              EKENPRHTFCIQHKASPAVGATEDTGADDVMDVDVSMRAYDVAVLKSPQQ
                *:**.*:***:*::***** ********:*****:**** :***::* **

C1              TWKERQAPISNSPPIPTHQRLNRPP--EAISPVSPLGNGTVVLEEQTLSA
C2              TWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSA
C3              TWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSA
C4              TWKEPQAPISNSPPIPSHQHLKRPPIHETNSPVSPLRNGTVALEEQALSA
                **** ***********:**:*:***  *: ****** ****.****:***

C1              KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSASNNQAKFRVNADEE
C2              KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEE
C3              KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEE
C4              KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTISGSNNQEKIRVNANRE
                ********************************* *.**** *:****:.*

C1              TGGKGASAMIRKRSGTAGEQEEIFDAEFHDGVNNQNLILNSSDFDYLYTK
C2              TGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTK
C3              TGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTK
C4              IEGKPAPALSKQRGGAPGELEAIIDAEFHDGASNQNLILKSSDFDYLYTK
                   * *.*: ::*.*:.** * *:*******..******:**********

C1              GSNSVPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLL
C2              GSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEKALQNILGSNQHQNRLL
C3              GSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLL
C4              GSNNAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQYQNRVL
                ***..****************************:**********:***:*

C1              SPTLEEHETSDGNQSFGVISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
C2              SPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
C3              SPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
C4              SPTLEEHETSDGNQSFGLISSCKDISVKWDCKPPVDTSKHVKMSVDVIDN
                *****************:***.** : *** ***** :************

C1              DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
C2              DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
C3              DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
C4              DCNKTFDNFNANTEDKTHNYNNMDELEKKIKNEVTRSEDIEKKLKEGEQR
                ******** *:**********:************************** *

C1              EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
C2              EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
C3              EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
C4              EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
                **************************************************

C1              QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
C2              QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
C3              QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
C4              QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
                **************************************************

C1              DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYSREHADETKKLKALLKKEE
C2              DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
C3              DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
C4              DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
                *******************************:******************

C1              ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSooo-------
C2              ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSoooo------
C3              ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS----------
C4              ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSoooooooooo
                *************************************          




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 4 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 1229 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 1229 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [15480]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [15480]--->[15229]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/412/tacc-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.406 Mb, Max= 31.108 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MEFDDAENGLGMGFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGLKPEDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
LKSNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSVS
TLGAEFNDPLAVSQHNNVSYEAMDVDD-LNETMEMLKDVLNAEDRHLMQT
HILSVTQSKPENNFVHYHPNQEQNRVELDQLAKHSKPNSDAKESESLVES
VLSEESGTQSFEPKLTLSALDSTKDLAKHQEEMQTNTKDIFQKEKHHPVS
SAQVKDAQNPKEPEKALNLKEASSELSTKSAKSLEYPNQEKQFSVAVESM
ERPCTAISLEQNASPAMEATEDRTVEELDQMDVDESMKVDDATVLNSCRQ
EQINAHSPVSSKFFLKLCVQNDTDCQDNKMDQKTAGKESALKMTEIELPV
ESVPSASLSPPTPALQAKIIELSLSPPIPTHRPKTAEELEFLALRELPLP
DGVSTAGKVECKQLSHGLVPIVAVLPTPLY------LDLKGNTTTASLPE
PTSPSFPIKEPAEKQSHFPRSPRAQLEQKDMPYLEEAVVERSSHRKQSDF
G--VIAKSPIVFELTQPSPEKQHLNETLPMSEISPTSSNMTFDSGSITED
KSQKGTENIEPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCM
ENENPRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSHQQ
TWKERQAPISNSPPIPTHQRLNRPP--EAISPVSPLGNGTVVLEEQTLSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSASNNQAKFRVNADEE
TGGKGASAMIRKRSGTAGEQEEIFDAEFHDGVNNQNLILNSSDFDYLYTK
GSNSVPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGVISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYSREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSooo-------
>C2
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLDAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHLMQT
HILSVTQPKPENNSVH-LPNQEQNRVELDQLAKHSKRNSNAKEP-PFVES
VLSEESGTQLLEPELTLSALDSTKDLAKHHEEKQTDTEDVFQKEDHHPVS
SAQMEEAQNPEEPKIALNLKEASSELSTKLANNLECPYQEKQ----LESM
ERTCTAISLEQSASPAMEATEDRNVEELDHMDVDESMRVDDAPVLNSCRQ
EQMHTLSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPV
ESVPSAPLSPPIPTLQAKMMELPRSPPIPTHRPKTAEELEFLALRELPLP
DDDPTAEKVVFKQLSHGRVPVVAVSPTPLS------LDLKGNTTTASLPE
PTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDF
GAGVIAKSPIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITED
KSQKGTENIEPSSNFAVSLGSVDDKQRRTFSVVQATKEEEEAKSRRTFCM
EKENTRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMNSPQQ
TWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEE
TGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTK
GSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEKALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSoooo------
>C3
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLTTDMDTQ
LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLEAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHFMQT
HILSVTQPKPENNSVH-LPNQEQNGVELDQLAKHSKRNSNAKEP-PFVES
VLSEESGTQLLEPELTLSALDSTKDLAKHHEEEQTDTEDVFQKEDHHPVS
SAQMKEAQNPEEAKMALNLKEASSELSTKLANNLECPNQEKQFSVAVESM
ERTCTAISLEQSASPAMEATEDRTVEELDHMDVDESMRVDDAPVLNSCRQ
EQMHALSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPV
ESVPSAPLSPPIPTLQAKMMELPLSPPIPTHRPKTAEELEFLALRELPLP
DDDPTAEKVVFKQLSHGRVPVVAVSPTPLS------LDLKGNTNTARLPE
PTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDF
GAGVIAKSPIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITED
KSQKGTENIEPSSTFAVSLGSVDNKQRRTFSLVQPTKEEEEAKSRRTFCM
EKENTRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSPQQ
TWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEE
TGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTK
GSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS----------
>C4
MEFDGAENGLGMEFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMEQQK
AMAAALGHQAAVAGSLQLDAVKVPKFGGLPEFDEMQIPELAPLSTDIDTQ
LKCNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLEADFKDPLAVSQHNNVSYEAMDVDD-INETMEMLKDVLDPEDHQLMQT
HILSVSQPKTETISVQYNQNQEQKRIEQDQLAKYPESNSDATKP-SLLES
VFPDQPVTPLLEPNLNLTALDYTKELAKHRDENQKDTKDEPQKEDHQPIC
SAQMENANS-EEP---LNLNEAT-EPSTYPAKTPKCLNQDMPFAVAVESM
EKTFTPISHEQNASPAMEATEDRTVTELEHMEVDDFMRVSEAIVLTSSRQ
EQVNAHSPVSRKSCLNLCGKNDMDFQDNKMDHKTAGLESQLKMTEIEL--
---PAAQISTPIPTLQTRSKELPFSPPIPTHRPKAAEELEFRTLRELPLP
DDVPSGGKVGVKQISHGRAPFVAVTPTQLRSTTHNSLDLDGKTTSAISPE
PTSPSFPIRGPAETQSHFPRSPRAPLEQKDMPYLEEAVVEPSSDRNQSVF
GAGVIEKSAIVFQLTQPSPQKQNLNETLPMSEMSPTSSNMAFDSENISEN
KPQNDTD------TFAVSVGSVDNKQRRTFSVIQSPTEEEESKSRRIFCM
EKENPRHTFCIQHKASPAVGATEDTGADDVMDVDVSMRAYDVAVLKSPQQ
TWKEPQAPISNSPPIPSHQHLKRPPIHETNSPVSPLRNGTVALEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTISGSNNQEKIRVNANRE
IEGKPAPALSKQRGGAPGELEAIIDAEFHDGASNQNLILKSSDFDYLYTK
GSNNAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQYQNRVL
SPTLEEHETSDGNQSFGLISSCKDISVKWDCKPPVDTSKHVKMSVDVIDN
DCNKTFDNFNANTEDKTHNYNNMDELEKKIKNEVTRSEDIEKKLKEGEQR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSoooooooooo

FORMAT of file /tmp/tmp5370950886461424214aln Not Supported[FATAL:T-COFFEE]
>C1
MEFDDAENGLGMGFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGLKPEDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
LKSNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSVS
TLGAEFNDPLAVSQHNNVSYEAMDVDD-LNETMEMLKDVLNAEDRHLMQT
HILSVTQSKPENNFVHYHPNQEQNRVELDQLAKHSKPNSDAKESESLVES
VLSEESGTQSFEPKLTLSALDSTKDLAKHQEEMQTNTKDIFQKEKHHPVS
SAQVKDAQNPKEPEKALNLKEASSELSTKSAKSLEYPNQEKQFSVAVESM
ERPCTAISLEQNASPAMEATEDRTVEELDQMDVDESMKVDDATVLNSCRQ
EQINAHSPVSSKFFLKLCVQNDTDCQDNKMDQKTAGKESALKMTEIELPV
ESVPSASLSPPTPALQAKIIELSLSPPIPTHRPKTAEELEFLALRELPLP
DGVSTAGKVECKQLSHGLVPIVAVLPTPLY------LDLKGNTTTASLPE
PTSPSFPIKEPAEKQSHFPRSPRAQLEQKDMPYLEEAVVERSSHRKQSDF
G--VIAKSPIVFELTQPSPEKQHLNETLPMSEISPTSSNMTFDSGSITED
KSQKGTENIEPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCM
ENENPRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSHQQ
TWKERQAPISNSPPIPTHQRLNRPP--EAISPVSPLGNGTVVLEEQTLSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSASNNQAKFRVNADEE
TGGKGASAMIRKRSGTAGEQEEIFDAEFHDGVNNQNLILNSSDFDYLYTK
GSNSVPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGVISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYSREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSooo-------
>C2
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLDAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHLMQT
HILSVTQPKPENNSVH-LPNQEQNRVELDQLAKHSKRNSNAKEP-PFVES
VLSEESGTQLLEPELTLSALDSTKDLAKHHEEKQTDTEDVFQKEDHHPVS
SAQMEEAQNPEEPKIALNLKEASSELSTKLANNLECPYQEKQ----LESM
ERTCTAISLEQSASPAMEATEDRNVEELDHMDVDESMRVDDAPVLNSCRQ
EQMHTLSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPV
ESVPSAPLSPPIPTLQAKMMELPRSPPIPTHRPKTAEELEFLALRELPLP
DDDPTAEKVVFKQLSHGRVPVVAVSPTPLS------LDLKGNTTTASLPE
PTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDF
GAGVIAKSPIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITED
KSQKGTENIEPSSNFAVSLGSVDDKQRRTFSVVQATKEEEEAKSRRTFCM
EKENTRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMNSPQQ
TWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEE
TGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTK
GSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEKALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSoooo------
>C3
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLTTDMDTQ
LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLEAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHFMQT
HILSVTQPKPENNSVH-LPNQEQNGVELDQLAKHSKRNSNAKEP-PFVES
VLSEESGTQLLEPELTLSALDSTKDLAKHHEEEQTDTEDVFQKEDHHPVS
SAQMKEAQNPEEAKMALNLKEASSELSTKLANNLECPNQEKQFSVAVESM
ERTCTAISLEQSASPAMEATEDRTVEELDHMDVDESMRVDDAPVLNSCRQ
EQMHALSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPV
ESVPSAPLSPPIPTLQAKMMELPLSPPIPTHRPKTAEELEFLALRELPLP
DDDPTAEKVVFKQLSHGRVPVVAVSPTPLS------LDLKGNTNTARLPE
PTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDF
GAGVIAKSPIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITED
KSQKGTENIEPSSTFAVSLGSVDNKQRRTFSLVQPTKEEEEAKSRRTFCM
EKENTRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSPQQ
TWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEE
TGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTK
GSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS----------
>C4
MEFDGAENGLGMEFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMEQQK
AMAAALGHQAAVAGSLQLDAVKVPKFGGLPEFDEMQIPELAPLSTDIDTQ
LKCNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLEADFKDPLAVSQHNNVSYEAMDVDD-INETMEMLKDVLDPEDHQLMQT
HILSVSQPKTETISVQYNQNQEQKRIEQDQLAKYPESNSDATKP-SLLES
VFPDQPVTPLLEPNLNLTALDYTKELAKHRDENQKDTKDEPQKEDHQPIC
SAQMENANS-EEP---LNLNEAT-EPSTYPAKTPKCLNQDMPFAVAVESM
EKTFTPISHEQNASPAMEATEDRTVTELEHMEVDDFMRVSEAIVLTSSRQ
EQVNAHSPVSRKSCLNLCGKNDMDFQDNKMDHKTAGLESQLKMTEIEL--
---PAAQISTPIPTLQTRSKELPFSPPIPTHRPKAAEELEFRTLRELPLP
DDVPSGGKVGVKQISHGRAPFVAVTPTQLRSTTHNSLDLDGKTTSAISPE
PTSPSFPIRGPAETQSHFPRSPRAPLEQKDMPYLEEAVVEPSSDRNQSVF
GAGVIEKSAIVFQLTQPSPQKQNLNETLPMSEMSPTSSNMAFDSENISEN
KPQNDTD------TFAVSVGSVDNKQRRTFSVIQSPTEEEESKSRRIFCM
EKENPRHTFCIQHKASPAVGATEDTGADDVMDVDVSMRAYDVAVLKSPQQ
TWKEPQAPISNSPPIPSHQHLKRPPIHETNSPVSPLRNGTVALEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTISGSNNQEKIRVNANRE
IEGKPAPALSKQRGGAPGELEAIIDAEFHDGASNQNLILKSSDFDYLYTK
GSNNAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQYQNRVL
SPTLEEHETSDGNQSFGLISSCKDISVKWDCKPPVDTSKHVKMSVDVIDN
DCNKTFDNFNANTEDKTHNYNNMDELEKKIKNEVTRSEDIEKKLKEGEQR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSSoooooooooo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:1247 S:98 BS:1247
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# PW_SEQ_DISTANCES 
BOT	    0    1	 91.82 C1	 C2	 91.82
TOP	    1    0	 91.82 C2	 C1	 91.82
BOT	    0    2	 91.99 C1	 C3	 91.99
TOP	    2    0	 91.99 C3	 C1	 91.99
BOT	    0    3	 79.87 C1	 C4	 79.87
TOP	    3    0	 79.87 C4	 C1	 79.87
BOT	    1    2	 98.29 C2	 C3	 98.29
TOP	    2    1	 98.29 C3	 C2	 98.29
BOT	    1    3	 81.27 C2	 C4	 81.27
TOP	    3    1	 81.27 C4	 C2	 81.27
BOT	    2    3	 81.35 C3	 C4	 81.35
TOP	    3    2	 81.35 C4	 C3	 81.35
AVG	 0	 C1	  *	 87.89
AVG	 1	 C2	  *	 90.46
AVG	 2	 C3	  *	 90.54
AVG	 3	 C4	  *	 80.83
TOT	 TOT	  *	 87.43
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGAATTCGACGACGCAGAAAATGGCCTAGGAATGGGATTTGGTGGTCG
C2              ATGGAATTCGACGGCGCAGAAAATGGCCTGGGAATGGAATTTGGCGGTCG
C3              ATGGAATTCGACGGCGCAGAAAATGGCCTGGGAATGGAATTTGGCGGTCG
C4              ATGGAATTCGACGGCGCAGAGAACGGCCTGGGAATGGAATTTGGCGGTCG
                *************.******.** *****.*******.****** *****

C1              CGGCGTTCTGCGGGAGATCAACAAAAACGATGGCGGCATTAAGCTGAGTC
C2              CGGCATTCTGCGGGAGATCAACAAAAACGATGGCGGCATTAAGCTGAGTC
C3              CGGCATTCTGCGGGAGATCAACAAAAACGATGGCGGCATTAAGCTGAGTC
C4              CGGCGTTCTGCGGGAGATCAACAAAAACGATGGCGGCATTAAGCTGAGTC
                ****.*********************************************

C1              CGTTGGCGGTGAAGCCCAGTCCCAAGCCAACGAGCATGGATCAACAGAAG
C2              CGCTGGCGGTGAAGCCCAGTCCCAAGCCGACGAGCATGGATCAACAGAAG
C3              CGCTGGCGGTGAAGCCCAGTCCCAAGCCGACGAGCATGGATCAACAGAAG
C4              CACTGGCGGTGAAGCCCAGTCCCAAGCCGACGAGCATGGAGCAACAGAAG
                *. *************************.*********** *********

C1              GCAATGGCGGCAGCTCTGGGGCATCAGACGGCGGTACCCGGTGGACTTAA
C2              GCAATGGCGGCAGCTCTGGGCCATCAGACGGCGGTACCCGGTGGCCGTAA
C3              GCAATGGCGGCAGCGCTGGGCCATCAGACGGCGGTACCCGGTGGCCGTAA
C4              GCAATGGCTGCAGCTCTGGGACATCAGGCGGCAGTAGCCGGTAGCCTTCA
                ******** ***** ***** ******.****.*** *****.*.* *.*

C1              GCCAGAAGACGACCTCGTTCCAAAGTTTGGAGGTCTTCCCGAGTTCGATG
C2              GCTAGACGACGACCTCGTTCCAAAGTTTGGAGGTCTTCCCGAGTTCGATG
C3              GCTGGACGACGACCTCGTTCCAAAGTTTGGAGGTCTTCCCGAGTTCGATG
C4              GCTAGACGCAGTTAAGGTTCCAAAATTTGGAGGTCTTCCCGAGTTCGATG
                ** .**.*..*: .: ********.*************************

C1              AGACGCAAATACCGGAACTAGCTCCTTTAAGTACCGATATGGATACTCAA
C2              AGACGCAAATACCGGAACTGGCTCCTTTAAGTACCGATATGGACACTCAA
C3              AGACTCAAATACCGGAACTGGCTCCTTTAACTACCGATATGGACACTCAA
C4              AAATGCAAATACCGGAACTGGCTCCTTTAAGTACCGATATAGACACTCAA
                *.*  **************.********** *********.** ******

C1              CTGAAATCCAACCATTCGGATTCGGATGTTTTTGTCGAGTGTTTATCGCT
C2              CTGAAAACCAACCATTCGGATTCGGATGTTTTTGTCGAGTGTTTATCGCT
C3              CTGAAAACCAACCATTCGGATTCTGATGTTTTTGTCGAGTGTTTATCGCT
C4              TTGAAATGCAACCATTCGGATTCTGATGTTTTTGTCGAGTGTTTATCGCT
                 *****: *************** **************************

C1              TCATAGCGAGCGCTACACCGGAGATCGATCGGAGTTAGAGGCATATTCAA
C2              TCATAGCGAGCGCTATACCGGAGATCGATCGGAGTTAGAGGCCTATTCAA
C3              TCATAGCGAGCGCTATACCGGAGATCGATCGGAGTTAGAGGCCTATTCAA
C4              TCATAGCGAGCGCTATACAGGAGATCGATCGGAGCTAGAGGCCTATTCAA
                *************** **.*************** *******.*******

C1              GTGCCCTTAATGATGTTTTGGAGCAGCAGCTGTCCATGACCTCAGTTTCT
C2              GTGCCCTTAATGATGTTTTGGAGCAGCAGCTGTCCATGACCTCAGCTTCT
C3              GTGCCCTCAATGATGTTTTGGAGCAGCAGCTGTCCATGACCTCAGCTTCT
C4              GTGCCCTTAATGATGTTTTGGAGCAGCAGCTGTCTATGACCTCAGCTTCT
                ******* ************************** ********** ****

C1              ACACTGGGAGCTGAATTCAACGATCCTTTGGCAGTTAGCCAGCACAACAA
C2              ACACTGGATGCTGCATTCAACGATCCTTTAGCGGTTAGCCAGCACAACAA
C3              ACACTGGAAGCTGCATTCAACGATCCTTTGGCGGTTAGCCAGCACAACAA
C4              ACACTGGAAGCTGATTTTAAAGATCCTTTGGCGGTTAGCCAGCACAACAA
                *******.:****.:** **.********.**.*****************

C1              CGTCAGCTATGAAGCCATGGATGTGGATGAC---CTAAACGAAACCATGG
C2              CGTCAGCTATGAAGACATGGATGTGGATGATGACCTAAACGAAACCATGG
C3              CGTCAGCTATGAAGACATGGATGTGGATGATGACCTAAACGAAACCATGG
C4              CGTCAGCTATGAAGCCATGGATGTGGATGAC---ATAAACGAAACTATGG
                **************.***************    .********** ****

C1              AAATGTTAAAGGACGTCTTGAATGCGGAAGACCGTCATCTTATGCAAACG
C2              AAATGTTAAAGGACTCCTTGGATGCGGAAGACCATCATCTTATGCAAACG
C3              AAATGTTAAAGGACTCCTTGGATGCGGAAGACCATCATTTTATGCAAACG
C4              AAATGTTAAAGGACGTTTTGGACCCGGAAGACCATCAGCTTATGCAAACG
                **************   ***.*  *********.***  ***********

C1              CATATTCTCAGCGTAACCCAGTCAAAACCAGAGAATAATTTTGTGCACTA
C2              CATATTCTCAGCGTAACCCAGCCAAAACCAGAGAATAATTCTGTGCAC--
C3              CATATTCTCAGCGTAACCCAGCCAAAACCAGAGAATAATTCTGTGCAC--
C4              CATATTCTCAGCGTATCGCAGCCTAAAACGGAGACTATTTCGGTGCAGTA
                ***************:* *** *:***.*.****.**:**  *****   

C1              TCATCCAAATCAGGAGCAAAATAGGGTTGAACTAGACCAGTTAGCCAAAC
C2              -CTTCCAAATCAGGAACAAAATAGGGTTGAACTAGACCAGTTAGCCAAAC
C3              -CTTCCAAATCAGGAACAAAATGGGGTTGAACTAGACCAGTTAGCCAAAC
C4              TAATCAAAATCAGGAGCAAAAGAGAATAGAACAAGACCAGTTAGCTAAAT
                 .:**.*********.***** .*..*:****:************ *** 

C1              ACTCTAAACCCAATAGTGATGCAAAGGAATCAGAATCATTGGTAGAATCA
C2              ACTCTAAACGCAATAGTAATGCAAAGGAGCCA---CCATTCGTAGAATCA
C3              ACTCTAAACGCAATAGTAATGCAAAGGAGCCA---CCATTCGTAGAATCA
C4              ACCCGGAATCGAATAGTGATGCAACGAAGCCA---TCATTATTAGAATCA
                ** * .**   ******.******.*.*. **    ****  ********

C1              GTACTGTCTGAGGAGTCTGGTACACAATCCTTTGAGCCGAAGCTCACCTT
C2              GTATTGTCTGAGGAGTCTGGTACACAACTTCTTGAGCCGGAGCTCACCTT
C3              GTATTGTCTGAGGAGTCTGGTACACAACTTCTTGAGCCGGAGCTCACTTT
C4              GTATTCCCTGATCAGCCTGTTACACCATTACTTGAACCGAATCTTAACTT
                *** *  ****  ** *** *****.*    ****.***.* ** *. **

C1              ATCTGCCTTGGACTCTACGAAAGACTTAGCTAAGCATCAAGAGGAAATGC
C2              ATCTGCCTTGGACTCTACGAAAGACTTAGCTAAGCATCATGAGGAAAAGC
C3              ATCTGCCTTGGACTCTACGAAAGACTTAGCTAAGCATCATGAGGAAGAGC
C4              AACTGCCTTAGACTACACGAAAGAGCTAGCTAAGCATCGTGATGAAAACC
                *:*******.****. ********  ************.:** ***.: *

C1              AAACAAATACAAAAGATATATTTCAGAAAGAGAAGCACCACCCGGTCAGT
C2              AAACGGATACAGAAGATGTATTTCAGAAAGAGGACCACCATCCGGTCAGT
C3              AAACGGATACAGAAGATGTATTTCAGAAAGAGGACCACCATCCCGTCAGT
C4              AAAAGGATACAAAAGATGAACCTCAGAAAGAGGACCACCAACCGATTTGT
                ***...*****.*****.:*  **********.* ***** ** .* :**

C1              AGTGCTCAGGTGAAGGACGCACAAAATCCTAAGGAGCCTGAAAAGGCCTT
C2              AGTGCGCAGATGGAGGAGGCACAAAATCCTGAGGAACCTAAAATAGCCTT
C3              AGTGCGCAGATGAAGGAGGCACAAAATCCTGAGGAAGCTAAAATGGCCTT
C4              AGTGCGCAGATGGAGAACGCAAATTCT---GAGGAGCCC---------TT
                ***** ***.**.**.* ***.*::.*   .****. *          **

C1              AAATCTCAAAGAGGCTTCTTCAGAACTGTCCACAAAATCAGCAAAATCTC
C2              AAATCTCAAAGAGGCTTCTTCAGAACTGTCCACAAAACTAGCAAATAATC
C3              AAATCTCAAAGAGGCTTCTTCAGAACTGTCCACAAAACTAGCAAATAATC
C4              AAATCTCAATGAGGCTACA---GAACCCTCCACATATCCAGCAAAAACTC
                *********:******:*:   ****  ******:*:  ******::.**

C1              TAGAATACCCTAATCAAGAGAAGCAATTTTCGGTGGCAGTAGAATCAATG
C2              TAGAATGCCCTTATCAAGAGAAGCAA------------TTAGAATCAATG
C3              TAGAATGCCCTAATCAAGAGAAGCAATTTTCGGTGGCAGTAGAATCAATG
C4              CAAAATGTCTTAATCAAGATATGCCATTTGCAGTGGCAGTAGAATCAATG
                 *.***. * *:******* *:**.*             ***********

C1              GAGAGACCATGCACTGCCATCAGCCTTGAGCAAAATGCATCCCCAGCTAT
C2              GAGAGAACATGCACTGCCATCAGCCTTGAGCAAAGTGCATCCCCAGCTAT
C3              GAGAGAACATGTACTGCCATCAGCCTTGAGCAAAGTGCATCCCCAGCTAT
C4              GAAAAAACATTCACTCCCATCAGCCATGAGCAAAATGCGTCCCCAGCTAT
                **.*.*.***  *** *********:********.***.***********

C1              GGAGGCAACTGAAGACAGGACTGTGGAGGAGCTTGATCAAATGGATGTGG
C2              GGAGGCAACTGAAGACAGAAATGTGGAGGAGCTTGATCACATGGACGTGG
C3              GGAGGCAACTGAAGACAGGACTGTGGAGGAGCTTGATCACATGGACGTGG
C4              GGAGGCAACTGAAGACAGGACTGTGACGGAGCTTGAGCACATGGAAGTGG
                ******************.*.****..********* **.***** ****

C1              ATGAATCCATGAAAGTGGATGATGCCACAGTGCTTAACTCATGTCGGCAG
C2              ATGAATCCATGAGAGTGGATGATGCCCCAGTGCTTAACTCATGTCGGCAG
C3              ATGAATCCATGAGAGTGGATGATGCCCCAGTGCTTAACTCATGTCGGCAG
C4              ATGACTTTATGAGAGTGAGTGAGGCTATAGTGCTTACCTCATCTCGGCAG
                ****.*  ****.****..*** ** . ********.***** *******

C1              GAGCAAATTAATGCTCATTCTCCCGTTTCAAGCAAATTTTTCTTAAAACT
C2              GAGCAAATGCATACTCTTTCTCCCGTTTCAAGCAAATCTTTTTCAAAACC
C3              GAGCAAATGCATGCTCTTTCTCCCGTTTCAAGCAAATCTTTTTCAAAACC
C4              GAGCAGGTTAATGCTCATTCACCCGTTTCAAGAAAATCTTGTTTAAACCT
                *****..* .**.***:***:***********.**** **  * ***.* 

C1              CTGCGTTCAAAATGATACGGATTGTCAAGATAATAAAATGGATCAAAAAA
C2              CTGCGTTGAAAATGATACGGATTTTCAAAATAATAAAATGGATCAAAAAA
C3              CTGCGTTGAAAATGATACGGATTTTCAAAATAATAAAATGGATCAAAAAA
C4              CTGCGGGAAAAATGATATGGACTTTCAAGATAATAAAATGGATCATAAAA
                *****   ********* *** * ****.****************:****

C1              CTGCAGGAAAAGAAAGTGCATTAAAGATGACTGAAATAGAGCTGCCTGTA
C2              CTGCAGGCAAAGAGAGTCCATTGAAGATGACTGAAATAGAGCTGCCTGTG
C3              CTGCAGGCAAAGAGAGTCCATTGAAGATGACTGAAATAGAGCTGCCTGTG
C4              CTGCAGGCCTGGAAAGTCAATTGAAGATGACTGAAATAGAGCTA------
                *******..:.**.*** .***.********************.      

C1              GAATCTGTCCCATCAGCTTCGCTCTCACCGCCGACACCCGCACTTCAAGC
C2              GAATCTGTCCCATCAGCACCACTCTCACCGCCGATACCCACACTTCAAGC
C3              GAATCTGTCCCTTCAGCACCACTCTCACCGCCGATACCCACACTTCAAGC
C4              ---------CCAGCAGCACAGATATCGACGCCCATACCGACACTTCAAAC
                         **: ****: ...*.**..**** * *** .********.*

C1              AAAAATTATCGAACTTTCCCTTTCCCCGCCCATACCTACACATCGCCCAA
C2              AAAAATGATGGAACTGCCCCGTTCTCCGCCCATACCTACACATCGCCCAA
C3              AAAAATGATGGAACTGCCCCTTTCTCCGCCCATACCTACACATCGCCCAA
C4              CAGAAGCAAGGAACTGCCCTTTTCTCCGCCCATACCTACACATCGCCCAA
                .*.**  *: *****  **  *** *************************

C1              AAACAGCGGAGGAACTAGAGTTCCTGGCTTTGAGGGAGCTGCCTTTGCCT
C2              AAACAGCGGAGGAACTAGAGTTCCTGGCTCTGAGGGAGCTGCCCTTGCCC
C3              AAACAGCGGAGGAACTAGAGTTCCTGGCTCTGAGGGAGCTGCCCTTGCCC
C4              AGGCAGCGGAAGAACTAGAGTTCCGGACTCTGAGGGAGTTGCCCTTGCCT
                *..*******.************* *.** ******** **** ***** 

C1              GATGGTGTCTCGACGGCGGGGAAGGTGGAATGTAAGCAGCTATCACACGG
C2              GATGATGACCCCACGGCGGAAAAGGTGGTATTTAAGCAGCTATCACACGG
C3              GATGATGACCCCACGGCGGAAAAGGTGGTATTTAAGCAGCTATCACACGG
C4              GATGATGTTCCGTCGGGAGGGAAGGTGGGAGTAAAGCAGATTTCACACGG
                ****.**:  * :*** .*..******* *  :******.*:********

C1              CCTGGTACCCATTGTGGCAGTCTTACCAACGCCACTTTAC----------
C2              CCGCGTACCCGTGGTGGCAGTCTCCCCAACGCCACTTTCC----------
C3              CCGCGTACCCGTGGTGGCAGTCTCACCAACGCCACTTTCC----------
C4              CCGCGCGCCCTTTGTGGCAGTCACACCAACGCAGCTGCGATCCACGACAC
                **  * .*** * *********: .*******..**   .          

C1              --------TTGGATCTGAAAGGGAATACAACCACTGCAAGCCTTCCAGAA
C2              --------TTGGATCTGAAAGGAAATACAACCACTGCAAGCCTTCCAGAA
C3              --------TTGGATCTGAAAGGAAATACAAACACTGCAAGACTTCCAGAA
C4              ATAATTCTTTGGATCTAGATGGAAAAACAACCTCTGCAATCTCTCCAGAA
                        ********..*:**.**:****.*:****** .  *******

C1              CCGACTTCGCCCAGTTTCCCCATCAAAGAACCTGCTGAAAAACAGTCCCA
C2              CCCACTTCGCCCAGTTTCCCCATCAAAGAACCTGCTGAAAAACAGTCCCA
C3              CCCACTTCGCCCAGTTTCCCCATCAAAGAACCTGCTGAAAAACAGTCCCA
C4              CCCACTTCGCCTAGTTTCCCTATCAGAGGACCCGCTGAAACACAATCCCA
                ** ******** ******** ****.**.*** *******.***.*****

C1              CTTTCCACGCTCACCGCGTGCTCAGCTCGAGCAAAAGGACATGCCCTATT
C2              CTTTCCACGCTCACCCCGTGCTCAGCCCGAGCAAAAGGACATGCCCTATT
C3              CTTTCCACGCTCACCCCGTGCTCAGCCCGAGCAAAAGGACATGCCCTATT
C4              TTTTCCACGCTCACCCCGTGCTCCGCTCGAGCAAAAAGACATGCCCTATT
                 ************** *******.** *********.*************

C1              TGGAAGAGGCTGTGGTAGAACGTTCATCACATCGCAAGCAAAGCGATTTC
C2              TGGAAGAGGCTGTTGTAGAACGTTCTTCAGATCGCAAGCAAAGCGATTTC
C3              TGGAAGAGGCTGTTGTAGAACGTTCTTCAGATCGCAAGCAAAGCGATTTC
C4              TGGAAGAAGCTGTGGTAGAACCTTCTTCAGATCGCAACCAAAGCGTCTTC
                *******.***** ******* ***:*** ******* *******: ***

C1              GGA------GTCATAGCGAAATCACCAATAGTCTTTGAGTTAACACAACC
C2              GGTGCCGGAGTCATAGCGAAATCACCAATAGTGTTTCAGTTAACACAACC
C3              GGTGCCGGAGTCATAGCGAAATCACCAATAGTCTTTCAGTTAACACAACC
C4              GGAGCTGGTGTCATCGAAAAGTCCGCAATTGTCTTTCAGTTGACACAACC
                **:      *****.*..**.**. ****:** *** ****.********

C1              GAGTCCTGAGAAGCAGCACCTCAACGAAACCTTGCCAATGAGCGAGATTT
C2              CAGTCCTGAGAAGCAGCACCTCAACGAAACCTTGCCCATGAGCGAAATTT
C3              GAGTCCTGAGAAGCAGCACCTCAACGAAACCTTGCCCATGAGCGAAATTT
C4              GAGTCCACAGAAGCAGAACCTCAACGAAACCTTACCCATGAGTGAGATGT
                 *****: ********.****************.**.***** **.** *

C1              CTCCCACTTCGTCAAATATGACCTTTGACAGCGGAAGCATTACGGAGGAC
C2              CTCCCACTCCGTCAAATATGACCTTTGACAGCGGAAGCATTACGGAGGAC
C3              CTCCCACTCCGTCAAATATGACCTTTGACAGCGGAAGCATTACGGAGGAC
C4              CTCCCACTTCCTCAAATATGGCATTTGACAGCGAAAACATTTCGGAGAAC
                ******** * *********.*.**********.**.****:*****.**

C1              AAATCACAGAAGGGTACAGAGAATATTGAGCCTTCTTCCACCCTTGCCGT
C2              AAATCTCAGAAGGGTACAGAGAATATTGAGCCTTCATCCAACTTCGCCGT
C3              AAATCTCAGAAGGGTACAGAGAATATTGAGCCTTCATCCACCTTCGCCGT
C4              AAGCCACAAAACGATACAGAC------------------ACATTCGCCGT
                **. *:**.** *.******                   *.. * *****

C1              AAGTCTGGGATCGGTTGATGATAAGCAGCGGCGCACTTTCTCGGTGGTTC
C2              AAGTCTGGGATCGGTCGATGATAAACAGCGCCGCACTTTCTCGGTGGTTC
C3              AAGTCTGGGATCGGTCGATAATAAGCAGCGCCGCACTTTCTCGTTGGTTC
C4              AAGTGTGGGATCGGTCGATAATAAACAGCGCCGTACTTTCTCGGTGATTC
                **** ********** ***.****.***** ** ********* **.***

C1              AGCCCACGAAGGAAGAGGAGGAGGCCAAATCGCGTCGGACTTTCTGTATG
C2              AGGCCACGAAGGAAGAGGAGGAGGCCAAATCGCGTCGGACTTTCTGTATG
C3              AGCCCACGAAGGAAGAGGAGGAGGCCAAATCGCGTCGGACTTTCTGTATG
C4              AGTCTCCGACGGAAGAGGAGGAGTCCAAATCGCGTAGGATTTTCTGCATG
                ** * .***.************* ***********.*** ****** ***

C1              GAAAATGAGAACCCTCGACGCACCTTCTGCATGCAGCAGAATGCTTCTCC
C2              GAAAAGGAGAACACTCGCCGCACCTTCTGCATGCAGCAGAATGCCTCTCC
C3              GAAAAGGAGAACACTCGCCGCACCTTCTGCATGCAGCAGAATGCCTCTCC
C4              GAAAAGGAGAACCCACGCCACACCTTCTGCATTCAGCATAAGGCTTCTCC
                ***** ******.*:**.*.************ ***** ** ** *****

C1              AGCGGTGGAGGCTACCGAAGACACCGGGGCTGATGAAGTTATGGATGTGG
C2              AGCGGTGGAGGCCACCGAAGATACCGGGGCTGATGAAGTCATGGATGTAG
C3              AGCGGTGGAGGCCACCGAAGATACCGGGGCTGATGAAGTCATGGATGTAG
C4              AGCAGTGGGGGCCACCGAAGATACCGGGGCTGATGACGTTATGGATGTAG
                ***.****.*** ******** **************.** ********.*

C1              ATATCTCCATGAGGGCAGATGAAGTAGCCGTGATGAAGTCGCATCAGCAA
C2              ATATCTCCATGAGGGCAGATGAAGTAGCCGTGATGAATTCGCCTCAGCAA
C3              ATATCTCCATGAGGGCAGATGAAGTAGCCGTGATGAAGTCGCCCCAGCAA
C4              ATGTCTCCATGAGGGCATATGATGTAGCCGTATTGAAGTCGCCTCAGCAA
                **.************** ****:********.:**** ****. ******

C1              ACTTGGAAGGAACGCCAAGCACCAATTTCAAATTCACCACCAATTCCTAC
C2              ACTTGGAAGGAACGCCAAGCACCAATTTCAAATTCACCACCTATTCCTAC
C3              ACTTGGAAGGAACGCCAAGCACCAATTTCAAATTCACCACCTATTCCTAC
C4              ACTTGGAAGGAACCTCAAGCACCAATTTCAAATTCACCGCCTATTCCTTC
                *************  ***********************.**:******:*

C1              TCACCAACGTTTAAATAGACCTCCT------GAGGCGATTTCTCCAGTGT
C2              CCATCAACATTTAAAAAGACCCCCTATCCATGAGGCGAATTCTCCAGTGT
C3              CCATCAACATTTAAAAAGACCCCCTATTCATGAGGCGAATTCTCCAGTGT
C4              CCACCAACATTTAAAGAGACCCCCTATCCATGAGACGAATTCCCCGGTGT
                 ** ****.****** ***** ***      ***.***:*** **.****

C1              CCCCATTGGGAAATGGCACCGTTGTGTTGGAGGAGCAAACTCTCTCTGCT
C2              CACCATTGGGAAATGGCACCGTTGTGTTGGAGGAGCAGGCTCTCTCTGCT
C3              CACCATTGGGAAATGGCACCGTTGTGTTGGAGGAGCAGGCTCTCTCTGCT
C4              CACCCTTGCGTAATGGTACCGTTGCGTTGGAGGAGCAGGCTCTTTCCGCC
                *.**.*** *:***** ******* ************..**** ** ** 

C1              AAAGAGCAAGCCACGCTAAGTGCCAGCGATGAGAAGGACGATGTTTTCTT
C2              AAAGAGCAAGCCACGCTGAGCGCCAGCGATGAGAAGGACGATGTTTTCTT
C3              AAAGAGCAAGCCACGCTGAGCGCCAGCGATGAGAAGGACGATGTTTTCTT
C4              AAAGAGCAAGCCACGCTAAGCGCCAGTGATGAGAAGGACGATGTTTTCTT
                *****************.** ***** ***********************

C1              GGAGCACTTTGGTGCAATTTCCCCAGTTTCGGATGACATGTTTAAAACCA
C2              GGAGCACTTTGGTGCCATTTCTCCAGTTTCGGATGACATGTTTAAAACCA
C3              GGAGCACTTTGGTGCCATTTCTCCAGTTTCGGATGACATGTTCAAAACCA
C4              AGAACACTTTGGCGCCATTTCGCCAGTTTCGGATGACATGTTCAAGACCA
                .**.******** **.***** ******************** **.****

C1              GCAGCGCTTCCAACAATCAAGCAAAGTTTAGGGTCAATGCTGATGAAGAA
C2              GCAGCGGCTCGAACAATCAAGCAAAGTTTAGGGTCAATGCTGATGAAGAA
C3              GCAGCGGCTCGAACAATCAAGCAAAGTTTAGGGTCAATGCTGATGAAGAA
C4              TAAGTGGTTCCAACAATCAAGAAAAGATTAGGGTCAATGCTAATAGGGAA
                 .** *  ** **********.****:**************.**...***

C1              ACCGGAGGCAAAGGCGCTTCTGCGATGATCAGGAAGAGAAGTGGTACAGC
C2              ACCGGAGTCAAAGGCGCTTCTGCTATGATCAGAAAGAGAAGTGGTACAGC
C3              ACCGGAGTCAAAGGCGCTTCTGCGATGATCAGGAAGAGAAGTGGTACAGC
C4              ATCGAAGGAAAACCCGCTCCTGCGTTGAGCAAACAGAGGGGTGGTGCACC
                * **.** .***  **** **** :*** **...****..*****.** *

C1              TGGCGAGCAGGAAGAGATCTTTGATGCCGAATTCCATGATGGCGTCAACA
C2              TGGCGAGCAGGAAGCGATCTTCGATGCCGAATTCCATGATGGCGCCAACA
C3              TGGCGAGCAGGAAGCGATCTTCGATGCCGAATTCCATGATGGCGCCAACA
C4              TGGCGAGCTGGAGGCGATCATTGATGCCGAATTCCACGACGGCGCCAGCA
                ********:***.*.****:* ************** ** **** **.**

C1              ACCAAAACCTAATACTAAATTCATCAGATTTTGATTATTTGTACACGAAA
C2              ACCAAAACCTGATACTGAATTCATCAGATTTTGATTATTTGTACACGAAA
C3              ACCAAAACCTGATACTGAATTCATCAGATTTTGATTATTTGTACACGAAA
C4              ACCAAAACCTAATACTGAAATCATCAGATTTTGATTATTTGTACACGAAA
                **********.*****.**:******************************

C1              GGCAGCAATAGTGTGCCTATTGACCGCAGTTCGCTGCTGTTGAAGTTTGA
C2              GGCAGCAATAGTGCGCCTATCGACCGCAGTTCGCTGCTGTTGAAGTTTGA
C3              GGCAGCAATAGTGCGCCTATCGACCGCAGTTCGCTGCTGTTGAAGTTTGA
C4              GGCAGCAATAATGCGCCTATCGACCGCAGTTCGCTGCTGCTGAAGTTTGA
                **********.** ****** ****************** **********

C1              TCCCCTCCTTGGAGCCCCTGTTCCCGTTAATCATCCGAATCAGCAGGAGC
C2              TCCCCTCCTTGGAGCCCCTGTTCCCGTTAATCATCCGAATCAGCAGGAGA
C3              TCCCCTCCTTGGAGCCCCTGTTCCCGTTAATCATCCGAATCAGCAGGAGC
C4              TCCCCTCCTTGGAGCCCCTGTTCCCGTTAATCATCCGAATCAGCAGGAGC
                *************************************************.

C1              AGGCGCTGCAGAATATTCTGGGATCGAACCAGCACCAGAACCGGCTCCTT
C2              AGGCGCTGCAGAATATTCTGGGATCGAACCAGCACCAGAACCGGCTTCTT
C3              AGGCGCTGCAGAATATTCTGGGATCGAACCAGCACCAGAACCGGCTCCTT
C4              AGGCGCTGCAGAATATTCTTGGTTCGAACCAGTATCAAAACCGTGTTCTG
                ******************* **:********* * **.*****  * ** 

C1              AGCCCAACATTGGAGGAGCACGAAACAAGTGACGGGAACCAGTCTTTTGG
C2              AGCCCAACATTGGAGGAGCACGAAACAAGTGACGGGAACCAGTCTTTTGG
C3              AGCCCAACATTGGAGGAGCACGAAACAAGTGACGGGAACCAGTCTTTTGG
C4              AGCCCAACATTGGAGGAGCACGAAACAAGTGACGGGAACCAGTCTTTTGG
                **************************************************

C1              AGTAATATCGAGTGCCAAAGATACAGCCAAGAAATGGGATTTTAAGCCAC
C2              ATTAATATCGAGTGCCAAAGATACAGCCAAGAAATGGGATTTTAAGCCAC
C3              ATTAATATCGAGTGCCAAAGATACAGCCAAGAAATGGGATTTTAAGCCAC
C4              ATTAATATCGAGTTGCAAAGATATATCAGTGAAATGGGATTGTAAGCCAC
                * ***********  ******** * *..:*********** ********

C1              CTGTGGATAGAACAAAACATGTTAAAATGAGTGTGGACGTCATTGATAAC
C2              CTGTGGATAGAACAAAACATGTTAAAATGAGTGTAGACGTCATTGATAAC
C3              CTGTGGATAGAACAAAACATGTTAAAATGAGTGTAGACGTCATTGATAAC
C4              CTGTGGATACGTCAAAACATGTTAAAATGAGTGTAGACGTCATTGATAAC
                ********* .:**********************.***************

C1              GATTGCAATAAAACCTTCGATAATTCCAACACTAATACGGAGGATAAGAC
C2              GATTGCAACAAAACCTTCGATAATTCCAACACTAATACGGAGGATAAGAC
C3              GATTGCAACAAAACCTTCGATAATTCCAACACTAATACGGAGGATAAGAC
C4              GATTGCAACAAAACCTTCGATAATTTCAACGCTAATACGGAGGACAAAAC
                ******** **************** ****.************* **.**

C1              GCACAACTACAACGATATGGATGAGCTGGAGAAGAAAATCAAAAATGAAG
C2              GCACAACTACAACGATATGGATGAGCTGGAGAAGAAAATCAAAAATGAAG
C3              GCACAACTACAACGATATGGATGAGCTGGAGAAGAAAATCAAAAATGAAG
C4              GCACAACTACAACAACATGGATGAACTGGAGAAGAAAATCAAAAATGAAG
                *************.* ********.*************************

C1              TAACGAGGTCCGAAGACATTGAAAAGAAGCTCAAGGAGGGAGAGCTGCGC
C2              TAACGCGGTCCGAAGACATTGAAAAGAAGCTCAAAGAGGGAGAGTTGCGC
C3              TAACGCGGTCCGAAGACATTGAAAAGAAGCTCAAAGAGGGAGAGCTGCGC
C4              TAACGAGGTCCGAAGACATTGAAAAGAAGCTCAAAGAGGGAGAGCAGCGC
                *****.****************************.********* :****

C1              GAGGAGGCTCTGATCAAGCGTATTACAGAAAAGGACAAAACAAATGCAAA
C2              GAGGAGGCTCTGATCAAGCGTATTACAGAAAAGGACAAAACAAATGCAAA
C3              GAGGAGGCTCTGATCAAGCGTATTACAGAAAAGGACAAAACAAATGCAAA
C4              GAGGAAGCACTGATCAAGCGTATTACAGAAAAGGACAAAACAAATGCAAA
                *****.**:*****************************************

C1              ACTAAACGGTGTCATTGAGGCATATGAGAAGGCAATTGCAGAGCTCATTA
C2              ACTAAACGGTGTCATCGAGGCGTATGAGAAAGCAATTGCAGAGCTTATCA
C3              ACTAAACGGTGTCATCGAGGCGTATGAGAAAGCAATTGCAGAGCTTATCA
C4              ACTAAACGGTGTCATCGAGGCATATGAGAAGGCAATTGCGGAGCTCATTA
                *************** *****.********.********.***** ** *

C1              GTGAGAAGGAGCAGCAAGCACAGCTTCACGAACGGCAGTTGCAGGAAGTC
C2              GTGAGAAGGAGCAGCAGGCACAGCTTCACGAACGGCAGTTGCAGGAAGTC
C3              GTGAGAAGGAGCAGCAGGCACAGCTTCACGAACGGCAGTTGCAGGAAGTC
C4              GTGAGAAGGAGCAGCAGGCGCAGCTCCACGAGCGGCAGTTGCAAGAAGTC
                ****************.**.***** *****.***********.******

C1              CAGGCAGACCGGGACGCAAATTACCATCACTTAACATCGTTGGAGACGAC
C2              CAGGCAGACCGGGACGCAAATTACCATCACTTAACGTCGTTGGAGACGAC
C3              CAGGCAGACCGGGACGCAAATTACCATCACTTAACGTCGTTGGAGACGAC
C4              CAGGCTGACCGGGACGCCAATTACCATCACTTAACGTCACTGGAGACGAC
                *****:***********.*****************.**. **********

C1              ATTTTCCGATCTGCATGTGAAATACGAGAAAAGCAAAGAGATGACCTCGC
C2              ATTTTCCGATCTGCATGTGAAATACGAGAAAAGCAAAGAGATGACCTCGC
C3              ATTTTCCGATCTGCATGTGAAATACGAGAAAAGCAAAGAGATGACCTCGC
C4              ATTTTCCGATCTGCATGTAAAATATGAAAAAAGCAAAGAGATGACCTCGC
                ******************.***** **.**********************

C1              AGCTTAAAAGTAACGAGGAATCGCTTCTGGCAGAGCGAAAGCAGATGATG
C2              AGCTCAAAAGCAACGAGGAATCGCTTCTGGCAGAGCGAAAGCAGATGATG
C3              AGCTCAAAAGCAACGAGGAATCGCTTCTGGCAGAGCGAAAGCAGATGATG
C4              AGCTTAAAAGCAACGAAGAATCGCTTCTGGCGGAGCGGAAGCAGATGATG
                **** ***** *****.**************.*****.************

C1              GACAATCTGCGGTTGCAGGAACAGCGCTACGACAAGATGAAGAACCATGC
C2              GACAATCTGCGGTTGCAGGAACAGCGCTACGACAAGATGAAGAACCATGC
C3              GACAATCTGCGGTTGCAGGAACAGCGCTACGACAAGATGAAGAACCATGC
C4              GACAATCTGCGGTTGCAGGAACAGCGCTACGACAAGATGAAAAACCATGC
                *****************************************.********

C1              CATGCAGCAGCTGGAAATTGCCAACAAAAAGCTGGACACCTACTCGAGGG
C2              CATGCAGCAGCTGGAAATTGCCAACAAAAAGCTTGACACCTACGCGAGGG
C3              CATGCAGCAGCTGGAAATTGCCAACAAAAAGCTGGACACCTACGCGAGGG
C4              CATGCAGCAGCTGGAAATTGCAAACAAAAAGCTGGACACCTACGCGAGGG
                *********************.*********** ********* ******

C1              AGCATGCCGACGAGACGAAAAAACTTAAAGCTTTACTTAAGAAGGAGGAG
C2              AGCATGCCGACGAGACGAAAAAACTTAAAGCTTTACTTAAGAAGGAGGAG
C3              AGCATGCTGACGAGACGAAAAAACTTAAAGCTTTACTTAAGAAGGAGGAG
C4              AGCATGCCGACGAAACGAAAAAACTTAAAGCTTTACTTAAGAAGGAGGAG
                ******* *****.************************************

C1              ATCTCGCGGGTCTCGATGACGGAGCAGCTGCAACAGAAGTCCCGCGAAAA
C2              ATCTCGCGGGTCTCGATGACTGAGCAGCTGCAACAGAAATCACGCGAAAA
C3              ATCTCGCGGGTCTCGATGACTGAGCAGCTGCAACAGAAGTCACGCGAAAA
C4              ATTTCTCGGGTTTCGATGACGGAGCAGCTGCAACAAAAATCACGCGAAAA
                ** ** ***** ******** **************.**.**.********

C1              CGCTGATCTGCTCAAGATCTGCGAAGAGCTCATCTATGGCAAGGGACAAG
C2              CGCTGATCTGCTCAAGATCTGCGAGGAGCTCATCTATGGCAAGGGACAAG
C3              CGCTGATCTGCTCAAGATCTGCGAGGAGCTCATCTATGGCAAGGGACAAG
C4              CGCCGATCTGCTCAAGATCTGCGAAGAGCTTATCTATGGCAAGGGACAAG
                *** ********************.***** *******************

C1              GTGGTAGTAGT------------------------------
C2              GTGGTAGTAGT------------------------------
C3              GTGGTAGTAGT------------------------------
C4              GTGGTAGTAGT------------------------------
                ***********                              



>C1
ATGGAATTCGACGACGCAGAAAATGGCCTAGGAATGGGATTTGGTGGTCG
CGGCGTTCTGCGGGAGATCAACAAAAACGATGGCGGCATTAAGCTGAGTC
CGTTGGCGGTGAAGCCCAGTCCCAAGCCAACGAGCATGGATCAACAGAAG
GCAATGGCGGCAGCTCTGGGGCATCAGACGGCGGTACCCGGTGGACTTAA
GCCAGAAGACGACCTCGTTCCAAAGTTTGGAGGTCTTCCCGAGTTCGATG
AGACGCAAATACCGGAACTAGCTCCTTTAAGTACCGATATGGATACTCAA
CTGAAATCCAACCATTCGGATTCGGATGTTTTTGTCGAGTGTTTATCGCT
TCATAGCGAGCGCTACACCGGAGATCGATCGGAGTTAGAGGCATATTCAA
GTGCCCTTAATGATGTTTTGGAGCAGCAGCTGTCCATGACCTCAGTTTCT
ACACTGGGAGCTGAATTCAACGATCCTTTGGCAGTTAGCCAGCACAACAA
CGTCAGCTATGAAGCCATGGATGTGGATGAC---CTAAACGAAACCATGG
AAATGTTAAAGGACGTCTTGAATGCGGAAGACCGTCATCTTATGCAAACG
CATATTCTCAGCGTAACCCAGTCAAAACCAGAGAATAATTTTGTGCACTA
TCATCCAAATCAGGAGCAAAATAGGGTTGAACTAGACCAGTTAGCCAAAC
ACTCTAAACCCAATAGTGATGCAAAGGAATCAGAATCATTGGTAGAATCA
GTACTGTCTGAGGAGTCTGGTACACAATCCTTTGAGCCGAAGCTCACCTT
ATCTGCCTTGGACTCTACGAAAGACTTAGCTAAGCATCAAGAGGAAATGC
AAACAAATACAAAAGATATATTTCAGAAAGAGAAGCACCACCCGGTCAGT
AGTGCTCAGGTGAAGGACGCACAAAATCCTAAGGAGCCTGAAAAGGCCTT
AAATCTCAAAGAGGCTTCTTCAGAACTGTCCACAAAATCAGCAAAATCTC
TAGAATACCCTAATCAAGAGAAGCAATTTTCGGTGGCAGTAGAATCAATG
GAGAGACCATGCACTGCCATCAGCCTTGAGCAAAATGCATCCCCAGCTAT
GGAGGCAACTGAAGACAGGACTGTGGAGGAGCTTGATCAAATGGATGTGG
ATGAATCCATGAAAGTGGATGATGCCACAGTGCTTAACTCATGTCGGCAG
GAGCAAATTAATGCTCATTCTCCCGTTTCAAGCAAATTTTTCTTAAAACT
CTGCGTTCAAAATGATACGGATTGTCAAGATAATAAAATGGATCAAAAAA
CTGCAGGAAAAGAAAGTGCATTAAAGATGACTGAAATAGAGCTGCCTGTA
GAATCTGTCCCATCAGCTTCGCTCTCACCGCCGACACCCGCACTTCAAGC
AAAAATTATCGAACTTTCCCTTTCCCCGCCCATACCTACACATCGCCCAA
AAACAGCGGAGGAACTAGAGTTCCTGGCTTTGAGGGAGCTGCCTTTGCCT
GATGGTGTCTCGACGGCGGGGAAGGTGGAATGTAAGCAGCTATCACACGG
CCTGGTACCCATTGTGGCAGTCTTACCAACGCCACTTTAC----------
--------TTGGATCTGAAAGGGAATACAACCACTGCAAGCCTTCCAGAA
CCGACTTCGCCCAGTTTCCCCATCAAAGAACCTGCTGAAAAACAGTCCCA
CTTTCCACGCTCACCGCGTGCTCAGCTCGAGCAAAAGGACATGCCCTATT
TGGAAGAGGCTGTGGTAGAACGTTCATCACATCGCAAGCAAAGCGATTTC
GGA------GTCATAGCGAAATCACCAATAGTCTTTGAGTTAACACAACC
GAGTCCTGAGAAGCAGCACCTCAACGAAACCTTGCCAATGAGCGAGATTT
CTCCCACTTCGTCAAATATGACCTTTGACAGCGGAAGCATTACGGAGGAC
AAATCACAGAAGGGTACAGAGAATATTGAGCCTTCTTCCACCCTTGCCGT
AAGTCTGGGATCGGTTGATGATAAGCAGCGGCGCACTTTCTCGGTGGTTC
AGCCCACGAAGGAAGAGGAGGAGGCCAAATCGCGTCGGACTTTCTGTATG
GAAAATGAGAACCCTCGACGCACCTTCTGCATGCAGCAGAATGCTTCTCC
AGCGGTGGAGGCTACCGAAGACACCGGGGCTGATGAAGTTATGGATGTGG
ATATCTCCATGAGGGCAGATGAAGTAGCCGTGATGAAGTCGCATCAGCAA
ACTTGGAAGGAACGCCAAGCACCAATTTCAAATTCACCACCAATTCCTAC
TCACCAACGTTTAAATAGACCTCCT------GAGGCGATTTCTCCAGTGT
CCCCATTGGGAAATGGCACCGTTGTGTTGGAGGAGCAAACTCTCTCTGCT
AAAGAGCAAGCCACGCTAAGTGCCAGCGATGAGAAGGACGATGTTTTCTT
GGAGCACTTTGGTGCAATTTCCCCAGTTTCGGATGACATGTTTAAAACCA
GCAGCGCTTCCAACAATCAAGCAAAGTTTAGGGTCAATGCTGATGAAGAA
ACCGGAGGCAAAGGCGCTTCTGCGATGATCAGGAAGAGAAGTGGTACAGC
TGGCGAGCAGGAAGAGATCTTTGATGCCGAATTCCATGATGGCGTCAACA
ACCAAAACCTAATACTAAATTCATCAGATTTTGATTATTTGTACACGAAA
GGCAGCAATAGTGTGCCTATTGACCGCAGTTCGCTGCTGTTGAAGTTTGA
TCCCCTCCTTGGAGCCCCTGTTCCCGTTAATCATCCGAATCAGCAGGAGC
AGGCGCTGCAGAATATTCTGGGATCGAACCAGCACCAGAACCGGCTCCTT
AGCCCAACATTGGAGGAGCACGAAACAAGTGACGGGAACCAGTCTTTTGG
AGTAATATCGAGTGCCAAAGATACAGCCAAGAAATGGGATTTTAAGCCAC
CTGTGGATAGAACAAAACATGTTAAAATGAGTGTGGACGTCATTGATAAC
GATTGCAATAAAACCTTCGATAATTCCAACACTAATACGGAGGATAAGAC
GCACAACTACAACGATATGGATGAGCTGGAGAAGAAAATCAAAAATGAAG
TAACGAGGTCCGAAGACATTGAAAAGAAGCTCAAGGAGGGAGAGCTGCGC
GAGGAGGCTCTGATCAAGCGTATTACAGAAAAGGACAAAACAAATGCAAA
ACTAAACGGTGTCATTGAGGCATATGAGAAGGCAATTGCAGAGCTCATTA
GTGAGAAGGAGCAGCAAGCACAGCTTCACGAACGGCAGTTGCAGGAAGTC
CAGGCAGACCGGGACGCAAATTACCATCACTTAACATCGTTGGAGACGAC
ATTTTCCGATCTGCATGTGAAATACGAGAAAAGCAAAGAGATGACCTCGC
AGCTTAAAAGTAACGAGGAATCGCTTCTGGCAGAGCGAAAGCAGATGATG
GACAATCTGCGGTTGCAGGAACAGCGCTACGACAAGATGAAGAACCATGC
CATGCAGCAGCTGGAAATTGCCAACAAAAAGCTGGACACCTACTCGAGGG
AGCATGCCGACGAGACGAAAAAACTTAAAGCTTTACTTAAGAAGGAGGAG
ATCTCGCGGGTCTCGATGACGGAGCAGCTGCAACAGAAGTCCCGCGAAAA
CGCTGATCTGCTCAAGATCTGCGAAGAGCTCATCTATGGCAAGGGACAAG
GTGGTAGTAGT------------------------------
>C2
ATGGAATTCGACGGCGCAGAAAATGGCCTGGGAATGGAATTTGGCGGTCG
CGGCATTCTGCGGGAGATCAACAAAAACGATGGCGGCATTAAGCTGAGTC
CGCTGGCGGTGAAGCCCAGTCCCAAGCCGACGAGCATGGATCAACAGAAG
GCAATGGCGGCAGCTCTGGGCCATCAGACGGCGGTACCCGGTGGCCGTAA
GCTAGACGACGACCTCGTTCCAAAGTTTGGAGGTCTTCCCGAGTTCGATG
AGACGCAAATACCGGAACTGGCTCCTTTAAGTACCGATATGGACACTCAA
CTGAAAACCAACCATTCGGATTCGGATGTTTTTGTCGAGTGTTTATCGCT
TCATAGCGAGCGCTATACCGGAGATCGATCGGAGTTAGAGGCCTATTCAA
GTGCCCTTAATGATGTTTTGGAGCAGCAGCTGTCCATGACCTCAGCTTCT
ACACTGGATGCTGCATTCAACGATCCTTTAGCGGTTAGCCAGCACAACAA
CGTCAGCTATGAAGACATGGATGTGGATGATGACCTAAACGAAACCATGG
AAATGTTAAAGGACTCCTTGGATGCGGAAGACCATCATCTTATGCAAACG
CATATTCTCAGCGTAACCCAGCCAAAACCAGAGAATAATTCTGTGCAC--
-CTTCCAAATCAGGAACAAAATAGGGTTGAACTAGACCAGTTAGCCAAAC
ACTCTAAACGCAATAGTAATGCAAAGGAGCCA---CCATTCGTAGAATCA
GTATTGTCTGAGGAGTCTGGTACACAACTTCTTGAGCCGGAGCTCACCTT
ATCTGCCTTGGACTCTACGAAAGACTTAGCTAAGCATCATGAGGAAAAGC
AAACGGATACAGAAGATGTATTTCAGAAAGAGGACCACCATCCGGTCAGT
AGTGCGCAGATGGAGGAGGCACAAAATCCTGAGGAACCTAAAATAGCCTT
AAATCTCAAAGAGGCTTCTTCAGAACTGTCCACAAAACTAGCAAATAATC
TAGAATGCCCTTATCAAGAGAAGCAA------------TTAGAATCAATG
GAGAGAACATGCACTGCCATCAGCCTTGAGCAAAGTGCATCCCCAGCTAT
GGAGGCAACTGAAGACAGAAATGTGGAGGAGCTTGATCACATGGACGTGG
ATGAATCCATGAGAGTGGATGATGCCCCAGTGCTTAACTCATGTCGGCAG
GAGCAAATGCATACTCTTTCTCCCGTTTCAAGCAAATCTTTTTCAAAACC
CTGCGTTGAAAATGATACGGATTTTCAAAATAATAAAATGGATCAAAAAA
CTGCAGGCAAAGAGAGTCCATTGAAGATGACTGAAATAGAGCTGCCTGTG
GAATCTGTCCCATCAGCACCACTCTCACCGCCGATACCCACACTTCAAGC
AAAAATGATGGAACTGCCCCGTTCTCCGCCCATACCTACACATCGCCCAA
AAACAGCGGAGGAACTAGAGTTCCTGGCTCTGAGGGAGCTGCCCTTGCCC
GATGATGACCCCACGGCGGAAAAGGTGGTATTTAAGCAGCTATCACACGG
CCGCGTACCCGTGGTGGCAGTCTCCCCAACGCCACTTTCC----------
--------TTGGATCTGAAAGGAAATACAACCACTGCAAGCCTTCCAGAA
CCCACTTCGCCCAGTTTCCCCATCAAAGAACCTGCTGAAAAACAGTCCCA
CTTTCCACGCTCACCCCGTGCTCAGCCCGAGCAAAAGGACATGCCCTATT
TGGAAGAGGCTGTTGTAGAACGTTCTTCAGATCGCAAGCAAAGCGATTTC
GGTGCCGGAGTCATAGCGAAATCACCAATAGTGTTTCAGTTAACACAACC
CAGTCCTGAGAAGCAGCACCTCAACGAAACCTTGCCCATGAGCGAAATTT
CTCCCACTCCGTCAAATATGACCTTTGACAGCGGAAGCATTACGGAGGAC
AAATCTCAGAAGGGTACAGAGAATATTGAGCCTTCATCCAACTTCGCCGT
AAGTCTGGGATCGGTCGATGATAAACAGCGCCGCACTTTCTCGGTGGTTC
AGGCCACGAAGGAAGAGGAGGAGGCCAAATCGCGTCGGACTTTCTGTATG
GAAAAGGAGAACACTCGCCGCACCTTCTGCATGCAGCAGAATGCCTCTCC
AGCGGTGGAGGCCACCGAAGATACCGGGGCTGATGAAGTCATGGATGTAG
ATATCTCCATGAGGGCAGATGAAGTAGCCGTGATGAATTCGCCTCAGCAA
ACTTGGAAGGAACGCCAAGCACCAATTTCAAATTCACCACCTATTCCTAC
CCATCAACATTTAAAAAGACCCCCTATCCATGAGGCGAATTCTCCAGTGT
CACCATTGGGAAATGGCACCGTTGTGTTGGAGGAGCAGGCTCTCTCTGCT
AAAGAGCAAGCCACGCTGAGCGCCAGCGATGAGAAGGACGATGTTTTCTT
GGAGCACTTTGGTGCCATTTCTCCAGTTTCGGATGACATGTTTAAAACCA
GCAGCGGCTCGAACAATCAAGCAAAGTTTAGGGTCAATGCTGATGAAGAA
ACCGGAGTCAAAGGCGCTTCTGCTATGATCAGAAAGAGAAGTGGTACAGC
TGGCGAGCAGGAAGCGATCTTCGATGCCGAATTCCATGATGGCGCCAACA
ACCAAAACCTGATACTGAATTCATCAGATTTTGATTATTTGTACACGAAA
GGCAGCAATAGTGCGCCTATCGACCGCAGTTCGCTGCTGTTGAAGTTTGA
TCCCCTCCTTGGAGCCCCTGTTCCCGTTAATCATCCGAATCAGCAGGAGA
AGGCGCTGCAGAATATTCTGGGATCGAACCAGCACCAGAACCGGCTTCTT
AGCCCAACATTGGAGGAGCACGAAACAAGTGACGGGAACCAGTCTTTTGG
ATTAATATCGAGTGCCAAAGATACAGCCAAGAAATGGGATTTTAAGCCAC
CTGTGGATAGAACAAAACATGTTAAAATGAGTGTAGACGTCATTGATAAC
GATTGCAACAAAACCTTCGATAATTCCAACACTAATACGGAGGATAAGAC
GCACAACTACAACGATATGGATGAGCTGGAGAAGAAAATCAAAAATGAAG
TAACGCGGTCCGAAGACATTGAAAAGAAGCTCAAAGAGGGAGAGTTGCGC
GAGGAGGCTCTGATCAAGCGTATTACAGAAAAGGACAAAACAAATGCAAA
ACTAAACGGTGTCATCGAGGCGTATGAGAAAGCAATTGCAGAGCTTATCA
GTGAGAAGGAGCAGCAGGCACAGCTTCACGAACGGCAGTTGCAGGAAGTC
CAGGCAGACCGGGACGCAAATTACCATCACTTAACGTCGTTGGAGACGAC
ATTTTCCGATCTGCATGTGAAATACGAGAAAAGCAAAGAGATGACCTCGC
AGCTCAAAAGCAACGAGGAATCGCTTCTGGCAGAGCGAAAGCAGATGATG
GACAATCTGCGGTTGCAGGAACAGCGCTACGACAAGATGAAGAACCATGC
CATGCAGCAGCTGGAAATTGCCAACAAAAAGCTTGACACCTACGCGAGGG
AGCATGCCGACGAGACGAAAAAACTTAAAGCTTTACTTAAGAAGGAGGAG
ATCTCGCGGGTCTCGATGACTGAGCAGCTGCAACAGAAATCACGCGAAAA
CGCTGATCTGCTCAAGATCTGCGAGGAGCTCATCTATGGCAAGGGACAAG
GTGGTAGTAGT------------------------------
>C3
ATGGAATTCGACGGCGCAGAAAATGGCCTGGGAATGGAATTTGGCGGTCG
CGGCATTCTGCGGGAGATCAACAAAAACGATGGCGGCATTAAGCTGAGTC
CGCTGGCGGTGAAGCCCAGTCCCAAGCCGACGAGCATGGATCAACAGAAG
GCAATGGCGGCAGCGCTGGGCCATCAGACGGCGGTACCCGGTGGCCGTAA
GCTGGACGACGACCTCGTTCCAAAGTTTGGAGGTCTTCCCGAGTTCGATG
AGACTCAAATACCGGAACTGGCTCCTTTAACTACCGATATGGACACTCAA
CTGAAAACCAACCATTCGGATTCTGATGTTTTTGTCGAGTGTTTATCGCT
TCATAGCGAGCGCTATACCGGAGATCGATCGGAGTTAGAGGCCTATTCAA
GTGCCCTCAATGATGTTTTGGAGCAGCAGCTGTCCATGACCTCAGCTTCT
ACACTGGAAGCTGCATTCAACGATCCTTTGGCGGTTAGCCAGCACAACAA
CGTCAGCTATGAAGACATGGATGTGGATGATGACCTAAACGAAACCATGG
AAATGTTAAAGGACTCCTTGGATGCGGAAGACCATCATTTTATGCAAACG
CATATTCTCAGCGTAACCCAGCCAAAACCAGAGAATAATTCTGTGCAC--
-CTTCCAAATCAGGAACAAAATGGGGTTGAACTAGACCAGTTAGCCAAAC
ACTCTAAACGCAATAGTAATGCAAAGGAGCCA---CCATTCGTAGAATCA
GTATTGTCTGAGGAGTCTGGTACACAACTTCTTGAGCCGGAGCTCACTTT
ATCTGCCTTGGACTCTACGAAAGACTTAGCTAAGCATCATGAGGAAGAGC
AAACGGATACAGAAGATGTATTTCAGAAAGAGGACCACCATCCCGTCAGT
AGTGCGCAGATGAAGGAGGCACAAAATCCTGAGGAAGCTAAAATGGCCTT
AAATCTCAAAGAGGCTTCTTCAGAACTGTCCACAAAACTAGCAAATAATC
TAGAATGCCCTAATCAAGAGAAGCAATTTTCGGTGGCAGTAGAATCAATG
GAGAGAACATGTACTGCCATCAGCCTTGAGCAAAGTGCATCCCCAGCTAT
GGAGGCAACTGAAGACAGGACTGTGGAGGAGCTTGATCACATGGACGTGG
ATGAATCCATGAGAGTGGATGATGCCCCAGTGCTTAACTCATGTCGGCAG
GAGCAAATGCATGCTCTTTCTCCCGTTTCAAGCAAATCTTTTTCAAAACC
CTGCGTTGAAAATGATACGGATTTTCAAAATAATAAAATGGATCAAAAAA
CTGCAGGCAAAGAGAGTCCATTGAAGATGACTGAAATAGAGCTGCCTGTG
GAATCTGTCCCTTCAGCACCACTCTCACCGCCGATACCCACACTTCAAGC
AAAAATGATGGAACTGCCCCTTTCTCCGCCCATACCTACACATCGCCCAA
AAACAGCGGAGGAACTAGAGTTCCTGGCTCTGAGGGAGCTGCCCTTGCCC
GATGATGACCCCACGGCGGAAAAGGTGGTATTTAAGCAGCTATCACACGG
CCGCGTACCCGTGGTGGCAGTCTCACCAACGCCACTTTCC----------
--------TTGGATCTGAAAGGAAATACAAACACTGCAAGACTTCCAGAA
CCCACTTCGCCCAGTTTCCCCATCAAAGAACCTGCTGAAAAACAGTCCCA
CTTTCCACGCTCACCCCGTGCTCAGCCCGAGCAAAAGGACATGCCCTATT
TGGAAGAGGCTGTTGTAGAACGTTCTTCAGATCGCAAGCAAAGCGATTTC
GGTGCCGGAGTCATAGCGAAATCACCAATAGTCTTTCAGTTAACACAACC
GAGTCCTGAGAAGCAGCACCTCAACGAAACCTTGCCCATGAGCGAAATTT
CTCCCACTCCGTCAAATATGACCTTTGACAGCGGAAGCATTACGGAGGAC
AAATCTCAGAAGGGTACAGAGAATATTGAGCCTTCATCCACCTTCGCCGT
AAGTCTGGGATCGGTCGATAATAAGCAGCGCCGCACTTTCTCGTTGGTTC
AGCCCACGAAGGAAGAGGAGGAGGCCAAATCGCGTCGGACTTTCTGTATG
GAAAAGGAGAACACTCGCCGCACCTTCTGCATGCAGCAGAATGCCTCTCC
AGCGGTGGAGGCCACCGAAGATACCGGGGCTGATGAAGTCATGGATGTAG
ATATCTCCATGAGGGCAGATGAAGTAGCCGTGATGAAGTCGCCCCAGCAA
ACTTGGAAGGAACGCCAAGCACCAATTTCAAATTCACCACCTATTCCTAC
CCATCAACATTTAAAAAGACCCCCTATTCATGAGGCGAATTCTCCAGTGT
CACCATTGGGAAATGGCACCGTTGTGTTGGAGGAGCAGGCTCTCTCTGCT
AAAGAGCAAGCCACGCTGAGCGCCAGCGATGAGAAGGACGATGTTTTCTT
GGAGCACTTTGGTGCCATTTCTCCAGTTTCGGATGACATGTTCAAAACCA
GCAGCGGCTCGAACAATCAAGCAAAGTTTAGGGTCAATGCTGATGAAGAA
ACCGGAGTCAAAGGCGCTTCTGCGATGATCAGGAAGAGAAGTGGTACAGC
TGGCGAGCAGGAAGCGATCTTCGATGCCGAATTCCATGATGGCGCCAACA
ACCAAAACCTGATACTGAATTCATCAGATTTTGATTATTTGTACACGAAA
GGCAGCAATAGTGCGCCTATCGACCGCAGTTCGCTGCTGTTGAAGTTTGA
TCCCCTCCTTGGAGCCCCTGTTCCCGTTAATCATCCGAATCAGCAGGAGC
AGGCGCTGCAGAATATTCTGGGATCGAACCAGCACCAGAACCGGCTCCTT
AGCCCAACATTGGAGGAGCACGAAACAAGTGACGGGAACCAGTCTTTTGG
ATTAATATCGAGTGCCAAAGATACAGCCAAGAAATGGGATTTTAAGCCAC
CTGTGGATAGAACAAAACATGTTAAAATGAGTGTAGACGTCATTGATAAC
GATTGCAACAAAACCTTCGATAATTCCAACACTAATACGGAGGATAAGAC
GCACAACTACAACGATATGGATGAGCTGGAGAAGAAAATCAAAAATGAAG
TAACGCGGTCCGAAGACATTGAAAAGAAGCTCAAAGAGGGAGAGCTGCGC
GAGGAGGCTCTGATCAAGCGTATTACAGAAAAGGACAAAACAAATGCAAA
ACTAAACGGTGTCATCGAGGCGTATGAGAAAGCAATTGCAGAGCTTATCA
GTGAGAAGGAGCAGCAGGCACAGCTTCACGAACGGCAGTTGCAGGAAGTC
CAGGCAGACCGGGACGCAAATTACCATCACTTAACGTCGTTGGAGACGAC
ATTTTCCGATCTGCATGTGAAATACGAGAAAAGCAAAGAGATGACCTCGC
AGCTCAAAAGCAACGAGGAATCGCTTCTGGCAGAGCGAAAGCAGATGATG
GACAATCTGCGGTTGCAGGAACAGCGCTACGACAAGATGAAGAACCATGC
CATGCAGCAGCTGGAAATTGCCAACAAAAAGCTGGACACCTACGCGAGGG
AGCATGCTGACGAGACGAAAAAACTTAAAGCTTTACTTAAGAAGGAGGAG
ATCTCGCGGGTCTCGATGACTGAGCAGCTGCAACAGAAGTCACGCGAAAA
CGCTGATCTGCTCAAGATCTGCGAGGAGCTCATCTATGGCAAGGGACAAG
GTGGTAGTAGT------------------------------
>C4
ATGGAATTCGACGGCGCAGAGAACGGCCTGGGAATGGAATTTGGCGGTCG
CGGCGTTCTGCGGGAGATCAACAAAAACGATGGCGGCATTAAGCTGAGTC
CACTGGCGGTGAAGCCCAGTCCCAAGCCGACGAGCATGGAGCAACAGAAG
GCAATGGCTGCAGCTCTGGGACATCAGGCGGCAGTAGCCGGTAGCCTTCA
GCTAGACGCAGTTAAGGTTCCAAAATTTGGAGGTCTTCCCGAGTTCGATG
AAATGCAAATACCGGAACTGGCTCCTTTAAGTACCGATATAGACACTCAA
TTGAAATGCAACCATTCGGATTCTGATGTTTTTGTCGAGTGTTTATCGCT
TCATAGCGAGCGCTATACAGGAGATCGATCGGAGCTAGAGGCCTATTCAA
GTGCCCTTAATGATGTTTTGGAGCAGCAGCTGTCTATGACCTCAGCTTCT
ACACTGGAAGCTGATTTTAAAGATCCTTTGGCGGTTAGCCAGCACAACAA
CGTCAGCTATGAAGCCATGGATGTGGATGAC---ATAAACGAAACTATGG
AAATGTTAAAGGACGTTTTGGACCCGGAAGACCATCAGCTTATGCAAACG
CATATTCTCAGCGTATCGCAGCCTAAAACGGAGACTATTTCGGTGCAGTA
TAATCAAAATCAGGAGCAAAAGAGAATAGAACAAGACCAGTTAGCTAAAT
ACCCGGAATCGAATAGTGATGCAACGAAGCCA---TCATTATTAGAATCA
GTATTCCCTGATCAGCCTGTTACACCATTACTTGAACCGAATCTTAACTT
AACTGCCTTAGACTACACGAAAGAGCTAGCTAAGCATCGTGATGAAAACC
AAAAGGATACAAAAGATGAACCTCAGAAAGAGGACCACCAACCGATTTGT
AGTGCGCAGATGGAGAACGCAAATTCT---GAGGAGCCC---------TT
AAATCTCAATGAGGCTACA---GAACCCTCCACATATCCAGCAAAAACTC
CAAAATGTCTTAATCAAGATATGCCATTTGCAGTGGCAGTAGAATCAATG
GAAAAAACATTCACTCCCATCAGCCATGAGCAAAATGCGTCCCCAGCTAT
GGAGGCAACTGAAGACAGGACTGTGACGGAGCTTGAGCACATGGAAGTGG
ATGACTTTATGAGAGTGAGTGAGGCTATAGTGCTTACCTCATCTCGGCAG
GAGCAGGTTAATGCTCATTCACCCGTTTCAAGAAAATCTTGTTTAAACCT
CTGCGGGAAAAATGATATGGACTTTCAAGATAATAAAATGGATCATAAAA
CTGCAGGCCTGGAAAGTCAATTGAAGATGACTGAAATAGAGCTA------
---------CCAGCAGCACAGATATCGACGCCCATACCGACACTTCAAAC
CAGAAGCAAGGAACTGCCCTTTTCTCCGCCCATACCTACACATCGCCCAA
AGGCAGCGGAAGAACTAGAGTTCCGGACTCTGAGGGAGTTGCCCTTGCCT
GATGATGTTCCGTCGGGAGGGAAGGTGGGAGTAAAGCAGATTTCACACGG
CCGCGCGCCCTTTGTGGCAGTCACACCAACGCAGCTGCGATCCACGACAC
ATAATTCTTTGGATCTAGATGGAAAAACAACCTCTGCAATCTCTCCAGAA
CCCACTTCGCCTAGTTTCCCTATCAGAGGACCCGCTGAAACACAATCCCA
TTTTCCACGCTCACCCCGTGCTCCGCTCGAGCAAAAAGACATGCCCTATT
TGGAAGAAGCTGTGGTAGAACCTTCTTCAGATCGCAACCAAAGCGTCTTC
GGAGCTGGTGTCATCGAAAAGTCCGCAATTGTCTTTCAGTTGACACAACC
GAGTCCACAGAAGCAGAACCTCAACGAAACCTTACCCATGAGTGAGATGT
CTCCCACTTCCTCAAATATGGCATTTGACAGCGAAAACATTTCGGAGAAC
AAGCCACAAAACGATACAGAC------------------ACATTCGCCGT
AAGTGTGGGATCGGTCGATAATAAACAGCGCCGTACTTTCTCGGTGATTC
AGTCTCCGACGGAAGAGGAGGAGTCCAAATCGCGTAGGATTTTCTGCATG
GAAAAGGAGAACCCACGCCACACCTTCTGCATTCAGCATAAGGCTTCTCC
AGCAGTGGGGGCCACCGAAGATACCGGGGCTGATGACGTTATGGATGTAG
ATGTCTCCATGAGGGCATATGATGTAGCCGTATTGAAGTCGCCTCAGCAA
ACTTGGAAGGAACCTCAAGCACCAATTTCAAATTCACCGCCTATTCCTTC
CCACCAACATTTAAAGAGACCCCCTATCCATGAGACGAATTCCCCGGTGT
CACCCTTGCGTAATGGTACCGTTGCGTTGGAGGAGCAGGCTCTTTCCGCC
AAAGAGCAAGCCACGCTAAGCGCCAGTGATGAGAAGGACGATGTTTTCTT
AGAACACTTTGGCGCCATTTCGCCAGTTTCGGATGACATGTTCAAGACCA
TAAGTGGTTCCAACAATCAAGAAAAGATTAGGGTCAATGCTAATAGGGAA
ATCGAAGGAAAACCCGCTCCTGCGTTGAGCAAACAGAGGGGTGGTGCACC
TGGCGAGCTGGAGGCGATCATTGATGCCGAATTCCACGACGGCGCCAGCA
ACCAAAACCTAATACTGAAATCATCAGATTTTGATTATTTGTACACGAAA
GGCAGCAATAATGCGCCTATCGACCGCAGTTCGCTGCTGCTGAAGTTTGA
TCCCCTCCTTGGAGCCCCTGTTCCCGTTAATCATCCGAATCAGCAGGAGC
AGGCGCTGCAGAATATTCTTGGTTCGAACCAGTATCAAAACCGTGTTCTG
AGCCCAACATTGGAGGAGCACGAAACAAGTGACGGGAACCAGTCTTTTGG
ATTAATATCGAGTTGCAAAGATATATCAGTGAAATGGGATTGTAAGCCAC
CTGTGGATACGTCAAAACATGTTAAAATGAGTGTAGACGTCATTGATAAC
GATTGCAACAAAACCTTCGATAATTTCAACGCTAATACGGAGGACAAAAC
GCACAACTACAACAACATGGATGAACTGGAGAAGAAAATCAAAAATGAAG
TAACGAGGTCCGAAGACATTGAAAAGAAGCTCAAAGAGGGAGAGCAGCGC
GAGGAAGCACTGATCAAGCGTATTACAGAAAAGGACAAAACAAATGCAAA
ACTAAACGGTGTCATCGAGGCATATGAGAAGGCAATTGCGGAGCTCATTA
GTGAGAAGGAGCAGCAGGCGCAGCTCCACGAGCGGCAGTTGCAAGAAGTC
CAGGCTGACCGGGACGCCAATTACCATCACTTAACGTCACTGGAGACGAC
ATTTTCCGATCTGCATGTAAAATATGAAAAAAGCAAAGAGATGACCTCGC
AGCTTAAAAGCAACGAAGAATCGCTTCTGGCGGAGCGGAAGCAGATGATG
GACAATCTGCGGTTGCAGGAACAGCGCTACGACAAGATGAAAAACCATGC
CATGCAGCAGCTGGAAATTGCAAACAAAAAGCTGGACACCTACGCGAGGG
AGCATGCCGACGAAACGAAAAAACTTAAAGCTTTACTTAAGAAGGAGGAG
ATTTCTCGGGTTTCGATGACGGAGCAGCTGCAACAAAAATCACGCGAAAA
CGCCGATCTGCTCAAGATCTGCGAAGAGCTTATCTATGGCAAGGGACAAG
GTGGTAGTAGT------------------------------
>C1
MEFDDAENGLGMGFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGLKPEDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
LKSNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSVS
TLGAEFNDPLAVSQHNNVSYEAMDVDDoLNETMEMLKDVLNAEDRHLMQT
HILSVTQSKPENNFVHYHPNQEQNRVELDQLAKHSKPNSDAKESESLVES
VLSEESGTQSFEPKLTLSALDSTKDLAKHQEEMQTNTKDIFQKEKHHPVS
SAQVKDAQNPKEPEKALNLKEASSELSTKSAKSLEYPNQEKQFSVAVESM
ERPCTAISLEQNASPAMEATEDRTVEELDQMDVDESMKVDDATVLNSCRQ
EQINAHSPVSSKFFLKLCVQNDTDCQDNKMDQKTAGKESALKMTEIELPV
ESVPSASLSPPTPALQAKIIELSLSPPIPTHRPKTAEELEFLALRELPLP
DGVSTAGKVECKQLSHGLVPIVAVLPTPLYooooooLDLKGNTTTASLPE
PTSPSFPIKEPAEKQSHFPRSPRAQLEQKDMPYLEEAVVERSSHRKQSDF
GooVIAKSPIVFELTQPSPEKQHLNETLPMSEISPTSSNMTFDSGSITED
KSQKGTENIEPSSTLAVSLGSVDDKQRRTFSVVQPTKEEEEAKSRRTFCM
ENENPRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSHQQ
TWKERQAPISNSPPIPTHQRLNRPPooEAISPVSPLGNGTVVLEEQTLSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSASNNQAKFRVNADEE
TGGKGASAMIRKRSGTAGEQEEIFDAEFHDGVNNQNLILNSSDFDYLYTK
GSNSVPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGVISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYSREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS
>C2
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLSTDMDTQ
LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLDAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHLMQT
HILSVTQPKPENNSVHoLPNQEQNRVELDQLAKHSKRNSNAKEPoPFVES
VLSEESGTQLLEPELTLSALDSTKDLAKHHEEKQTDTEDVFQKEDHHPVS
SAQMEEAQNPEEPKIALNLKEASSELSTKLANNLECPYQEKQooooLESM
ERTCTAISLEQSASPAMEATEDRNVEELDHMDVDESMRVDDAPVLNSCRQ
EQMHTLSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPV
ESVPSAPLSPPIPTLQAKMMELPRSPPIPTHRPKTAEELEFLALRELPLP
DDDPTAEKVVFKQLSHGRVPVVAVSPTPLSooooooLDLKGNTTTASLPE
PTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDF
GAGVIAKSPIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITED
KSQKGTENIEPSSNFAVSLGSVDDKQRRTFSVVQATKEEEEAKSRRTFCM
EKENTRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMNSPQQ
TWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEE
TGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTK
GSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEKALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS
>C3
MEFDGAENGLGMEFGGRGILREINKNDGGIKLSPLAVKPSPKPTSMDQQK
AMAAALGHQTAVPGGRKLDDDLVPKFGGLPEFDETQIPELAPLTTDMDTQ
LKTNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLEAAFNDPLAVSQHNNVSYEDMDVDDDLNETMEMLKDSLDAEDHHFMQT
HILSVTQPKPENNSVHoLPNQEQNGVELDQLAKHSKRNSNAKEPoPFVES
VLSEESGTQLLEPELTLSALDSTKDLAKHHEEEQTDTEDVFQKEDHHPVS
SAQMKEAQNPEEAKMALNLKEASSELSTKLANNLECPNQEKQFSVAVESM
ERTCTAISLEQSASPAMEATEDRTVEELDHMDVDESMRVDDAPVLNSCRQ
EQMHALSPVSSKSFSKPCVENDTDFQNNKMDQKTAGKESPLKMTEIELPV
ESVPSAPLSPPIPTLQAKMMELPLSPPIPTHRPKTAEELEFLALRELPLP
DDDPTAEKVVFKQLSHGRVPVVAVSPTPLSooooooLDLKGNTNTARLPE
PTSPSFPIKEPAEKQSHFPRSPRAQPEQKDMPYLEEAVVERSSDRKQSDF
GAGVIAKSPIVFQLTQPSPEKQHLNETLPMSEISPTPSNMTFDSGSITED
KSQKGTENIEPSSTFAVSLGSVDNKQRRTFSLVQPTKEEEEAKSRRTFCM
EKENTRRTFCMQQNASPAVEATEDTGADEVMDVDISMRADEVAVMKSPQQ
TWKERQAPISNSPPIPTHQHLKRPPIHEANSPVSPLGNGTVVLEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTSSGSNNQAKFRVNADEE
TGVKGASAMIRKRSGTAGEQEAIFDAEFHDGANNQNLILNSSDFDYLYTK
GSNSAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQHQNRLL
SPTLEEHETSDGNQSFGLISSAKDTAKKWDFKPPVDRTKHVKMSVDVIDN
DCNKTFDNSNTNTEDKTHNYNDMDELEKKIKNEVTRSEDIEKKLKEGELR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS
>C4
MEFDGAENGLGMEFGGRGVLREINKNDGGIKLSPLAVKPSPKPTSMEQQK
AMAAALGHQAAVAGSLQLDAVKVPKFGGLPEFDEMQIPELAPLSTDIDTQ
LKCNHSDSDVFVECLSLHSERYTGDRSELEAYSSALNDVLEQQLSMTSAS
TLEADFKDPLAVSQHNNVSYEAMDVDDoINETMEMLKDVLDPEDHQLMQT
HILSVSQPKTETISVQYNQNQEQKRIEQDQLAKYPESNSDATKPoSLLES
VFPDQPVTPLLEPNLNLTALDYTKELAKHRDENQKDTKDEPQKEDHQPIC
SAQMENANSoEEPoooLNLNEAToEPSTYPAKTPKCLNQDMPFAVAVESM
EKTFTPISHEQNASPAMEATEDRTVTELEHMEVDDFMRVSEAIVLTSSRQ
EQVNAHSPVSRKSCLNLCGKNDMDFQDNKMDHKTAGLESQLKMTEIELoo
oooPAAQISTPIPTLQTRSKELPFSPPIPTHRPKAAEELEFRTLRELPLP
DDVPSGGKVGVKQISHGRAPFVAVTPTQLRSTTHNSLDLDGKTTSAISPE
PTSPSFPIRGPAETQSHFPRSPRAPLEQKDMPYLEEAVVEPSSDRNQSVF
GAGVIEKSAIVFQLTQPSPQKQNLNETLPMSEMSPTSSNMAFDSENISEN
KPQNDTDooooooTFAVSVGSVDNKQRRTFSVIQSPTEEEESKSRRIFCM
EKENPRHTFCIQHKASPAVGATEDTGADDVMDVDVSMRAYDVAVLKSPQQ
TWKEPQAPISNSPPIPSHQHLKRPPIHETNSPVSPLRNGTVALEEQALSA
KEQATLSASDEKDDVFLEHFGAISPVSDDMFKTISGSNNQEKIRVNANRE
IEGKPAPALSKQRGGAPGELEAIIDAEFHDGASNQNLILKSSDFDYLYTK
GSNNAPIDRSSLLLKFDPLLGAPVPVNHPNQQEQALQNILGSNQYQNRVL
SPTLEEHETSDGNQSFGLISSCKDISVKWDCKPPVDTSKHVKMSVDVIDN
DCNKTFDNFNANTEDKTHNYNNMDELEKKIKNEVTRSEDIEKKLKEGEQR
EEALIKRITEKDKTNAKLNGVIEAYEKAIAELISEKEQQAQLHERQLQEV
QADRDANYHHLTSLETTFSDLHVKYEKSKEMTSQLKSNEESLLAERKQMM
DNLRLQEQRYDKMKNHAMQQLEIANKKLDTYAREHADETKKLKALLKKEE
ISRVSMTEQLQQKSRENADLLKICEELIYGKGQGGSS


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/412/tacc-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 4 taxa and 3741 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481160995
      Setting output file names to "/opt/ADOPS/412/tacc-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1088930077
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 1187425537
      Seed = 1820158988
      Swapseed = 1481160995
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.35 %   Dirichlet(Revmat{all})
            1.35 %   Slider(Revmat{all})
            1.35 %   Dirichlet(Pi{all})
            1.35 %   Slider(Pi{all})
            2.70 %   Multiplier(Alpha{1,2})
            2.70 %   Multiplier(Alpha{3})
            2.70 %   Slider(Pinvar{all})
           13.51 %   NNI(Tau{all},V{all})
           13.51 %   ParsSPR(Tau{all},V{all})
           40.54 %   Multiplier(V{all})
           13.51 %   Nodeslider(V{all})
            5.41 %   TLMultiplier(V{all})

      Division 1 has 65 unique site patterns
      Division 2 has 58 unique site patterns
      Division 3 has 83 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -9114.505706 -- -26.620141
         Chain 2 -- -9114.505706 -- -26.620141
         Chain 3 -- -9105.577427 -- -26.620141
         Chain 4 -- -8944.566293 -- -26.620141

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -9105.577427 -- -26.620141
         Chain 2 -- -9114.505706 -- -26.620141
         Chain 3 -- -9105.577427 -- -26.620141
         Chain 4 -- -8944.566293 -- -26.620141


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-9114.506] (-9114.506) (-9105.577) (-8944.566) * [-9105.577] (-9114.506) (-9105.577) (-8944.566) 
        500 -- (-8104.651) [-8083.698] (-8083.255) (-8085.849) * (-8079.547) [-8074.256] (-8101.044) (-8107.946) -- 0:00:00
       1000 -- (-8079.387) [-8058.556] (-8076.342) (-8066.419) * (-8054.050) [-8057.469] (-8080.301) (-8067.094) -- 0:16:39
       1500 -- (-8061.652) [-8046.289] (-8070.614) (-8055.150) * (-8053.097) [-8044.395] (-8061.958) (-8046.862) -- 0:11:05
       2000 -- (-8066.412) (-8047.051) (-8062.237) [-8042.739] * (-8044.861) (-8050.120) [-8052.344] (-8048.549) -- 0:08:19
       2500 -- (-8049.954) [-8043.840] (-8048.906) (-8044.877) * (-8048.688) (-8041.279) [-8044.290] (-8042.843) -- 0:06:39
       3000 -- [-8053.862] (-8046.852) (-8044.972) (-8044.335) * (-8045.376) (-8047.798) [-8039.063] (-8042.031) -- 0:05:32
       3500 -- (-8044.755) (-8042.669) (-8047.427) [-8043.559] * [-8046.929] (-8039.310) (-8040.679) (-8037.947) -- 0:04:44
       4000 -- (-8042.113) (-8043.117) (-8044.825) [-8050.456] * (-8046.072) (-8053.245) (-8048.217) [-8035.463] -- 0:04:09
       4500 -- [-8044.914] (-8041.275) (-8043.931) (-8042.066) * [-8044.342] (-8040.440) (-8042.128) (-8044.082) -- 0:07:22
       5000 -- (-8042.142) [-8040.144] (-8038.051) (-8039.321) * [-8039.875] (-8043.732) (-8045.297) (-8046.126) -- 0:06:38

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-8045.053] (-8038.719) (-8041.753) (-8035.012) * [-8036.720] (-8041.843) (-8045.255) (-8044.003) -- 0:06:01
       6000 -- (-8041.408) [-8035.941] (-8038.976) (-8041.374) * (-8036.556) [-8040.791] (-8043.892) (-8044.850) -- 0:05:31
       6500 -- (-8040.877) [-8039.353] (-8041.109) (-8041.100) * (-8041.824) (-8044.961) [-8042.224] (-8041.675) -- 0:05:05
       7000 -- (-8039.479) [-8040.269] (-8038.514) (-8044.066) * (-8040.990) [-8039.603] (-8049.152) (-8046.150) -- 0:04:43
       7500 -- (-8043.918) (-8041.618) (-8043.345) [-8038.218] * (-8035.563) (-8037.629) [-8040.709] (-8051.716) -- 0:04:24
       8000 -- (-8044.344) (-8039.790) (-8043.699) [-8040.439] * (-8038.008) [-8040.199] (-8039.143) (-8051.770) -- 0:06:12
       8500 -- (-8044.682) (-8041.976) (-8039.088) [-8043.726] * (-8043.143) [-8035.782] (-8039.548) (-8048.004) -- 0:05:49
       9000 -- (-8039.549) (-8043.477) (-8041.787) [-8041.652] * (-8046.741) [-8038.557] (-8041.474) (-8040.474) -- 0:05:30
       9500 -- [-8037.788] (-8041.858) (-8040.912) (-8044.944) * (-8045.918) (-8042.508) [-8040.958] (-8041.113) -- 0:05:12
      10000 -- [-8044.197] (-8045.629) (-8042.859) (-8044.755) * (-8048.434) [-8034.808] (-8046.141) (-8048.231) -- 0:04:57

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-8041.448] (-8041.145) (-8040.385) (-8041.175) * [-8037.828] (-8040.789) (-8042.533) (-8040.522) -- 0:04:42
      11000 -- (-8054.351) (-8039.689) [-8042.976] (-8045.132) * (-8043.590) (-8040.594) [-8037.562] (-8041.133) -- 0:04:29
      11500 -- (-8043.541) (-8037.030) (-8044.362) [-8043.904] * (-8042.845) (-8039.317) [-8040.112] (-8043.972) -- 0:05:43
      12000 -- (-8045.456) [-8040.697] (-8047.951) (-8042.258) * (-8045.385) [-8035.211] (-8040.193) (-8049.688) -- 0:05:29
      12500 -- (-8041.733) (-8042.869) [-8042.458] (-8045.152) * (-8047.311) (-8041.934) [-8037.784] (-8041.028) -- 0:05:16
      13000 -- (-8037.548) (-8040.773) [-8041.142] (-8044.951) * (-8043.056) (-8041.565) (-8035.970) [-8041.560] -- 0:05:03
      13500 -- (-8045.037) (-8039.040) [-8036.222] (-8044.854) * [-8041.593] (-8052.831) (-8042.699) (-8044.078) -- 0:04:52
      14000 -- (-8043.256) (-8049.332) [-8037.319] (-8040.122) * [-8037.065] (-8040.031) (-8044.367) (-8048.424) -- 0:04:41
      14500 -- (-8046.199) (-8046.542) (-8036.096) [-8036.002] * (-8037.917) (-8037.804) [-8040.198] (-8047.772) -- 0:04:31
      15000 -- (-8043.110) (-8036.537) (-8047.574) [-8046.145] * (-8040.035) (-8043.081) (-8036.512) [-8044.341] -- 0:05:28

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-8045.645) [-8039.500] (-8040.983) (-8043.725) * (-8041.517) [-8041.878] (-8036.157) (-8045.653) -- 0:05:17
      16000 -- [-8038.828] (-8040.353) (-8040.306) (-8040.838) * (-8037.251) (-8040.850) (-8042.040) [-8041.375] -- 0:05:07
      16500 -- (-8041.899) (-8043.345) [-8039.569] (-8046.812) * (-8037.626) [-8038.916] (-8046.289) (-8043.012) -- 0:04:58
      17000 -- (-8043.983) [-8042.903] (-8044.246) (-8041.141) * [-8038.759] (-8041.543) (-8042.472) (-8044.076) -- 0:04:49
      17500 -- (-8040.413) [-8037.997] (-8038.473) (-8047.875) * (-8038.754) [-8043.778] (-8044.626) (-8037.261) -- 0:04:40
      18000 -- (-8041.571) [-8035.572] (-8043.985) (-8043.431) * (-8040.939) (-8043.619) (-8048.323) [-8040.588] -- 0:04:32
      18500 -- (-8043.535) (-8040.009) (-8056.133) [-8038.557] * (-8046.318) [-8042.819] (-8053.557) (-8038.966) -- 0:05:18
      19000 -- (-8042.076) [-8042.593] (-8041.093) (-8046.154) * (-8038.036) [-8041.431] (-8046.006) (-8044.301) -- 0:05:09
      19500 -- [-8039.467] (-8045.606) (-8037.439) (-8043.352) * (-8039.846) [-8039.459] (-8045.547) (-8042.330) -- 0:05:01
      20000 -- [-8042.272] (-8042.334) (-8038.118) (-8041.592) * (-8042.509) [-8037.970] (-8047.631) (-8038.085) -- 0:04:54

      Average standard deviation of split frequencies: 0.000000

      20500 -- (-8046.362) (-8042.524) [-8040.887] (-8043.387) * [-8038.059] (-8039.277) (-8045.753) (-8040.421) -- 0:04:46
      21000 -- (-8044.458) (-8040.186) (-8044.813) [-8037.409] * (-8047.051) (-8039.495) (-8045.874) [-8038.288] -- 0:04:39
      21500 -- (-8037.278) (-8042.801) (-8042.621) [-8040.168] * (-8044.050) (-8040.830) (-8042.475) [-8039.394] -- 0:04:33
      22000 -- (-8048.324) (-8050.765) [-8039.808] (-8040.000) * [-8045.902] (-8047.916) (-8046.982) (-8042.482) -- 0:04:26
      22500 -- (-8039.896) (-8041.548) [-8035.939] (-8038.471) * [-8039.778] (-8049.802) (-8046.165) (-8038.099) -- 0:05:04
      23000 -- (-8035.344) (-8043.027) (-8039.868) [-8040.338] * (-8039.169) (-8053.912) [-8052.297] (-8037.792) -- 0:04:57
      23500 -- (-8052.331) (-8043.425) [-8038.899] (-8040.427) * (-8043.792) [-8038.953] (-8043.910) (-8042.238) -- 0:04:50
      24000 -- (-8039.152) [-8045.037] (-8045.352) (-8040.980) * [-8041.014] (-8037.756) (-8038.924) (-8041.694) -- 0:04:44
      24500 -- (-8040.171) [-8041.054] (-8036.434) (-8041.171) * (-8038.333) (-8041.126) [-8045.776] (-8057.268) -- 0:04:38
      25000 -- (-8042.728) (-8041.234) [-8039.733] (-8043.896) * [-8039.156] (-8040.428) (-8050.004) (-8041.200) -- 0:04:33

      Average standard deviation of split frequencies: 0.000000

      25500 -- [-8043.558] (-8047.108) (-8042.782) (-8040.674) * [-8040.933] (-8041.200) (-8039.684) (-8046.243) -- 0:04:27
      26000 -- (-8037.114) [-8043.440] (-8038.849) (-8038.922) * (-8039.523) (-8038.586) [-8037.676] (-8047.132) -- 0:04:59
      26500 -- (-8037.881) [-8038.641] (-8041.807) (-8040.341) * (-8039.776) [-8038.499] (-8036.331) (-8045.195) -- 0:04:53
      27000 -- (-8039.169) (-8050.834) [-8039.260] (-8035.573) * (-8037.864) [-8036.836] (-8038.144) (-8036.363) -- 0:04:48
      27500 -- (-8041.800) (-8047.694) (-8037.363) [-8037.905] * (-8040.147) (-8039.939) (-8039.447) [-8040.402] -- 0:04:42
      28000 -- [-8037.487] (-8042.707) (-8043.162) (-8041.089) * (-8044.354) (-8041.866) [-8037.069] (-8037.739) -- 0:04:37
      28500 -- [-8036.796] (-8039.643) (-8035.786) (-8042.901) * (-8039.130) (-8045.173) [-8038.480] (-8042.802) -- 0:04:32
      29000 -- [-8038.380] (-8046.582) (-8040.569) (-8041.832) * (-8044.393) (-8041.371) [-8037.600] (-8043.267) -- 0:04:27
      29500 -- (-8043.784) [-8043.829] (-8045.775) (-8041.726) * (-8044.116) (-8039.081) (-8037.990) [-8040.210] -- 0:04:56
      30000 -- (-8039.493) (-8036.797) (-8038.686) [-8037.902] * (-8047.053) [-8037.834] (-8036.853) (-8039.353) -- 0:04:51

      Average standard deviation of split frequencies: 0.000000

      30500 -- [-8050.510] (-8038.482) (-8046.846) (-8042.273) * (-8047.072) (-8040.910) (-8037.972) [-8039.647] -- 0:04:46
      31000 -- (-8039.720) (-8040.865) [-8042.587] (-8045.647) * (-8045.595) (-8042.619) [-8046.159] (-8035.464) -- 0:04:41
      31500 -- (-8040.723) (-8039.908) [-8042.540] (-8044.270) * (-8048.732) [-8036.123] (-8043.944) (-8034.700) -- 0:04:36
      32000 -- (-8041.110) (-8044.561) [-8046.580] (-8041.241) * (-8040.834) (-8036.272) (-8039.141) [-8037.725] -- 0:04:32
      32500 -- (-8042.434) [-8039.899] (-8050.371) (-8039.351) * (-8040.663) (-8036.238) (-8040.454) [-8037.451] -- 0:04:27
      33000 -- (-8041.434) (-8045.063) (-8047.783) [-8038.198] * [-8038.948] (-8040.795) (-8039.499) (-8040.782) -- 0:04:53
      33500 -- (-8045.402) (-8045.133) [-8042.920] (-8043.942) * [-8037.629] (-8038.813) (-8049.371) (-8040.337) -- 0:04:48
      34000 -- (-8043.038) (-8038.701) [-8042.088] (-8046.507) * (-8041.542) (-8036.434) [-8043.934] (-8047.527) -- 0:04:44
      34500 -- [-8040.125] (-8038.865) (-8047.094) (-8045.224) * [-8043.848] (-8044.430) (-8044.911) (-8041.356) -- 0:04:39
      35000 -- (-8037.200) (-8041.830) (-8050.317) [-8042.177] * (-8039.468) (-8048.222) (-8041.151) [-8045.963] -- 0:04:35

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-8039.306) (-8043.100) (-8046.973) [-8039.809] * [-8038.555] (-8047.202) (-8044.307) (-8045.474) -- 0:04:31
      36000 -- [-8036.805] (-8041.703) (-8049.007) (-8041.912) * [-8037.470] (-8040.319) (-8047.121) (-8049.605) -- 0:04:27
      36500 -- [-8034.875] (-8043.376) (-8043.593) (-8040.318) * (-8047.044) [-8037.700] (-8044.631) (-8042.977) -- 0:04:50
      37000 -- [-8038.396] (-8044.183) (-8044.258) (-8048.824) * [-8038.805] (-8040.989) (-8043.994) (-8041.021) -- 0:04:46
      37500 -- (-8042.155) (-8039.605) (-8040.996) [-8044.923] * (-8040.676) (-8042.880) (-8043.694) [-8042.734] -- 0:04:42
      38000 -- (-8045.628) [-8038.746] (-8042.215) (-8036.482) * [-8037.360] (-8042.377) (-8050.561) (-8048.435) -- 0:04:38
      38500 -- (-8036.646) [-8038.951] (-8040.334) (-8042.249) * (-8037.610) (-8041.834) [-8036.792] (-8040.775) -- 0:04:34
      39000 -- (-8038.329) (-8043.427) [-8040.292] (-8039.522) * (-8039.659) (-8038.913) [-8040.189] (-8042.772) -- 0:04:31
      39500 -- (-8036.405) (-8046.989) (-8039.828) [-8044.378] * (-8043.684) [-8039.933] (-8043.360) (-8045.696) -- 0:04:27
      40000 -- (-8045.842) (-8044.551) (-8041.317) [-8040.589] * (-8043.962) (-8040.810) (-8044.241) [-8039.160] -- 0:04:24

      Average standard deviation of split frequencies: 0.000000

      40500 -- (-8043.486) (-8044.273) (-8044.532) [-8037.957] * (-8044.559) (-8035.209) (-8041.734) [-8038.840] -- 0:04:44
      41000 -- (-8050.795) (-8044.686) (-8042.329) [-8035.808] * (-8044.083) (-8040.338) (-8038.961) [-8035.415] -- 0:04:40
      41500 -- (-8051.396) (-8043.118) (-8044.724) [-8037.371] * (-8036.506) [-8044.012] (-8039.567) (-8041.156) -- 0:04:37
      42000 -- (-8051.227) (-8037.958) (-8040.676) [-8039.141] * (-8039.969) (-8043.871) [-8036.836] (-8045.437) -- 0:04:33
      42500 -- (-8056.272) (-8041.018) [-8039.026] (-8039.874) * (-8048.020) (-8037.269) [-8039.740] (-8039.770) -- 0:04:30
      43000 -- (-8041.622) (-8042.043) (-8040.733) [-8036.692] * (-8039.078) (-8043.086) [-8039.054] (-8044.035) -- 0:04:27
      43500 -- [-8037.953] (-8041.508) (-8037.706) (-8038.067) * (-8047.834) [-8039.117] (-8040.229) (-8044.205) -- 0:04:23
      44000 -- [-8040.145] (-8040.625) (-8038.558) (-8039.235) * (-8042.683) (-8040.357) (-8041.982) [-8042.259] -- 0:04:42
      44500 -- [-8040.408] (-8042.149) (-8042.029) (-8041.381) * (-8043.630) [-8038.357] (-8043.393) (-8045.560) -- 0:04:39
      45000 -- (-8042.130) (-8039.373) (-8042.278) [-8037.508] * (-8042.033) (-8043.318) [-8040.959] (-8042.453) -- 0:04:35

      Average standard deviation of split frequencies: 0.000000

      45500 -- [-8041.371] (-8043.045) (-8040.496) (-8042.378) * (-8050.387) (-8044.190) [-8046.059] (-8037.717) -- 0:04:32
      46000 -- (-8040.117) (-8040.577) (-8045.008) [-8042.628] * (-8046.172) (-8052.169) (-8038.624) [-8046.921] -- 0:04:29
      46500 -- (-8039.296) (-8049.613) [-8041.073] (-8045.944) * (-8041.149) (-8049.050) (-8037.518) [-8040.935] -- 0:04:26
      47000 -- (-8038.289) [-8039.394] (-8041.685) (-8044.645) * (-8042.045) (-8043.321) [-8041.696] (-8042.627) -- 0:04:23
      47500 -- [-8040.448] (-8045.225) (-8042.094) (-8049.100) * (-8044.714) (-8040.181) [-8037.837] (-8051.094) -- 0:04:40
      48000 -- (-8039.053) (-8038.876) [-8038.374] (-8042.486) * [-8035.727] (-8037.606) (-8046.142) (-8042.157) -- 0:04:37
      48500 -- [-8039.128] (-8040.854) (-8042.027) (-8039.395) * (-8038.472) [-8039.277] (-8040.555) (-8042.581) -- 0:04:34
      49000 -- (-8036.245) (-8043.479) (-8037.569) [-8036.566] * (-8039.916) (-8035.846) [-8044.956] (-8036.289) -- 0:04:31
      49500 -- (-8036.427) (-8039.777) [-8039.499] (-8038.599) * (-8041.522) [-8039.271] (-8049.557) (-8041.439) -- 0:04:28
      50000 -- (-8039.246) [-8039.022] (-8048.865) (-8039.478) * [-8039.011] (-8039.527) (-8043.913) (-8038.812) -- 0:04:26

      Average standard deviation of split frequencies: 0.000000

      50500 -- [-8041.026] (-8037.509) (-8040.875) (-8038.247) * (-8042.147) (-8036.685) [-8037.928] (-8044.786) -- 0:04:23
      51000 -- (-8043.418) [-8039.580] (-8042.284) (-8039.798) * (-8040.491) [-8041.915] (-8037.200) (-8040.688) -- 0:04:39
      51500 -- (-8041.322) (-8039.903) (-8044.325) [-8035.622] * (-8048.919) (-8040.226) [-8036.347] (-8041.328) -- 0:04:36
      52000 -- [-8039.855] (-8040.089) (-8045.200) (-8041.029) * (-8038.555) [-8044.467] (-8039.114) (-8046.403) -- 0:04:33
      52500 -- (-8043.059) [-8045.801] (-8049.978) (-8040.714) * (-8049.272) [-8045.749] (-8047.009) (-8047.336) -- 0:04:30
      53000 -- (-8038.109) (-8039.698) [-8046.439] (-8046.631) * (-8051.697) (-8042.362) [-8041.569] (-8040.969) -- 0:04:28
      53500 -- (-8040.183) (-8041.928) (-8046.886) [-8045.540] * (-8042.363) [-8038.602] (-8038.373) (-8042.997) -- 0:04:25
      54000 -- (-8040.701) [-8036.814] (-8041.399) (-8042.915) * [-8048.674] (-8041.352) (-8040.297) (-8042.352) -- 0:04:22
      54500 -- (-8040.624) [-8038.361] (-8040.351) (-8044.764) * [-8041.680] (-8042.858) (-8035.228) (-8041.159) -- 0:04:37
      55000 -- (-8048.574) [-8039.007] (-8038.470) (-8039.126) * (-8041.765) (-8040.515) [-8040.259] (-8041.882) -- 0:04:34

      Average standard deviation of split frequencies: 0.000000

      55500 -- (-8042.357) (-8043.027) [-8039.657] (-8038.535) * [-8040.982] (-8044.160) (-8039.843) (-8038.074) -- 0:04:32
      56000 -- (-8039.686) (-8045.592) (-8042.411) [-8040.795] * (-8041.588) (-8048.465) (-8048.092) [-8038.780] -- 0:04:29
      56500 -- (-8042.185) [-8039.224] (-8039.973) (-8041.231) * (-8040.891) (-8049.646) [-8042.199] (-8036.227) -- 0:04:27
      57000 -- (-8041.087) (-8039.382) [-8041.533] (-8039.915) * (-8037.143) (-8036.892) [-8044.571] (-8041.222) -- 0:04:24
      57500 -- (-8040.717) [-8037.456] (-8041.740) (-8037.925) * (-8045.242) (-8041.286) (-8041.721) [-8041.451] -- 0:04:22
      58000 -- [-8042.661] (-8044.882) (-8045.334) (-8037.701) * (-8038.537) (-8042.450) [-8041.938] (-8046.937) -- 0:04:36
      58500 -- (-8037.699) (-8040.632) (-8043.394) [-8039.629] * (-8042.828) (-8039.078) (-8039.774) [-8043.488] -- 0:04:33
      59000 -- (-8041.397) (-8039.454) [-8036.345] (-8039.742) * (-8036.764) (-8038.566) [-8041.661] (-8043.205) -- 0:04:31
      59500 -- (-8038.364) [-8039.179] (-8042.655) (-8040.609) * [-8039.278] (-8038.887) (-8035.849) (-8038.860) -- 0:04:28
      60000 -- [-8041.745] (-8038.674) (-8050.009) (-8038.639) * (-8043.755) [-8041.344] (-8039.087) (-8037.555) -- 0:04:26

      Average standard deviation of split frequencies: 0.000000

      60500 -- [-8037.031] (-8039.082) (-8056.338) (-8041.880) * (-8048.600) [-8041.109] (-8039.379) (-8041.462) -- 0:04:23
      61000 -- (-8042.923) (-8041.663) (-8056.577) [-8041.060] * (-8044.362) (-8040.984) [-8040.793] (-8038.546) -- 0:04:21
      61500 -- [-8039.639] (-8037.687) (-8045.317) (-8040.092) * (-8050.718) [-8043.639] (-8043.204) (-8039.981) -- 0:04:34
      62000 -- (-8039.734) (-8043.666) [-8040.905] (-8037.654) * (-8051.585) (-8044.751) [-8040.739] (-8043.390) -- 0:04:32
      62500 -- [-8044.884] (-8047.601) (-8041.360) (-8042.282) * [-8046.047] (-8040.990) (-8036.480) (-8038.961) -- 0:04:30
      63000 -- (-8040.432) [-8044.460] (-8044.178) (-8038.692) * [-8045.687] (-8050.230) (-8037.814) (-8038.539) -- 0:04:27
      63500 -- (-8044.297) (-8042.061) (-8042.285) [-8033.393] * [-8038.987] (-8050.199) (-8039.786) (-8045.080) -- 0:04:25
      64000 -- (-8044.721) (-8039.113) (-8041.856) [-8041.104] * (-8042.040) [-8036.935] (-8038.996) (-8044.669) -- 0:04:23
      64500 -- (-8047.010) (-8038.602) [-8039.513] (-8040.281) * (-8050.034) [-8039.189] (-8043.811) (-8044.393) -- 0:04:21
      65000 -- (-8049.525) (-8039.447) [-8039.507] (-8040.044) * (-8046.332) [-8040.785] (-8039.628) (-8050.538) -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      65500 -- [-8043.121] (-8038.747) (-8040.525) (-8049.785) * (-8042.508) (-8038.714) [-8036.931] (-8044.287) -- 0:04:31
      66000 -- (-8038.139) (-8042.109) (-8053.001) [-8038.248] * [-8035.106] (-8041.964) (-8042.110) (-8040.199) -- 0:04:28
      66500 -- (-8043.050) [-8039.815] (-8042.959) (-8044.209) * (-8040.761) (-8038.340) [-8039.726] (-8040.594) -- 0:04:26
      67000 -- [-8044.436] (-8040.816) (-8042.968) (-8042.938) * (-8037.610) (-8040.180) [-8035.756] (-8044.296) -- 0:04:24
      67500 -- (-8043.642) [-8037.657] (-8043.241) (-8055.862) * (-8042.361) (-8043.743) [-8036.023] (-8041.242) -- 0:04:22
      68000 -- [-8040.468] (-8041.242) (-8041.631) (-8042.691) * (-8041.062) [-8041.353] (-8043.562) (-8046.080) -- 0:04:20
      68500 -- (-8043.908) (-8040.511) [-8043.036] (-8038.130) * [-8038.473] (-8047.330) (-8041.966) (-8040.626) -- 0:04:18
      69000 -- (-8046.951) (-8040.094) (-8039.081) [-8037.986] * (-8045.754) [-8037.604] (-8048.224) (-8037.590) -- 0:04:29
      69500 -- [-8041.792] (-8044.224) (-8040.711) (-8040.005) * (-8042.366) [-8038.808] (-8044.924) (-8049.662) -- 0:04:27
      70000 -- (-8040.316) [-8040.665] (-8041.935) (-8041.895) * (-8042.852) (-8047.845) [-8037.500] (-8044.681) -- 0:04:25

      Average standard deviation of split frequencies: 0.000000

      70500 -- [-8041.489] (-8043.825) (-8046.790) (-8037.399) * [-8037.897] (-8040.861) (-8039.005) (-8045.181) -- 0:04:23
      71000 -- (-8042.497) (-8041.924) (-8048.140) [-8038.998] * (-8040.262) (-8047.353) (-8041.193) [-8038.027] -- 0:04:21
      71500 -- [-8035.694] (-8038.565) (-8046.082) (-8035.025) * (-8041.140) (-8041.850) (-8037.087) [-8040.595] -- 0:04:19
      72000 -- (-8040.817) (-8040.294) (-8043.515) [-8038.048] * (-8045.867) (-8040.031) [-8041.454] (-8042.266) -- 0:04:17
      72500 -- [-8041.786] (-8040.616) (-8041.266) (-8042.708) * (-8035.033) [-8040.226] (-8042.120) (-8039.215) -- 0:04:28
      73000 -- (-8039.683) [-8040.828] (-8040.317) (-8038.722) * (-8035.284) [-8040.207] (-8043.424) (-8040.713) -- 0:04:26
      73500 -- (-8043.384) (-8045.764) [-8037.590] (-8041.662) * (-8035.832) (-8041.775) (-8044.030) [-8043.210] -- 0:04:24
      74000 -- (-8041.484) [-8038.564] (-8049.198) (-8041.473) * (-8038.530) (-8037.754) [-8044.000] (-8040.515) -- 0:04:22
      74500 -- [-8042.927] (-8036.302) (-8036.990) (-8045.026) * [-8040.692] (-8041.691) (-8041.740) (-8040.813) -- 0:04:20
      75000 -- (-8040.810) (-8041.089) [-8041.521] (-8040.969) * [-8040.178] (-8045.211) (-8036.524) (-8040.919) -- 0:04:19

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-8038.893) (-8043.346) [-8037.167] (-8038.247) * (-8045.863) (-8045.296) [-8041.659] (-8042.482) -- 0:04:17
      76000 -- (-8049.123) [-8037.818] (-8042.327) (-8039.115) * (-8043.037) (-8045.972) (-8040.572) [-8040.745] -- 0:04:27
      76500 -- (-8046.392) (-8039.574) (-8038.734) [-8041.542] * (-8042.561) (-8043.777) (-8040.980) [-8037.536] -- 0:04:25
      77000 -- (-8051.121) (-8036.999) [-8036.044] (-8038.123) * [-8042.172] (-8044.982) (-8041.005) (-8044.450) -- 0:04:23
      77500 -- [-8042.852] (-8039.359) (-8037.877) (-8045.249) * (-8049.026) (-8038.005) [-8038.213] (-8037.557) -- 0:04:21
      78000 -- [-8037.901] (-8041.651) (-8042.387) (-8039.844) * [-8040.513] (-8041.399) (-8042.206) (-8048.318) -- 0:04:20
      78500 -- (-8039.917) [-8035.922] (-8041.296) (-8039.979) * [-8043.036] (-8043.350) (-8043.843) (-8039.431) -- 0:04:18
      79000 -- [-8033.760] (-8045.097) (-8040.238) (-8038.613) * (-8042.696) (-8045.707) (-8047.204) [-8038.270] -- 0:04:16
      79500 -- (-8040.665) (-8042.524) (-8036.359) [-8043.830] * (-8041.196) (-8045.694) (-8047.792) [-8039.990] -- 0:04:26
      80000 -- (-8045.563) (-8038.690) [-8036.449] (-8042.288) * [-8039.136] (-8047.776) (-8040.331) (-8044.754) -- 0:04:24

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-8046.241) [-8037.567] (-8040.827) (-8040.995) * [-8040.664] (-8047.728) (-8047.552) (-8048.780) -- 0:04:22
      81000 -- [-8042.880] (-8038.443) (-8042.719) (-8038.694) * (-8037.036) [-8042.160] (-8040.973) (-8040.366) -- 0:04:20
      81500 -- [-8039.001] (-8039.670) (-8038.432) (-8041.229) * (-8036.725) [-8043.952] (-8036.175) (-8043.380) -- 0:04:19
      82000 -- (-8038.512) (-8043.101) [-8044.854] (-8040.011) * (-8042.612) (-8045.045) [-8039.810] (-8048.912) -- 0:04:17
      82500 -- (-8037.168) (-8043.451) (-8040.057) [-8042.338] * (-8037.044) (-8049.039) (-8046.589) [-8045.271] -- 0:04:15
      83000 -- (-8043.254) (-8037.910) [-8038.259] (-8041.144) * [-8044.005] (-8045.573) (-8042.630) (-8044.465) -- 0:04:14
      83500 -- (-8042.946) (-8039.830) [-8037.781] (-8041.700) * [-8039.303] (-8045.733) (-8050.449) (-8042.839) -- 0:04:23
      84000 -- (-8042.431) (-8041.287) (-8036.682) [-8040.662] * [-8041.681] (-8045.713) (-8039.055) (-8039.606) -- 0:04:21
      84500 -- (-8044.617) [-8038.440] (-8042.232) (-8038.229) * (-8043.974) (-8045.928) [-8039.419] (-8042.939) -- 0:04:20
      85000 -- (-8044.629) (-8038.762) [-8038.426] (-8040.489) * (-8042.247) (-8046.299) [-8042.559] (-8042.829) -- 0:04:18

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-8048.509) (-8039.709) [-8044.456] (-8041.653) * (-8050.879) [-8041.719] (-8053.439) (-8040.018) -- 0:04:16
      86000 -- [-8044.084] (-8044.017) (-8041.763) (-8044.032) * (-8043.158) (-8038.455) (-8044.059) [-8038.898] -- 0:04:15
      86500 -- (-8043.301) (-8054.932) (-8044.392) [-8039.534] * (-8050.037) (-8041.243) (-8043.856) [-8036.383] -- 0:04:13
      87000 -- (-8039.594) (-8045.642) (-8042.742) [-8048.572] * (-8043.095) (-8038.568) [-8046.982] (-8045.590) -- 0:04:22
      87500 -- (-8039.539) (-8047.725) [-8042.833] (-8045.492) * (-8038.560) (-8039.843) (-8040.203) [-8037.787] -- 0:04:20
      88000 -- (-8047.491) [-8042.806] (-8045.249) (-8036.545) * (-8042.557) (-8039.869) (-8040.758) [-8036.117] -- 0:04:19
      88500 -- (-8048.534) (-8044.724) (-8041.256) [-8037.985] * (-8042.505) (-8044.188) (-8045.177) [-8035.833] -- 0:04:17
      89000 -- (-8046.906) (-8042.317) [-8037.260] (-8037.887) * [-8039.320] (-8038.312) (-8039.743) (-8048.333) -- 0:04:15
      89500 -- (-8043.930) (-8038.472) [-8038.807] (-8040.358) * (-8044.433) [-8039.096] (-8042.584) (-8044.691) -- 0:04:14
      90000 -- (-8045.897) (-8038.229) [-8037.704] (-8038.435) * (-8038.295) [-8040.287] (-8039.309) (-8047.271) -- 0:04:12

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-8045.645) [-8040.771] (-8038.655) (-8042.071) * [-8036.692] (-8044.155) (-8038.380) (-8038.506) -- 0:04:21
      91000 -- (-8041.617) (-8039.788) (-8043.916) [-8042.232] * (-8035.098) [-8042.695] (-8040.354) (-8044.645) -- 0:04:19
      91500 -- (-8038.267) [-8037.581] (-8041.837) (-8047.739) * (-8046.133) (-8045.973) (-8050.006) [-8038.880] -- 0:04:18
      92000 -- (-8040.336) [-8040.628] (-8037.656) (-8046.495) * (-8039.715) (-8036.714) (-8041.992) [-8043.979] -- 0:04:16
      92500 -- (-8038.928) [-8040.889] (-8039.276) (-8047.043) * [-8040.455] (-8038.840) (-8041.411) (-8044.928) -- 0:04:15
      93000 -- [-8038.955] (-8042.189) (-8036.225) (-8040.560) * (-8042.291) [-8035.434] (-8041.543) (-8044.158) -- 0:04:13
      93500 -- (-8041.439) [-8045.782] (-8034.415) (-8039.049) * (-8037.628) [-8039.291] (-8043.150) (-8044.584) -- 0:04:12
      94000 -- (-8043.853) [-8038.590] (-8042.441) (-8042.794) * (-8043.471) (-8039.652) [-8035.961] (-8041.203) -- 0:04:20
      94500 -- (-8043.164) [-8040.531] (-8039.950) (-8040.594) * (-8049.612) (-8041.617) [-8044.003] (-8045.048) -- 0:04:18
      95000 -- (-8036.842) [-8040.898] (-8039.383) (-8037.177) * (-8041.883) (-8037.212) (-8038.190) [-8034.327] -- 0:04:17

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-8038.629) [-8037.030] (-8041.845) (-8038.838) * (-8040.568) (-8040.804) [-8036.602] (-8043.490) -- 0:04:15
      96000 -- (-8040.404) [-8044.317] (-8041.101) (-8045.070) * (-8040.663) (-8044.304) [-8043.131] (-8035.251) -- 0:04:14
      96500 -- [-8040.796] (-8046.601) (-8039.161) (-8047.492) * (-8042.272) [-8042.077] (-8039.109) (-8035.993) -- 0:04:12
      97000 -- (-8042.565) (-8043.476) (-8042.827) [-8044.268] * (-8039.446) [-8036.131] (-8044.631) (-8038.817) -- 0:04:11
      97500 -- (-8037.343) (-8040.306) (-8040.787) [-8039.191] * (-8039.016) (-8044.784) (-8042.529) [-8041.730] -- 0:04:19
      98000 -- (-8042.652) [-8041.935] (-8042.085) (-8043.598) * (-8039.635) (-8042.442) [-8043.853] (-8038.080) -- 0:04:17
      98500 -- (-8043.457) (-8040.098) (-8041.226) [-8036.962] * (-8042.142) [-8036.356] (-8037.997) (-8041.719) -- 0:04:16
      99000 -- (-8048.272) (-8045.621) [-8041.502] (-8039.308) * (-8044.127) (-8048.136) (-8038.900) [-8038.600] -- 0:04:14
      99500 -- (-8046.072) [-8038.124] (-8044.844) (-8036.923) * [-8043.149] (-8046.384) (-8038.276) (-8046.507) -- 0:04:13
      100000 -- [-8043.268] (-8038.026) (-8040.066) (-8041.741) * (-8044.537) (-8040.366) [-8039.923] (-8047.481) -- 0:04:11

      Average standard deviation of split frequencies: 0.000000

      100500 -- (-8045.521) [-8043.090] (-8042.148) (-8044.094) * (-8049.879) [-8042.016] (-8050.837) (-8039.239) -- 0:04:10
      101000 -- (-8038.886) [-8046.497] (-8040.758) (-8041.226) * (-8036.402) (-8041.207) (-8042.650) [-8038.979] -- 0:04:18
      101500 -- [-8045.248] (-8044.604) (-8039.340) (-8040.320) * (-8046.520) (-8038.595) (-8041.893) [-8037.464] -- 0:04:16
      102000 -- [-8047.204] (-8037.348) (-8039.972) (-8041.132) * (-8038.684) (-8045.112) [-8035.532] (-8040.529) -- 0:04:15
      102500 -- (-8045.432) [-8037.782] (-8049.751) (-8040.630) * (-8051.148) [-8041.899] (-8045.851) (-8043.485) -- 0:04:13
      103000 -- (-8044.283) (-8046.199) [-8047.356] (-8037.714) * [-8037.087] (-8054.743) (-8043.027) (-8039.925) -- 0:04:12
      103500 -- [-8041.817] (-8042.373) (-8049.183) (-8040.238) * (-8042.510) (-8040.898) [-8037.620] (-8038.966) -- 0:04:11
      104000 -- (-8045.060) (-8042.875) [-8040.524] (-8041.947) * [-8041.260] (-8040.245) (-8038.803) (-8039.409) -- 0:04:09
      104500 -- (-8040.009) (-8041.207) [-8038.596] (-8040.118) * (-8050.069) (-8039.732) (-8043.244) [-8039.427] -- 0:04:08
      105000 -- (-8036.650) (-8044.118) [-8038.944] (-8049.241) * (-8041.025) [-8042.291] (-8043.197) (-8038.799) -- 0:04:15

      Average standard deviation of split frequencies: 0.000000

      105500 -- [-8040.635] (-8037.290) (-8045.472) (-8040.550) * (-8043.885) [-8041.503] (-8042.605) (-8039.786) -- 0:04:14
      106000 -- [-8038.781] (-8048.613) (-8040.234) (-8040.555) * (-8039.824) (-8044.246) (-8050.970) [-8038.885] -- 0:04:13
      106500 -- (-8040.129) (-8040.379) (-8038.054) [-8038.833] * (-8038.895) (-8041.658) [-8040.126] (-8035.608) -- 0:04:11
      107000 -- (-8044.204) (-8041.901) (-8035.863) [-8038.019] * (-8045.901) (-8039.451) (-8042.863) [-8039.729] -- 0:04:10
      107500 -- (-8042.203) (-8044.903) [-8039.403] (-8041.971) * (-8044.085) (-8038.029) [-8042.857] (-8047.028) -- 0:04:09
      108000 -- [-8036.086] (-8041.649) (-8045.760) (-8035.215) * (-8039.355) (-8036.542) [-8042.222] (-8051.386) -- 0:04:07
      108500 -- [-8044.951] (-8048.260) (-8038.432) (-8043.061) * (-8039.685) (-8040.434) [-8039.164] (-8044.211) -- 0:04:14
      109000 -- (-8049.246) [-8041.663] (-8036.229) (-8042.691) * [-8038.899] (-8045.045) (-8036.303) (-8046.092) -- 0:04:13
      109500 -- (-8038.032) (-8038.943) [-8042.609] (-8038.243) * (-8035.611) (-8040.823) (-8043.931) [-8042.533] -- 0:04:12
      110000 -- [-8040.896] (-8038.185) (-8044.447) (-8042.359) * (-8040.679) (-8042.038) (-8044.798) [-8038.983] -- 0:04:10

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-8039.056) [-8036.156] (-8037.823) (-8043.112) * (-8041.809) [-8037.145] (-8046.941) (-8040.720) -- 0:04:09
      111000 -- (-8041.856) (-8040.257) [-8041.225] (-8039.729) * (-8044.784) [-8041.639] (-8044.570) (-8036.850) -- 0:04:08
      111500 -- [-8042.017] (-8038.362) (-8043.606) (-8041.379) * (-8039.685) (-8037.272) (-8042.347) [-8044.211] -- 0:04:07
      112000 -- (-8050.109) (-8040.358) (-8036.271) [-8037.079] * (-8038.012) [-8040.651] (-8046.721) (-8042.344) -- 0:04:13
      112500 -- (-8040.340) [-8038.838] (-8045.848) (-8043.047) * (-8045.026) (-8044.989) (-8050.295) [-8039.844] -- 0:04:12
      113000 -- [-8036.584] (-8038.956) (-8043.012) (-8039.939) * [-8038.062] (-8039.842) (-8041.069) (-8041.700) -- 0:04:11
      113500 -- (-8040.112) [-8040.266] (-8044.883) (-8046.259) * (-8038.930) [-8045.648] (-8052.228) (-8038.245) -- 0:04:09
      114000 -- (-8041.165) (-8038.913) [-8040.972] (-8047.376) * (-8037.992) [-8046.328] (-8047.848) (-8035.442) -- 0:04:08
      114500 -- (-8040.124) (-8052.819) [-8039.337] (-8050.390) * [-8039.260] (-8038.300) (-8049.811) (-8039.254) -- 0:04:07
      115000 -- (-8044.562) (-8042.400) [-8039.476] (-8045.017) * (-8042.203) [-8040.917] (-8048.213) (-8037.765) -- 0:04:06

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-8040.820) (-8036.579) (-8043.429) [-8046.559] * (-8042.872) (-8041.575) [-8041.841] (-8047.632) -- 0:04:12
      116000 -- (-8039.303) [-8038.310] (-8038.859) (-8039.577) * (-8043.243) (-8053.950) [-8046.441] (-8043.455) -- 0:04:11
      116500 -- (-8046.453) [-8038.768] (-8040.760) (-8040.817) * (-8041.858) (-8043.250) (-8040.431) [-8040.393] -- 0:04:10
      117000 -- (-8045.138) (-8037.796) (-8045.930) [-8039.282] * (-8043.512) (-8040.144) [-8038.425] (-8044.401) -- 0:04:09
      117500 -- (-8039.834) (-8039.949) (-8037.637) [-8037.698] * (-8044.606) (-8044.274) (-8039.532) [-8039.246] -- 0:04:07
      118000 -- [-8043.326] (-8038.779) (-8036.073) (-8045.859) * (-8044.000) (-8044.115) (-8035.397) [-8043.189] -- 0:04:06
      118500 -- [-8038.680] (-8041.202) (-8042.273) (-8044.685) * (-8040.342) [-8046.803] (-8035.733) (-8053.249) -- 0:04:05
      119000 -- (-8042.205) (-8043.711) (-8040.414) [-8039.154] * (-8043.068) [-8037.347] (-8043.310) (-8044.348) -- 0:04:11
      119500 -- (-8038.093) (-8042.287) [-8036.293] (-8045.173) * (-8044.441) (-8044.533) [-8039.261] (-8044.427) -- 0:04:10
      120000 -- (-8044.373) [-8039.568] (-8044.044) (-8043.169) * [-8041.078] (-8053.253) (-8042.494) (-8047.159) -- 0:04:09

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-8039.031) (-8039.467) (-8043.161) [-8043.936] * (-8041.373) (-8039.150) (-8049.371) [-8038.837] -- 0:04:08
      121000 -- [-8035.928] (-8045.166) (-8038.192) (-8042.005) * (-8044.817) (-8041.661) [-8039.487] (-8038.599) -- 0:04:06
      121500 -- (-8040.991) (-8038.869) (-8035.620) [-8037.764] * (-8045.602) (-8038.387) (-8043.093) [-8042.277] -- 0:04:05
      122000 -- [-8037.985] (-8048.231) (-8041.956) (-8041.518) * [-8042.405] (-8041.772) (-8040.440) (-8037.503) -- 0:04:04
      122500 -- (-8041.132) [-8043.281] (-8040.668) (-8043.996) * (-8041.249) (-8046.325) [-8039.188] (-8044.424) -- 0:04:10
      123000 -- (-8040.803) (-8052.595) [-8038.766] (-8043.123) * (-8040.603) (-8036.252) (-8040.974) [-8045.908] -- 0:04:09
      123500 -- [-8039.855] (-8038.256) (-8036.108) (-8036.805) * (-8045.193) [-8037.211] (-8040.533) (-8043.733) -- 0:04:08
      124000 -- (-8041.796) (-8041.550) [-8037.269] (-8040.290) * [-8042.381] (-8040.020) (-8039.871) (-8045.737) -- 0:04:07
      124500 -- (-8039.334) (-8042.408) (-8041.682) [-8037.036] * (-8041.698) [-8041.308] (-8039.466) (-8046.535) -- 0:04:06
      125000 -- (-8037.847) (-8041.785) (-8038.117) [-8039.009] * (-8047.915) [-8040.985] (-8039.672) (-8041.253) -- 0:04:04

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-8047.664) (-8047.399) (-8041.534) [-8039.588] * (-8042.970) (-8039.709) (-8038.093) [-8035.768] -- 0:04:03
      126000 -- (-8046.161) (-8045.228) [-8042.615] (-8035.190) * (-8044.011) (-8043.173) (-8038.531) [-8044.414] -- 0:04:09
      126500 -- (-8039.370) (-8038.755) [-8040.074] (-8036.645) * (-8042.233) [-8045.329] (-8040.067) (-8039.601) -- 0:04:08
      127000 -- [-8038.799] (-8036.989) (-8040.572) (-8044.948) * (-8039.787) [-8043.140] (-8046.723) (-8051.212) -- 0:04:07
      127500 -- (-8036.708) (-8040.791) [-8038.796] (-8050.533) * (-8038.907) (-8043.218) (-8046.856) [-8042.441] -- 0:04:06
      128000 -- (-8038.304) (-8041.569) (-8038.858) [-8042.359] * (-8044.690) (-8039.601) [-8038.331] (-8042.804) -- 0:04:05
      128500 -- (-8039.455) (-8038.935) [-8039.220] (-8036.857) * (-8040.999) (-8038.989) (-8036.367) [-8039.224] -- 0:04:04
      129000 -- (-8045.856) [-8042.506] (-8039.386) (-8053.009) * (-8049.099) (-8043.431) (-8040.744) [-8041.593] -- 0:04:03
      129500 -- (-8044.733) (-8039.608) (-8040.686) [-8040.337] * (-8045.386) [-8040.513] (-8042.787) (-8039.353) -- 0:04:01
      130000 -- (-8053.472) (-8048.376) (-8039.094) [-8036.437] * (-8036.930) (-8048.991) [-8040.491] (-8040.033) -- 0:04:07

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-8038.683) (-8039.885) (-8040.479) [-8042.047] * (-8038.178) [-8045.105] (-8040.039) (-8044.102) -- 0:04:06
      131000 -- [-8041.443] (-8042.174) (-8043.284) (-8038.421) * (-8042.477) [-8042.243] (-8037.973) (-8044.507) -- 0:04:05
      131500 -- (-8038.109) (-8041.395) [-8038.347] (-8038.063) * (-8045.300) (-8039.793) (-8039.591) [-8038.364] -- 0:04:04
      132000 -- (-8036.654) (-8038.801) [-8044.169] (-8040.284) * (-8045.882) (-8043.067) [-8042.319] (-8043.022) -- 0:04:03
      132500 -- (-8036.964) [-8039.682] (-8041.393) (-8043.533) * (-8044.218) [-8050.524] (-8039.034) (-8039.685) -- 0:04:02
      133000 -- (-8043.639) (-8047.070) [-8052.873] (-8039.422) * (-8040.071) (-8041.941) (-8039.213) [-8039.564] -- 0:04:01
      133500 -- (-8038.537) (-8038.337) (-8053.210) [-8038.278] * (-8042.852) (-8048.779) [-8041.079] (-8037.144) -- 0:04:06
      134000 -- [-8037.258] (-8044.128) (-8047.045) (-8038.763) * [-8040.972] (-8048.590) (-8039.839) (-8039.117) -- 0:04:05
      134500 -- [-8042.980] (-8035.452) (-8046.008) (-8039.280) * (-8044.976) (-8043.800) [-8036.822] (-8040.793) -- 0:04:04
      135000 -- (-8040.275) [-8038.654] (-8037.822) (-8043.298) * (-8046.904) (-8040.044) [-8038.388] (-8045.145) -- 0:04:03

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-8042.543) (-8040.197) (-8037.920) [-8040.444] * (-8047.959) (-8045.935) (-8037.544) [-8042.862] -- 0:04:02
      136000 -- [-8040.654] (-8038.311) (-8040.214) (-8038.909) * (-8039.105) [-8038.494] (-8042.548) (-8042.410) -- 0:04:01
      136500 -- (-8047.476) [-8037.192] (-8046.618) (-8043.945) * (-8046.258) (-8037.097) (-8041.467) [-8041.554] -- 0:04:00
      137000 -- (-8039.525) [-8044.761] (-8040.525) (-8044.417) * (-8046.929) (-8039.717) [-8042.748] (-8047.944) -- 0:04:05
      137500 -- (-8043.548) (-8035.717) [-8038.609] (-8041.581) * (-8044.909) (-8038.389) [-8042.071] (-8044.369) -- 0:04:04
      138000 -- (-8040.188) (-8039.117) [-8039.474] (-8047.209) * (-8042.596) (-8044.211) (-8038.910) [-8037.957] -- 0:04:03
      138500 -- (-8044.679) (-8035.720) (-8040.058) [-8044.574] * (-8039.853) [-8040.267] (-8041.369) (-8039.468) -- 0:04:02
      139000 -- (-8045.012) (-8040.483) [-8043.547] (-8042.921) * (-8040.634) (-8042.415) [-8038.890] (-8040.442) -- 0:04:01
      139500 -- (-8042.837) (-8041.985) (-8040.198) [-8040.365] * (-8045.843) [-8038.932] (-8039.922) (-8039.897) -- 0:04:00
      140000 -- [-8042.880] (-8039.397) (-8043.459) (-8038.801) * (-8039.674) (-8044.754) [-8041.356] (-8045.837) -- 0:03:59

      Average standard deviation of split frequencies: 0.000000

      140500 -- (-8047.121) [-8037.569] (-8041.580) (-8042.154) * (-8039.151) (-8041.485) (-8040.799) [-8035.034] -- 0:04:04
      141000 -- (-8044.150) (-8037.486) [-8042.859] (-8041.225) * (-8040.705) [-8041.462] (-8038.237) (-8043.914) -- 0:04:03
      141500 -- [-8040.673] (-8041.694) (-8042.680) (-8041.408) * [-8038.619] (-8044.980) (-8039.474) (-8048.802) -- 0:04:02
      142000 -- [-8042.273] (-8038.704) (-8038.624) (-8049.553) * (-8040.705) [-8038.349] (-8038.089) (-8041.510) -- 0:04:01
      142500 -- (-8043.484) (-8039.346) (-8039.782) [-8038.573] * [-8042.466] (-8043.881) (-8043.730) (-8040.907) -- 0:04:00
      143000 -- [-8041.578] (-8037.657) (-8044.072) (-8039.223) * (-8046.138) (-8041.194) [-8038.100] (-8041.742) -- 0:03:59
      143500 -- [-8038.312] (-8042.931) (-8040.392) (-8046.951) * (-8036.192) [-8040.161] (-8045.147) (-8046.825) -- 0:03:58
      144000 -- (-8037.423) [-8045.068] (-8041.555) (-8041.778) * (-8043.319) [-8041.574] (-8049.330) (-8040.659) -- 0:04:03
      144500 -- (-8036.881) (-8040.512) [-8045.317] (-8039.154) * (-8042.679) [-8043.455] (-8040.959) (-8042.124) -- 0:04:02
      145000 -- [-8041.707] (-8049.762) (-8041.639) (-8039.813) * (-8038.286) [-8037.320] (-8038.397) (-8039.890) -- 0:04:01

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-8039.998) [-8040.013] (-8047.361) (-8040.661) * (-8041.939) (-8042.209) [-8044.251] (-8041.094) -- 0:04:00
      146000 -- (-8038.391) (-8046.108) [-8045.637] (-8041.251) * (-8039.474) (-8043.768) (-8048.107) [-8040.048] -- 0:03:59
      146500 -- (-8040.136) (-8039.384) (-8043.767) [-8046.610] * (-8044.529) (-8041.928) [-8040.550] (-8038.781) -- 0:03:58
      147000 -- (-8039.910) [-8037.806] (-8040.710) (-8040.362) * (-8042.019) [-8039.260] (-8043.619) (-8045.478) -- 0:03:57
      147500 -- (-8033.510) (-8041.683) (-8042.052) [-8038.658] * (-8037.602) [-8036.298] (-8044.815) (-8043.773) -- 0:03:56
      148000 -- (-8041.580) (-8038.081) [-8042.212] (-8040.145) * (-8046.631) (-8041.080) (-8043.738) [-8042.553] -- 0:04:01
      148500 -- [-8044.337] (-8039.795) (-8045.137) (-8044.354) * (-8041.132) (-8039.267) (-8043.490) [-8042.718] -- 0:04:00
      149000 -- (-8046.143) [-8042.693] (-8042.829) (-8042.410) * [-8039.118] (-8037.795) (-8040.173) (-8048.642) -- 0:03:59
      149500 -- (-8043.643) (-8038.791) [-8036.929] (-8042.935) * (-8041.672) [-8039.946] (-8044.249) (-8054.146) -- 0:03:58
      150000 -- (-8035.938) [-8037.567] (-8036.966) (-8044.665) * (-8041.681) [-8039.552] (-8040.135) (-8042.907) -- 0:03:57

      Average standard deviation of split frequencies: 0.000000

      150500 -- [-8042.935] (-8046.093) (-8037.799) (-8038.662) * (-8038.714) (-8046.792) (-8038.957) [-8041.814] -- 0:03:57
      151000 -- (-8043.432) [-8041.858] (-8039.988) (-8043.455) * (-8039.822) (-8042.885) (-8041.678) [-8041.318] -- 0:03:56
      151500 -- (-8046.361) (-8041.493) [-8040.561] (-8047.299) * (-8038.516) (-8041.092) [-8036.422] (-8044.752) -- 0:04:00
      152000 -- (-8044.849) (-8043.893) [-8039.837] (-8049.388) * (-8039.395) (-8042.195) [-8037.829] (-8043.119) -- 0:03:59
      152500 -- (-8043.634) [-8042.231] (-8038.312) (-8047.505) * (-8040.051) (-8046.277) [-8044.147] (-8041.552) -- 0:03:58
      153000 -- (-8036.155) (-8044.757) (-8038.352) [-8039.340] * (-8042.250) [-8043.632] (-8041.848) (-8036.909) -- 0:03:58
      153500 -- [-8041.795] (-8040.465) (-8048.534) (-8042.695) * (-8036.634) (-8035.136) [-8038.564] (-8042.471) -- 0:03:57
      154000 -- (-8043.165) [-8040.528] (-8039.934) (-8040.369) * (-8045.822) [-8040.130] (-8041.617) (-8038.621) -- 0:03:56
      154500 -- [-8041.545] (-8044.408) (-8049.585) (-8044.604) * (-8038.815) (-8037.060) (-8046.179) [-8037.598] -- 0:03:55
      155000 -- (-8039.130) (-8039.221) [-8042.429] (-8040.898) * [-8040.939] (-8042.956) (-8049.842) (-8038.413) -- 0:03:59

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-8037.235) (-8041.042) [-8035.997] (-8038.053) * [-8037.443] (-8040.769) (-8041.973) (-8043.034) -- 0:03:58
      156000 -- (-8043.066) (-8040.333) (-8037.995) [-8041.997] * [-8043.143] (-8039.916) (-8036.497) (-8043.232) -- 0:03:58
      156500 -- (-8040.557) [-8044.493] (-8039.673) (-8044.029) * (-8036.817) (-8040.930) (-8038.802) [-8039.757] -- 0:03:57
      157000 -- (-8042.170) (-8035.515) (-8044.927) [-8042.081] * (-8042.035) (-8040.949) [-8040.261] (-8045.199) -- 0:03:56
      157500 -- (-8045.550) (-8044.174) (-8046.225) [-8039.716] * [-8043.631] (-8039.044) (-8039.218) (-8038.146) -- 0:03:55
      158000 -- (-8045.417) (-8045.223) (-8039.400) [-8040.905] * (-8042.841) (-8040.471) (-8036.571) [-8048.174] -- 0:03:54
      158500 -- (-8043.188) (-8042.751) (-8043.799) [-8037.035] * [-8046.355] (-8044.073) (-8039.825) (-8045.353) -- 0:03:58
      159000 -- (-8050.609) (-8043.005) [-8041.142] (-8040.450) * (-8036.815) (-8045.103) [-8044.817] (-8039.520) -- 0:03:58
      159500 -- [-8043.115] (-8038.029) (-8049.307) (-8036.335) * (-8036.685) (-8037.518) (-8044.796) [-8037.147] -- 0:03:57
      160000 -- (-8046.300) (-8043.512) (-8041.923) [-8035.202] * (-8044.294) (-8041.664) (-8041.177) [-8039.634] -- 0:03:56

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-8050.424) (-8041.467) [-8040.722] (-8040.229) * (-8044.510) (-8042.822) [-8042.327] (-8036.624) -- 0:03:55
      161000 -- (-8051.749) (-8040.957) (-8041.696) [-8036.949] * [-8039.914] (-8039.681) (-8040.797) (-8041.552) -- 0:03:54
      161500 -- (-8046.984) (-8036.786) (-8039.413) [-8038.190] * [-8036.606] (-8038.347) (-8042.006) (-8033.853) -- 0:03:53
      162000 -- [-8041.787] (-8038.919) (-8048.485) (-8035.355) * (-8044.788) [-8041.704] (-8037.112) (-8040.388) -- 0:03:57
      162500 -- (-8043.994) [-8047.061] (-8044.784) (-8040.807) * [-8053.299] (-8045.651) (-8042.782) (-8043.523) -- 0:03:57
      163000 -- (-8048.871) [-8040.868] (-8043.588) (-8045.923) * (-8041.104) (-8044.810) [-8040.155] (-8044.632) -- 0:03:56
      163500 -- (-8040.443) (-8041.735) [-8035.217] (-8042.764) * [-8043.270] (-8041.839) (-8039.418) (-8039.620) -- 0:03:55
      164000 -- (-8044.055) (-8043.818) [-8041.709] (-8047.584) * [-8043.108] (-8043.662) (-8044.321) (-8040.961) -- 0:03:54
      164500 -- (-8040.125) (-8040.172) (-8051.221) [-8040.402] * (-8038.624) (-8039.307) (-8035.922) [-8037.262] -- 0:03:53
      165000 -- (-8041.322) [-8039.310] (-8048.348) (-8040.362) * [-8038.623] (-8043.854) (-8036.216) (-8049.548) -- 0:03:52

      Average standard deviation of split frequencies: 0.000000

      165500 -- (-8046.180) (-8042.804) [-8041.518] (-8048.582) * [-8038.460] (-8044.056) (-8034.441) (-8042.328) -- 0:03:51
      166000 -- [-8040.205] (-8040.275) (-8044.002) (-8043.807) * (-8040.353) (-8038.093) [-8037.746] (-8044.349) -- 0:03:56
      166500 -- (-8037.053) (-8039.510) [-8035.531] (-8044.630) * (-8043.184) (-8040.897) (-8040.134) [-8041.269] -- 0:03:55
      167000 -- (-8043.429) [-8041.908] (-8040.820) (-8039.711) * (-8044.390) (-8038.518) (-8040.233) [-8043.564] -- 0:03:54
      167500 -- (-8043.200) (-8040.701) (-8039.737) [-8035.963] * (-8036.801) [-8042.847] (-8035.799) (-8039.081) -- 0:03:53
      168000 -- (-8040.463) (-8042.834) [-8044.597] (-8039.443) * (-8038.206) [-8045.200] (-8046.393) (-8046.914) -- 0:03:52
      168500 -- (-8039.903) [-8039.904] (-8040.071) (-8044.920) * [-8041.795] (-8040.528) (-8044.092) (-8038.151) -- 0:03:51
      169000 -- (-8040.325) (-8037.015) (-8039.129) [-8042.514] * [-8042.274] (-8043.733) (-8041.595) (-8037.169) -- 0:03:51
      169500 -- (-8044.769) (-8041.849) (-8041.628) [-8037.915] * (-8040.798) [-8043.264] (-8042.905) (-8038.226) -- 0:03:55
      170000 -- (-8043.229) (-8037.807) (-8042.575) [-8046.074] * [-8040.641] (-8038.626) (-8039.525) (-8046.995) -- 0:03:54

      Average standard deviation of split frequencies: 0.000000

      170500 -- [-8039.163] (-8044.831) (-8038.805) (-8041.407) * (-8041.324) [-8042.148] (-8043.242) (-8045.200) -- 0:03:53
      171000 -- (-8046.727) (-8038.080) [-8038.136] (-8044.873) * (-8041.669) [-8039.603] (-8038.284) (-8045.236) -- 0:03:52
      171500 -- (-8039.938) [-8039.750] (-8038.708) (-8042.881) * [-8041.684] (-8044.603) (-8040.766) (-8041.939) -- 0:03:51
      172000 -- [-8041.331] (-8041.624) (-8034.305) (-8036.761) * (-8039.897) (-8041.667) (-8043.122) [-8041.863] -- 0:03:51
      172500 -- [-8050.556] (-8042.842) (-8039.562) (-8039.203) * [-8040.113] (-8046.820) (-8041.783) (-8039.530) -- 0:03:50
      173000 -- [-8043.360] (-8044.012) (-8036.888) (-8041.169) * (-8040.713) (-8040.364) (-8042.326) [-8039.879] -- 0:03:54
      173500 -- [-8039.339] (-8043.022) (-8044.480) (-8049.479) * (-8038.233) (-8043.375) [-8045.271] (-8048.377) -- 0:03:53
      174000 -- [-8037.459] (-8037.899) (-8045.764) (-8048.664) * (-8039.015) (-8040.272) (-8044.365) [-8037.807] -- 0:03:52
      174500 -- [-8050.191] (-8042.283) (-8040.316) (-8040.475) * (-8038.371) [-8037.350] (-8043.757) (-8045.638) -- 0:03:51
      175000 -- [-8043.174] (-8040.255) (-8043.889) (-8037.252) * (-8040.328) (-8043.854) [-8038.699] (-8042.029) -- 0:03:50

      Average standard deviation of split frequencies: 0.000000

      175500 -- (-8042.909) [-8044.795] (-8040.400) (-8039.519) * (-8039.899) (-8038.633) (-8037.800) [-8041.957] -- 0:03:50
      176000 -- (-8044.757) (-8041.218) [-8039.526] (-8041.637) * (-8042.558) (-8036.252) (-8042.550) [-8038.799] -- 0:03:49
      176500 -- (-8040.913) [-8040.501] (-8039.571) (-8037.434) * [-8040.497] (-8036.932) (-8042.711) (-8041.872) -- 0:03:53
      177000 -- [-8043.765] (-8043.376) (-8053.195) (-8043.685) * (-8040.345) [-8040.226] (-8042.097) (-8045.575) -- 0:03:52
      177500 -- (-8040.298) (-8040.507) [-8041.009] (-8042.280) * (-8036.771) (-8038.141) [-8036.998] (-8045.196) -- 0:03:51
      178000 -- (-8043.249) (-8043.718) [-8038.288] (-8044.508) * (-8042.545) (-8043.175) [-8041.616] (-8046.921) -- 0:03:50
      178500 -- (-8040.245) (-8042.095) [-8045.515] (-8050.185) * [-8047.511] (-8039.681) (-8040.976) (-8041.994) -- 0:03:50
      179000 -- [-8034.808] (-8048.575) (-8039.081) (-8038.091) * (-8042.988) (-8043.909) [-8041.414] (-8039.091) -- 0:03:49
      179500 -- [-8040.275] (-8039.994) (-8047.024) (-8047.367) * [-8042.025] (-8041.639) (-8041.464) (-8040.762) -- 0:03:48
      180000 -- (-8041.307) (-8047.318) [-8044.147] (-8054.563) * (-8046.574) (-8035.332) (-8039.639) [-8036.269] -- 0:03:52

      Average standard deviation of split frequencies: 0.000000

      180500 -- (-8038.985) (-8041.023) [-8039.685] (-8049.762) * (-8044.529) (-8037.353) [-8047.955] (-8039.396) -- 0:03:51
      181000 -- (-8045.213) (-8035.804) (-8042.885) [-8049.741] * [-8040.416] (-8035.626) (-8045.997) (-8047.918) -- 0:03:50
      181500 -- (-8038.123) (-8041.369) [-8044.322] (-8044.378) * (-8037.712) [-8040.737] (-8046.802) (-8036.998) -- 0:03:49
      182000 -- (-8041.185) (-8042.118) [-8040.747] (-8045.076) * (-8044.898) [-8037.091] (-8039.491) (-8040.577) -- 0:03:49
      182500 -- (-8045.020) [-8042.496] (-8043.490) (-8040.698) * (-8040.798) (-8038.294) (-8043.069) [-8037.930] -- 0:03:48
      183000 -- (-8046.133) [-8038.122] (-8041.800) (-8039.627) * (-8041.538) [-8043.793] (-8041.079) (-8041.222) -- 0:03:47
      183500 -- [-8041.194] (-8046.683) (-8039.557) (-8037.753) * (-8039.785) (-8037.451) [-8038.646] (-8044.027) -- 0:03:51
      184000 -- (-8046.237) (-8045.131) [-8039.256] (-8035.317) * (-8046.269) [-8037.307] (-8045.621) (-8042.121) -- 0:03:50
      184500 -- [-8042.640] (-8047.940) (-8045.654) (-8043.872) * (-8041.986) (-8044.869) (-8047.433) [-8044.063] -- 0:03:49
      185000 -- (-8039.250) (-8050.426) (-8040.077) [-8041.163] * [-8037.614] (-8037.739) (-8041.973) (-8046.925) -- 0:03:49

      Average standard deviation of split frequencies: 0.000000

      185500 -- [-8041.061] (-8039.339) (-8040.887) (-8043.727) * [-8042.386] (-8044.413) (-8044.048) (-8044.132) -- 0:03:48
      186000 -- (-8036.660) [-8039.443] (-8043.630) (-8038.176) * (-8035.721) (-8037.778) (-8040.099) [-8036.690] -- 0:03:47
      186500 -- (-8038.851) [-8039.188] (-8040.335) (-8038.851) * (-8039.304) (-8051.402) [-8038.572] (-8038.227) -- 0:03:46
      187000 -- (-8043.902) (-8042.002) (-8037.536) [-8041.300] * [-8041.006] (-8040.124) (-8038.475) (-8043.538) -- 0:03:46
      187500 -- [-8038.347] (-8043.242) (-8036.952) (-8040.751) * [-8039.528] (-8039.125) (-8037.367) (-8044.956) -- 0:03:49
      188000 -- (-8039.861) [-8044.930] (-8041.682) (-8041.607) * (-8043.018) [-8040.097] (-8040.837) (-8037.243) -- 0:03:48
      188500 -- (-8041.199) (-8045.314) (-8048.686) [-8041.742] * (-8048.189) [-8042.527] (-8044.931) (-8040.200) -- 0:03:48
      189000 -- (-8044.315) [-8042.077] (-8037.891) (-8043.989) * (-8038.010) (-8048.913) (-8036.678) [-8036.411] -- 0:03:47
      189500 -- (-8041.956) (-8041.347) (-8035.911) [-8036.894] * (-8038.732) (-8038.474) [-8045.245] (-8045.502) -- 0:03:46
      190000 -- [-8038.341] (-8038.340) (-8042.704) (-8040.224) * (-8036.976) [-8039.297] (-8037.222) (-8052.181) -- 0:03:45

      Average standard deviation of split frequencies: 0.000000

      190500 -- (-8042.028) (-8041.721) (-8040.480) [-8037.608] * (-8042.324) [-8039.334] (-8039.385) (-8044.826) -- 0:03:45
      191000 -- (-8051.676) [-8038.102] (-8054.536) (-8045.931) * (-8041.202) [-8039.349] (-8036.415) (-8042.680) -- 0:03:48
      191500 -- (-8048.624) (-8043.931) [-8032.498] (-8044.527) * [-8041.631] (-8040.491) (-8038.918) (-8043.480) -- 0:03:47
      192000 -- (-8043.058) (-8040.584) [-8039.673] (-8044.152) * (-8038.651) (-8044.389) (-8038.558) [-8040.312] -- 0:03:47
      192500 -- (-8039.604) [-8047.044] (-8036.143) (-8035.947) * (-8042.707) [-8046.651] (-8035.773) (-8033.973) -- 0:03:46
      193000 -- (-8040.753) (-8038.735) [-8041.430] (-8038.812) * [-8042.668] (-8044.970) (-8050.113) (-8038.278) -- 0:03:45
      193500 -- (-8037.567) (-8042.326) [-8036.813] (-8042.549) * (-8039.323) (-8042.505) [-8038.111] (-8038.976) -- 0:03:45
      194000 -- (-8042.335) (-8039.202) (-8042.558) [-8043.871] * (-8041.924) [-8050.871] (-8037.879) (-8040.189) -- 0:03:44
      194500 -- [-8034.563] (-8041.149) (-8039.119) (-8040.217) * (-8046.346) (-8045.938) (-8043.994) [-8040.087] -- 0:03:47
      195000 -- (-8041.103) [-8041.778] (-8039.776) (-8039.835) * (-8045.711) [-8038.602] (-8036.615) (-8043.113) -- 0:03:47

      Average standard deviation of split frequencies: 0.000000

      195500 -- (-8043.249) (-8043.416) [-8037.454] (-8049.472) * (-8051.717) [-8040.918] (-8046.837) (-8043.462) -- 0:03:46
      196000 -- (-8041.888) (-8037.463) [-8035.789] (-8045.620) * (-8038.727) (-8036.096) (-8045.600) [-8038.958] -- 0:03:45
      196500 -- [-8044.317] (-8040.516) (-8046.598) (-8045.792) * (-8042.751) (-8038.278) [-8041.599] (-8039.957) -- 0:03:44
      197000 -- [-8043.918] (-8039.450) (-8039.576) (-8043.591) * [-8035.628] (-8043.548) (-8039.190) (-8036.472) -- 0:03:44
      197500 -- (-8041.995) (-8047.959) (-8046.646) [-8039.077] * [-8041.310] (-8038.446) (-8044.843) (-8043.903) -- 0:03:43
      198000 -- (-8043.525) (-8039.133) [-8038.444] (-8037.429) * (-8039.997) (-8038.315) (-8044.079) [-8044.580] -- 0:03:46
      198500 -- (-8047.183) (-8041.160) [-8039.088] (-8038.375) * [-8038.933] (-8037.175) (-8047.559) (-8044.048) -- 0:03:46
      199000 -- (-8044.534) (-8039.565) (-8039.808) [-8041.294] * [-8037.014] (-8039.149) (-8047.079) (-8049.826) -- 0:03:45
      199500 -- (-8039.611) (-8034.896) (-8043.044) [-8040.645] * (-8040.941) (-8037.879) [-8036.708] (-8037.985) -- 0:03:44
      200000 -- (-8037.954) [-8038.617] (-8040.970) (-8044.536) * [-8045.290] (-8041.888) (-8036.395) (-8041.450) -- 0:03:43

      Average standard deviation of split frequencies: 0.000000

      200500 -- [-8038.358] (-8039.329) (-8036.818) (-8045.876) * [-8043.776] (-8036.785) (-8039.333) (-8040.905) -- 0:03:43
      201000 -- (-8041.579) (-8041.150) [-8036.402] (-8038.778) * [-8045.523] (-8040.259) (-8037.121) (-8042.124) -- 0:03:42
      201500 -- [-8039.912] (-8038.468) (-8043.652) (-8042.750) * (-8041.098) (-8044.381) [-8044.184] (-8043.355) -- 0:03:41
      202000 -- (-8040.587) (-8038.651) [-8038.578] (-8038.600) * (-8040.338) (-8041.793) (-8039.715) [-8036.839] -- 0:03:45
      202500 -- (-8037.742) (-8042.108) [-8043.400] (-8039.492) * (-8041.247) (-8047.361) (-8038.428) [-8042.004] -- 0:03:44
      203000 -- (-8040.271) (-8042.216) [-8043.631] (-8042.038) * (-8045.752) (-8042.255) (-8046.898) [-8040.464] -- 0:03:43
      203500 -- (-8048.862) (-8041.963) [-8041.817] (-8038.892) * [-8041.228] (-8036.883) (-8041.166) (-8041.032) -- 0:03:43
      204000 -- (-8043.131) [-8039.556] (-8039.091) (-8036.993) * [-8041.228] (-8041.166) (-8040.344) (-8041.543) -- 0:03:42
      204500 -- (-8044.071) (-8039.600) (-8038.710) [-8040.852] * (-8044.203) (-8046.427) [-8039.175] (-8050.468) -- 0:03:41
      205000 -- (-8049.856) (-8038.834) (-8046.525) [-8037.886] * (-8043.524) [-8040.404] (-8042.671) (-8040.068) -- 0:03:41

      Average standard deviation of split frequencies: 0.000000

      205500 -- (-8043.116) [-8040.029] (-8038.104) (-8041.464) * (-8040.667) [-8035.776] (-8042.593) (-8050.891) -- 0:03:44
      206000 -- [-8036.132] (-8039.856) (-8051.620) (-8040.520) * (-8041.334) (-8037.804) [-8040.862] (-8039.629) -- 0:03:43
      206500 -- [-8040.619] (-8044.083) (-8041.045) (-8045.708) * (-8035.362) [-8037.014] (-8039.486) (-8039.181) -- 0:03:42
      207000 -- (-8041.599) (-8040.493) (-8041.750) [-8038.963] * (-8039.689) (-8041.408) [-8040.309] (-8037.711) -- 0:03:42
      207500 -- (-8043.508) (-8041.299) [-8040.090] (-8041.650) * (-8041.661) [-8037.454] (-8038.245) (-8042.847) -- 0:03:41
      208000 -- (-8047.194) (-8039.752) (-8035.102) [-8045.465] * (-8042.083) (-8053.141) [-8039.754] (-8040.007) -- 0:03:40
      208500 -- (-8043.940) (-8037.576) [-8035.101] (-8047.713) * (-8044.778) (-8043.629) [-8045.098] (-8051.879) -- 0:03:40
      209000 -- (-8042.107) (-8041.504) [-8040.053] (-8046.160) * (-8042.323) [-8040.722] (-8051.714) (-8043.364) -- 0:03:43
      209500 -- [-8043.684] (-8036.840) (-8036.150) (-8039.606) * (-8042.432) (-8043.953) (-8041.905) [-8043.831] -- 0:03:42
      210000 -- (-8039.654) [-8036.009] (-8043.287) (-8043.305) * (-8045.124) (-8042.908) (-8043.888) [-8040.915] -- 0:03:41

      Average standard deviation of split frequencies: 0.000000

      210500 -- [-8047.676] (-8039.859) (-8043.763) (-8041.666) * (-8047.850) (-8037.914) (-8043.266) [-8041.714] -- 0:03:41
      211000 -- (-8040.213) [-8038.124] (-8040.475) (-8039.897) * (-8038.329) (-8044.246) (-8039.950) [-8035.153] -- 0:03:40
      211500 -- (-8038.386) [-8037.965] (-8042.879) (-8036.829) * (-8041.736) (-8039.694) [-8045.598] (-8041.184) -- 0:03:39
      212000 -- (-8042.625) (-8043.105) (-8042.704) [-8040.058] * (-8044.422) (-8042.583) [-8046.394] (-8043.790) -- 0:03:39
      212500 -- (-8041.474) (-8039.958) (-8047.563) [-8036.651] * [-8037.591] (-8050.177) (-8046.371) (-8039.940) -- 0:03:42
      213000 -- (-8036.344) [-8037.646] (-8040.829) (-8041.767) * (-8038.914) (-8049.641) [-8043.830] (-8046.625) -- 0:03:41
      213500 -- (-8048.375) (-8038.743) [-8041.260] (-8042.164) * [-8043.519] (-8040.143) (-8045.346) (-8037.788) -- 0:03:41
      214000 -- (-8043.660) (-8036.500) [-8044.896] (-8043.516) * (-8046.840) (-8043.062) [-8041.423] (-8044.173) -- 0:03:40
      214500 -- (-8048.082) [-8041.087] (-8056.103) (-8046.579) * (-8048.291) (-8042.621) [-8043.809] (-8043.469) -- 0:03:39
      215000 -- [-8048.961] (-8049.194) (-8043.762) (-8041.918) * (-8042.117) (-8037.904) (-8040.880) [-8040.838] -- 0:03:39

      Average standard deviation of split frequencies: 0.000000

      215500 -- (-8039.098) (-8050.058) (-8040.181) [-8040.687] * (-8046.004) (-8044.215) (-8035.161) [-8035.290] -- 0:03:38
      216000 -- (-8042.357) (-8040.391) (-8042.881) [-8041.617] * (-8041.787) [-8035.759] (-8038.793) (-8042.823) -- 0:03:41
      216500 -- (-8042.097) (-8039.862) (-8041.719) [-8041.840] * (-8043.525) [-8041.494] (-8038.984) (-8039.907) -- 0:03:40
      217000 -- (-8037.605) (-8040.471) (-8047.726) [-8038.230] * [-8036.703] (-8049.840) (-8041.372) (-8042.076) -- 0:03:40
      217500 -- (-8036.532) (-8040.209) [-8040.864] (-8038.154) * [-8038.422] (-8043.226) (-8040.882) (-8043.344) -- 0:03:39
      218000 -- (-8046.488) [-8045.711] (-8041.672) (-8040.514) * [-8041.443] (-8042.421) (-8039.779) (-8045.848) -- 0:03:38
      218500 -- (-8043.779) (-8043.633) (-8041.119) [-8039.176] * (-8041.081) [-8037.781] (-8044.845) (-8045.315) -- 0:03:38
      219000 -- (-8042.244) (-8045.985) (-8038.341) [-8042.137] * (-8037.859) [-8040.618] (-8040.863) (-8041.313) -- 0:03:37
      219500 -- (-8040.667) [-8047.125] (-8043.061) (-8039.661) * (-8041.961) [-8038.513] (-8041.840) (-8044.496) -- 0:03:36
      220000 -- (-8045.588) [-8038.116] (-8043.639) (-8037.017) * (-8047.134) [-8039.871] (-8038.041) (-8042.084) -- 0:03:39

      Average standard deviation of split frequencies: 0.000000

      220500 -- (-8042.069) (-8041.440) [-8039.114] (-8040.078) * (-8044.604) (-8039.749) [-8037.497] (-8041.542) -- 0:03:39
      221000 -- [-8042.654] (-8045.297) (-8043.724) (-8034.852) * (-8049.118) [-8043.856] (-8043.110) (-8039.178) -- 0:03:38
      221500 -- [-8039.819] (-8047.045) (-8049.524) (-8038.716) * (-8042.777) (-8041.735) [-8038.498] (-8039.902) -- 0:03:37
      222000 -- (-8035.711) (-8044.190) [-8037.780] (-8041.457) * (-8038.701) (-8043.032) [-8036.758] (-8044.814) -- 0:03:37
      222500 -- (-8037.139) (-8045.453) (-8043.922) [-8047.078] * [-8039.845] (-8039.208) (-8043.957) (-8040.267) -- 0:03:36
      223000 -- [-8040.304] (-8041.640) (-8049.509) (-8047.255) * (-8037.012) (-8040.756) (-8040.915) [-8039.910] -- 0:03:36
      223500 -- [-8038.255] (-8045.440) (-8047.481) (-8046.646) * (-8045.552) (-8038.679) (-8038.563) [-8040.980] -- 0:03:38
      224000 -- (-8043.063) [-8042.482] (-8041.164) (-8048.835) * [-8041.869] (-8044.298) (-8043.163) (-8042.064) -- 0:03:38
      224500 -- (-8045.325) [-8038.415] (-8043.817) (-8049.989) * [-8041.223] (-8039.139) (-8042.541) (-8044.238) -- 0:03:37
      225000 -- [-8041.274] (-8040.364) (-8038.637) (-8044.981) * (-8036.756) (-8041.455) (-8045.835) [-8036.208] -- 0:03:36

      Average standard deviation of split frequencies: 0.000000

      225500 -- (-8037.590) (-8037.925) [-8039.018] (-8038.462) * (-8044.845) (-8038.348) [-8039.501] (-8044.435) -- 0:03:36
      226000 -- (-8040.959) (-8038.082) [-8045.619] (-8035.627) * (-8038.684) [-8034.553] (-8039.465) (-8042.614) -- 0:03:35
      226500 -- [-8042.477] (-8040.369) (-8044.899) (-8036.208) * [-8038.311] (-8043.944) (-8042.659) (-8040.293) -- 0:03:35
      227000 -- (-8040.800) (-8036.300) (-8039.252) [-8047.561] * (-8040.041) (-8042.383) (-8049.364) [-8038.158] -- 0:03:37
      227500 -- (-8046.607) (-8036.648) [-8037.290] (-8044.443) * (-8038.288) (-8045.423) (-8041.516) [-8037.918] -- 0:03:37
      228000 -- (-8037.022) (-8045.444) [-8041.614] (-8041.147) * (-8036.078) (-8042.161) (-8046.417) [-8037.540] -- 0:03:36
      228500 -- (-8037.920) (-8043.566) (-8045.219) [-8036.103] * (-8045.895) [-8042.688] (-8044.966) (-8036.023) -- 0:03:36
      229000 -- [-8040.271] (-8040.380) (-8039.956) (-8043.656) * (-8038.052) (-8040.018) [-8042.867] (-8039.533) -- 0:03:35
      229500 -- (-8040.823) (-8041.361) (-8036.527) [-8038.642] * (-8040.405) (-8043.694) [-8043.752] (-8042.201) -- 0:03:34
      230000 -- [-8036.172] (-8057.100) (-8036.207) (-8040.468) * (-8043.852) (-8047.649) (-8040.681) [-8044.979] -- 0:03:34

      Average standard deviation of split frequencies: 0.000000

      230500 -- (-8053.457) [-8043.388] (-8035.146) (-8036.446) * (-8037.212) [-8042.877] (-8044.419) (-8039.586) -- 0:03:36
      231000 -- (-8047.373) [-8035.292] (-8042.762) (-8037.024) * (-8040.467) (-8041.204) [-8041.752] (-8038.461) -- 0:03:36
      231500 -- (-8045.086) [-8038.752] (-8039.105) (-8042.864) * (-8036.982) (-8044.951) (-8041.164) [-8039.463] -- 0:03:35
      232000 -- [-8042.996] (-8045.205) (-8037.410) (-8044.612) * (-8044.796) [-8036.965] (-8046.881) (-8039.378) -- 0:03:35
      232500 -- (-8038.171) (-8041.366) [-8038.261] (-8038.799) * (-8038.764) [-8044.971] (-8051.198) (-8038.379) -- 0:03:34
      233000 -- [-8038.062] (-8041.692) (-8042.147) (-8046.426) * (-8041.074) [-8041.535] (-8050.725) (-8040.187) -- 0:03:33
      233500 -- (-8041.319) [-8043.484] (-8044.565) (-8042.279) * (-8038.007) [-8040.806] (-8036.015) (-8038.048) -- 0:03:33
      234000 -- [-8037.261] (-8042.799) (-8041.980) (-8039.331) * (-8046.575) (-8037.225) (-8044.277) [-8039.218] -- 0:03:36
      234500 -- (-8037.091) [-8039.127] (-8049.460) (-8050.184) * (-8041.832) (-8039.104) (-8039.974) [-8039.759] -- 0:03:35
      235000 -- (-8039.808) (-8038.149) [-8040.321] (-8054.595) * (-8041.013) (-8040.186) (-8039.548) [-8040.272] -- 0:03:34

      Average standard deviation of split frequencies: 0.000000

      235500 -- (-8041.881) [-8042.279] (-8042.906) (-8040.043) * (-8045.223) (-8040.344) [-8037.390] (-8042.747) -- 0:03:34
      236000 -- [-8040.124] (-8047.337) (-8048.069) (-8038.508) * (-8044.385) (-8043.455) (-8040.717) [-8036.116] -- 0:03:33
      236500 -- (-8044.450) (-8037.340) (-8043.076) [-8036.167] * [-8039.987] (-8045.246) (-8035.355) (-8050.645) -- 0:03:33
      237000 -- (-8037.218) [-8040.167] (-8051.255) (-8038.194) * [-8042.302] (-8041.297) (-8041.564) (-8039.146) -- 0:03:32
      237500 -- (-8038.159) (-8039.475) (-8042.067) [-8036.123] * (-8043.250) (-8039.790) (-8037.344) [-8041.390] -- 0:03:35
      238000 -- (-8034.493) (-8040.182) [-8040.125] (-8038.743) * (-8040.404) (-8042.914) [-8042.018] (-8038.005) -- 0:03:34
      238500 -- (-8037.354) [-8046.106] (-8036.380) (-8041.415) * [-8036.059] (-8037.896) (-8044.385) (-8041.084) -- 0:03:33
      239000 -- (-8039.010) [-8036.280] (-8041.739) (-8046.069) * (-8041.640) [-8039.361] (-8041.778) (-8039.361) -- 0:03:33
      239500 -- (-8042.587) [-8042.535] (-8041.694) (-8042.917) * [-8040.648] (-8041.338) (-8038.115) (-8039.235) -- 0:03:32
      240000 -- (-8041.570) (-8039.223) [-8039.459] (-8044.606) * (-8042.442) [-8041.409] (-8038.818) (-8049.273) -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      240500 -- [-8046.325] (-8036.932) (-8038.621) (-8046.231) * (-8040.348) (-8036.791) (-8038.773) [-8041.220] -- 0:03:31
      241000 -- (-8039.876) [-8035.842] (-8036.137) (-8040.775) * [-8038.932] (-8041.221) (-8036.920) (-8038.477) -- 0:03:34
      241500 -- [-8040.234] (-8043.185) (-8037.810) (-8045.821) * (-8040.092) [-8040.792] (-8038.146) (-8039.478) -- 0:03:33
      242000 -- [-8036.937] (-8043.858) (-8038.828) (-8044.046) * (-8040.680) (-8039.333) [-8036.812] (-8049.854) -- 0:03:32
      242500 -- (-8041.200) (-8047.712) [-8042.878] (-8038.868) * (-8041.414) (-8042.226) (-8037.326) [-8044.958] -- 0:03:32
      243000 -- (-8047.891) [-8039.135] (-8047.138) (-8037.635) * (-8040.483) [-8041.796] (-8037.792) (-8050.916) -- 0:03:31
      243500 -- (-8046.316) (-8037.065) [-8036.552] (-8046.476) * [-8042.845] (-8039.549) (-8036.327) (-8042.574) -- 0:03:31
      244000 -- (-8043.900) (-8039.468) [-8041.658] (-8040.729) * [-8042.227] (-8045.575) (-8045.414) (-8046.631) -- 0:03:30
      244500 -- (-8041.644) [-8038.552] (-8046.747) (-8042.030) * (-8038.516) (-8046.039) (-8044.056) [-8043.496] -- 0:03:33
      245000 -- (-8044.744) [-8039.319] (-8043.873) (-8040.519) * (-8039.953) (-8044.114) [-8040.810] (-8042.276) -- 0:03:32

      Average standard deviation of split frequencies: 0.000000

      245500 -- [-8041.594] (-8035.972) (-8048.779) (-8042.799) * (-8042.739) (-8042.153) (-8044.568) [-8044.152] -- 0:03:32
      246000 -- (-8039.833) (-8040.682) [-8040.547] (-8045.504) * (-8044.413) (-8041.196) [-8036.595] (-8048.156) -- 0:03:31
      246500 -- (-8041.145) (-8038.083) (-8040.205) [-8040.231] * (-8039.534) [-8040.541] (-8041.411) (-8043.534) -- 0:03:30
      247000 -- [-8040.836] (-8041.489) (-8038.632) (-8038.690) * [-8040.622] (-8038.521) (-8039.306) (-8039.285) -- 0:03:30
      247500 -- (-8050.410) (-8048.579) [-8036.831] (-8042.254) * (-8053.090) (-8038.629) (-8042.838) [-8036.080] -- 0:03:29
      248000 -- (-8052.000) (-8043.161) (-8039.334) [-8040.087] * (-8043.244) [-8044.471] (-8037.756) (-8036.939) -- 0:03:29
      248500 -- (-8044.110) (-8042.851) [-8041.557] (-8036.749) * (-8049.287) [-8047.274] (-8036.905) (-8046.037) -- 0:03:31
      249000 -- (-8044.550) [-8042.089] (-8038.644) (-8037.698) * (-8041.528) [-8040.225] (-8039.916) (-8040.195) -- 0:03:31
      249500 -- (-8044.616) (-8037.817) (-8041.440) [-8037.884] * (-8039.840) (-8041.876) [-8038.659] (-8039.671) -- 0:03:30
      250000 -- [-8042.028] (-8037.443) (-8044.604) (-8036.058) * [-8038.589] (-8038.177) (-8041.749) (-8042.868) -- 0:03:29

      Average standard deviation of split frequencies: 0.000000

      250500 -- (-8045.858) (-8042.513) (-8040.842) [-8039.705] * (-8038.687) [-8044.290] (-8040.584) (-8044.421) -- 0:03:29
      251000 -- (-8044.603) (-8045.786) [-8037.722] (-8040.418) * (-8044.176) (-8046.086) [-8041.037] (-8046.898) -- 0:03:28
      251500 -- (-8039.784) [-8042.291] (-8036.954) (-8036.819) * [-8036.354] (-8044.555) (-8047.533) (-8041.302) -- 0:03:28
      252000 -- (-8046.827) (-8039.408) [-8038.762] (-8039.461) * [-8049.901] (-8037.216) (-8039.012) (-8040.949) -- 0:03:30
      252500 -- (-8044.432) (-8041.327) [-8039.240] (-8038.316) * (-8042.282) (-8042.015) (-8039.700) [-8040.549] -- 0:03:30
      253000 -- (-8040.983) (-8041.526) [-8039.350] (-8040.813) * (-8037.098) (-8045.594) (-8053.503) [-8037.807] -- 0:03:29
      253500 -- (-8036.850) [-8041.124] (-8041.669) (-8040.441) * (-8041.379) (-8039.232) (-8042.621) [-8040.609] -- 0:03:29
      254000 -- (-8042.203) (-8041.782) (-8047.196) [-8039.606] * (-8038.344) [-8040.039] (-8036.966) (-8045.780) -- 0:03:28
      254500 -- (-8042.773) [-8040.597] (-8041.856) (-8040.984) * [-8038.990] (-8036.464) (-8039.411) (-8041.213) -- 0:03:27
      255000 -- [-8040.735] (-8041.106) (-8037.232) (-8048.981) * (-8039.971) (-8044.584) (-8043.958) [-8045.100] -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      255500 -- (-8041.084) (-8044.506) [-8041.549] (-8039.995) * (-8041.127) [-8043.038] (-8048.147) (-8047.860) -- 0:03:29
      256000 -- (-8039.181) (-8038.627) [-8037.888] (-8041.850) * [-8040.337] (-8042.040) (-8042.220) (-8041.853) -- 0:03:29
      256500 -- (-8043.584) (-8035.114) (-8045.475) [-8048.157] * (-8039.460) (-8043.499) [-8039.802] (-8038.927) -- 0:03:28
      257000 -- [-8039.706] (-8040.616) (-8050.804) (-8040.810) * (-8040.077) (-8037.314) (-8042.681) [-8038.834] -- 0:03:28
      257500 -- [-8041.748] (-8042.300) (-8042.603) (-8043.048) * [-8041.861] (-8037.354) (-8037.119) (-8044.037) -- 0:03:27
      258000 -- (-8043.602) [-8039.872] (-8059.965) (-8041.807) * (-8039.594) [-8036.990] (-8040.524) (-8041.603) -- 0:03:27
      258500 -- [-8041.675] (-8037.943) (-8044.374) (-8041.383) * (-8041.980) (-8045.415) (-8046.208) [-8040.528] -- 0:03:26
      259000 -- (-8041.252) [-8038.909] (-8045.386) (-8046.866) * (-8044.254) (-8040.897) (-8050.965) [-8039.837] -- 0:03:28
      259500 -- (-8049.982) (-8054.021) (-8041.600) [-8041.941] * (-8041.596) [-8043.658] (-8044.295) (-8038.693) -- 0:03:28
      260000 -- (-8041.812) (-8043.285) [-8038.738] (-8045.858) * (-8043.274) [-8044.190] (-8043.041) (-8039.012) -- 0:03:27

      Average standard deviation of split frequencies: 0.000000

      260500 -- [-8041.876] (-8038.855) (-8044.271) (-8044.262) * (-8046.481) (-8037.617) (-8044.541) [-8039.773] -- 0:03:27
      261000 -- (-8044.585) [-8041.595] (-8046.287) (-8036.807) * (-8043.682) [-8042.191] (-8046.137) (-8035.998) -- 0:03:26
      261500 -- (-8039.771) [-8040.276] (-8042.315) (-8044.972) * [-8042.761] (-8038.783) (-8056.808) (-8042.530) -- 0:03:26
      262000 -- (-8042.736) (-8041.285) [-8037.316] (-8038.086) * (-8053.218) (-8044.948) [-8040.869] (-8043.295) -- 0:03:25
      262500 -- (-8041.715) (-8044.033) (-8040.272) [-8036.881] * (-8043.169) [-8042.206] (-8036.882) (-8043.565) -- 0:03:27
      263000 -- (-8042.740) (-8044.073) (-8044.309) [-8040.633] * (-8046.410) (-8040.983) (-8035.470) [-8040.965] -- 0:03:27
      263500 -- [-8046.282] (-8040.988) (-8041.917) (-8041.181) * [-8037.836] (-8043.573) (-8044.551) (-8051.770) -- 0:03:26
      264000 -- (-8046.655) (-8043.094) [-8041.936] (-8038.477) * [-8042.634] (-8041.074) (-8039.506) (-8045.736) -- 0:03:26
      264500 -- (-8042.360) (-8041.726) [-8038.761] (-8038.954) * (-8040.505) [-8041.640] (-8042.054) (-8036.075) -- 0:03:25
      265000 -- [-8037.285] (-8047.344) (-8038.989) (-8041.554) * (-8046.923) [-8039.920] (-8039.242) (-8039.774) -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-8038.693) [-8035.974] (-8037.764) (-8038.204) * (-8045.056) (-8050.740) [-8040.396] (-8046.206) -- 0:03:24
      266000 -- (-8040.754) [-8039.254] (-8047.187) (-8045.769) * [-8039.081] (-8037.054) (-8043.721) (-8038.752) -- 0:03:26
      266500 -- [-8040.523] (-8039.742) (-8041.824) (-8039.259) * (-8039.594) (-8051.544) (-8037.623) [-8043.193] -- 0:03:26
      267000 -- (-8047.607) [-8037.753] (-8042.247) (-8039.896) * (-8038.092) (-8040.144) [-8038.341] (-8041.584) -- 0:03:25
      267500 -- (-8039.299) [-8038.293] (-8039.595) (-8039.289) * (-8041.255) (-8038.848) (-8047.415) [-8040.634] -- 0:03:25
      268000 -- (-8041.984) [-8035.485] (-8046.259) (-8037.347) * [-8036.004] (-8043.695) (-8042.313) (-8046.320) -- 0:03:24
      268500 -- (-8037.054) (-8039.388) [-8038.223] (-8042.401) * (-8038.402) (-8045.451) (-8041.137) [-8039.273] -- 0:03:24
      269000 -- [-8040.865] (-8040.423) (-8042.198) (-8039.916) * (-8038.162) (-8041.631) [-8042.450] (-8040.363) -- 0:03:23
      269500 -- (-8042.124) [-8037.482] (-8050.070) (-8043.638) * [-8041.281] (-8043.411) (-8045.594) (-8044.744) -- 0:03:26
      270000 -- (-8038.732) (-8043.362) (-8046.599) [-8036.995] * (-8048.424) [-8038.536] (-8036.566) (-8039.136) -- 0:03:25

      Average standard deviation of split frequencies: 0.000000

      270500 -- (-8035.500) (-8047.574) (-8045.200) [-8035.908] * (-8048.829) [-8037.358] (-8040.579) (-8046.195) -- 0:03:24
      271000 -- (-8036.424) (-8046.201) (-8040.371) [-8043.708] * [-8040.611] (-8040.223) (-8043.082) (-8042.229) -- 0:03:24
      271500 -- (-8037.413) (-8042.958) [-8041.949] (-8044.546) * [-8039.599] (-8046.402) (-8045.213) (-8042.973) -- 0:03:23
      272000 -- (-8040.122) [-8037.947] (-8043.914) (-8049.584) * (-8044.697) [-8038.946] (-8047.287) (-8042.114) -- 0:03:23
      272500 -- (-8036.003) [-8042.180] (-8037.391) (-8040.202) * (-8041.065) (-8041.351) (-8048.618) [-8041.246] -- 0:03:22
      273000 -- [-8038.555] (-8042.515) (-8038.579) (-8043.704) * (-8037.816) (-8044.547) [-8036.706] (-8040.483) -- 0:03:22
      273500 -- [-8039.744] (-8041.189) (-8045.629) (-8042.728) * (-8041.774) (-8039.005) [-8039.766] (-8039.994) -- 0:03:24
      274000 -- [-8039.524] (-8039.611) (-8050.090) (-8043.317) * (-8038.349) [-8038.070] (-8037.677) (-8040.017) -- 0:03:24
      274500 -- (-8042.665) [-8039.562] (-8038.315) (-8044.509) * (-8039.260) [-8035.097] (-8036.565) (-8038.930) -- 0:03:23
      275000 -- (-8047.862) (-8038.711) [-8037.471] (-8044.708) * (-8038.807) [-8039.476] (-8039.946) (-8040.052) -- 0:03:22

      Average standard deviation of split frequencies: 0.000000

      275500 -- [-8045.077] (-8038.675) (-8041.961) (-8045.816) * [-8038.798] (-8042.974) (-8040.489) (-8040.743) -- 0:03:22
      276000 -- (-8048.503) (-8038.483) (-8043.664) [-8045.206] * (-8042.732) (-8042.382) (-8041.158) [-8042.728] -- 0:03:21
      276500 -- [-8040.015] (-8040.159) (-8041.271) (-8041.372) * (-8038.457) (-8044.066) (-8041.291) [-8037.948] -- 0:03:21
      277000 -- (-8038.085) [-8043.025] (-8041.887) (-8040.156) * [-8042.075] (-8042.618) (-8042.084) (-8039.930) -- 0:03:23
      277500 -- (-8038.733) (-8037.646) [-8038.065] (-8047.522) * [-8041.081] (-8046.774) (-8038.266) (-8035.673) -- 0:03:23
      278000 -- [-8042.917] (-8042.697) (-8041.144) (-8041.724) * [-8038.265] (-8042.257) (-8049.105) (-8046.933) -- 0:03:22
      278500 -- (-8044.713) [-8035.788] (-8036.910) (-8048.368) * (-8043.316) [-8044.510] (-8038.231) (-8040.528) -- 0:03:22
      279000 -- (-8038.479) (-8048.727) [-8040.177] (-8045.905) * (-8051.496) (-8039.235) (-8037.785) [-8043.819] -- 0:03:21
      279500 -- (-8041.764) (-8038.407) (-8042.235) [-8041.402] * (-8043.942) (-8034.570) (-8044.309) [-8044.048] -- 0:03:21
      280000 -- (-8038.637) (-8043.691) [-8039.720] (-8038.298) * (-8040.038) (-8041.986) (-8036.628) [-8044.218] -- 0:03:20

      Average standard deviation of split frequencies: 0.000000

      280500 -- (-8039.566) (-8042.376) (-8046.614) [-8035.973] * (-8039.154) [-8037.101] (-8041.080) (-8045.703) -- 0:03:22
      281000 -- (-8044.153) [-8039.177] (-8041.663) (-8042.959) * (-8041.153) [-8050.877] (-8041.059) (-8047.162) -- 0:03:22
      281500 -- (-8050.502) (-8041.498) (-8042.104) [-8035.823] * (-8048.740) (-8038.144) [-8038.911] (-8049.809) -- 0:03:21
      282000 -- (-8048.387) (-8039.566) [-8038.439] (-8043.488) * (-8040.711) (-8039.035) [-8035.506] (-8045.247) -- 0:03:21
      282500 -- (-8042.614) (-8046.864) [-8043.081] (-8039.275) * (-8043.411) [-8036.796] (-8038.998) (-8038.319) -- 0:03:20
      283000 -- (-8044.221) [-8038.922] (-8039.397) (-8043.375) * (-8041.134) (-8045.367) [-8038.693] (-8052.832) -- 0:03:20
      283500 -- (-8045.803) [-8036.991] (-8043.083) (-8041.293) * (-8048.826) (-8044.240) (-8044.476) [-8043.674] -- 0:03:19
      284000 -- (-8043.332) (-8039.309) (-8041.202) [-8042.499] * (-8042.321) [-8038.669] (-8049.714) (-8044.346) -- 0:03:21
      284500 -- (-8041.040) (-8040.591) (-8039.746) [-8038.005] * (-8041.424) [-8037.947] (-8046.069) (-8037.800) -- 0:03:21
      285000 -- [-8037.966] (-8040.612) (-8040.073) (-8040.326) * (-8044.042) [-8041.527] (-8039.083) (-8037.421) -- 0:03:20

      Average standard deviation of split frequencies: 0.000000

      285500 -- (-8044.658) (-8041.219) [-8039.592] (-8045.530) * [-8048.532] (-8045.129) (-8041.623) (-8041.706) -- 0:03:20
      286000 -- [-8038.926] (-8043.586) (-8037.674) (-8039.338) * (-8042.306) (-8039.004) (-8045.946) [-8042.447] -- 0:03:19
      286500 -- (-8039.517) (-8038.670) (-8041.992) [-8036.725] * [-8039.838] (-8038.648) (-8043.522) (-8046.396) -- 0:03:19
      287000 -- (-8042.586) [-8039.348] (-8040.095) (-8041.877) * (-8041.372) (-8039.335) [-8042.188] (-8037.625) -- 0:03:18
      287500 -- (-8043.232) [-8045.274] (-8047.140) (-8042.445) * [-8040.138] (-8041.366) (-8044.743) (-8048.476) -- 0:03:20
      288000 -- (-8048.301) [-8042.454] (-8041.102) (-8041.253) * (-8046.598) (-8041.904) [-8044.079] (-8040.807) -- 0:03:20
      288500 -- (-8036.296) [-8040.483] (-8043.984) (-8048.528) * (-8043.918) (-8040.040) (-8037.463) [-8040.355] -- 0:03:19
      289000 -- (-8039.419) (-8040.065) (-8040.605) [-8045.237] * [-8042.614] (-8041.645) (-8046.111) (-8044.175) -- 0:03:19
      289500 -- (-8039.347) (-8040.053) (-8042.652) [-8040.298] * [-8038.644] (-8041.464) (-8038.710) (-8036.909) -- 0:03:18
      290000 -- (-8042.872) [-8040.929] (-8052.090) (-8040.618) * (-8039.154) [-8038.621] (-8039.402) (-8036.171) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      290500 -- (-8039.064) [-8036.369] (-8042.161) (-8043.990) * [-8036.471] (-8045.670) (-8037.590) (-8049.580) -- 0:03:17
      291000 -- (-8038.275) [-8036.471] (-8050.447) (-8044.041) * (-8036.948) (-8041.096) [-8035.820] (-8041.734) -- 0:03:19
      291500 -- [-8039.550] (-8039.900) (-8040.200) (-8038.466) * (-8035.457) [-8036.382] (-8038.066) (-8040.719) -- 0:03:19
      292000 -- (-8039.105) (-8040.640) (-8040.815) [-8040.790] * (-8041.013) (-8043.513) (-8050.989) [-8040.490] -- 0:03:18
      292500 -- (-8043.808) (-8044.907) (-8041.112) [-8039.013] * (-8040.555) [-8039.422] (-8039.390) (-8036.538) -- 0:03:18
      293000 -- (-8050.989) (-8040.873) (-8038.723) [-8040.329] * [-8036.705] (-8043.420) (-8035.474) (-8034.338) -- 0:03:17
      293500 -- (-8039.618) (-8040.339) (-8040.585) [-8041.452] * [-8038.410] (-8035.853) (-8040.591) (-8044.154) -- 0:03:17
      294000 -- (-8041.641) [-8035.428] (-8047.350) (-8040.717) * (-8039.830) (-8039.211) [-8035.793] (-8039.469) -- 0:03:16
      294500 -- (-8039.014) [-8037.031] (-8037.909) (-8037.186) * (-8045.004) (-8048.159) (-8042.734) [-8038.947] -- 0:03:16
      295000 -- (-8036.487) (-8039.658) [-8039.483] (-8044.767) * [-8040.956] (-8048.772) (-8041.387) (-8045.313) -- 0:03:18

      Average standard deviation of split frequencies: 0.000000

      295500 -- (-8038.078) [-8040.269] (-8041.701) (-8041.725) * (-8039.152) (-8044.853) (-8036.996) [-8040.035] -- 0:03:17
      296000 -- (-8042.375) (-8035.793) [-8039.414] (-8043.107) * (-8041.367) (-8043.656) [-8038.156] (-8041.554) -- 0:03:17
      296500 -- (-8039.980) (-8042.027) (-8039.584) [-8038.427] * [-8040.422] (-8044.899) (-8042.454) (-8037.719) -- 0:03:16
      297000 -- (-8040.194) [-8035.346] (-8042.720) (-8040.925) * (-8042.882) [-8039.943] (-8038.025) (-8039.070) -- 0:03:16
      297500 -- (-8043.256) (-8038.852) [-8045.794] (-8039.998) * (-8041.877) (-8048.112) (-8046.383) [-8040.785] -- 0:03:15
      298000 -- (-8041.746) (-8048.604) [-8040.277] (-8044.868) * (-8042.031) [-8048.483] (-8041.730) (-8039.502) -- 0:03:15
      298500 -- (-8040.547) [-8035.351] (-8042.858) (-8046.807) * (-8039.117) [-8041.608] (-8039.457) (-8042.764) -- 0:03:17
      299000 -- (-8037.310) [-8037.608] (-8040.184) (-8036.861) * [-8038.704] (-8039.061) (-8041.741) (-8043.341) -- 0:03:16
      299500 -- (-8035.936) (-8039.554) [-8036.512] (-8040.432) * (-8039.764) [-8043.401] (-8040.254) (-8041.101) -- 0:03:16
      300000 -- [-8040.995] (-8040.807) (-8044.271) (-8042.254) * [-8038.336] (-8042.021) (-8043.883) (-8038.124) -- 0:03:15

      Average standard deviation of split frequencies: 0.000000

      300500 -- (-8042.839) [-8037.780] (-8043.804) (-8042.656) * [-8046.932] (-8041.571) (-8039.502) (-8044.743) -- 0:03:15
      301000 -- (-8041.594) (-8040.146) (-8045.123) [-8041.095] * (-8046.192) (-8041.418) (-8039.568) [-8040.649] -- 0:03:15
      301500 -- (-8039.148) (-8041.915) [-8045.734] (-8045.024) * (-8050.655) (-8041.686) (-8039.877) [-8041.830] -- 0:03:14
      302000 -- [-8044.580] (-8047.535) (-8041.309) (-8042.161) * [-8038.133] (-8043.857) (-8046.656) (-8044.876) -- 0:03:16
      302500 -- (-8046.177) [-8043.829] (-8043.155) (-8042.134) * (-8040.758) (-8044.915) (-8043.035) [-8041.479] -- 0:03:15
      303000 -- (-8041.214) (-8040.069) [-8044.044] (-8038.515) * (-8043.668) (-8045.857) (-8042.252) [-8041.409] -- 0:03:15
      303500 -- (-8041.583) (-8043.358) (-8038.853) [-8037.866] * (-8043.833) [-8041.763] (-8038.131) (-8040.886) -- 0:03:15
      304000 -- [-8040.183] (-8049.967) (-8041.894) (-8039.554) * (-8046.353) (-8050.032) (-8041.384) [-8041.487] -- 0:03:14
      304500 -- (-8041.860) (-8045.538) [-8042.839] (-8046.305) * [-8037.212] (-8038.870) (-8040.127) (-8039.370) -- 0:03:14
      305000 -- (-8040.055) [-8037.709] (-8043.726) (-8035.819) * (-8040.553) (-8042.489) (-8039.307) [-8040.858] -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      305500 -- [-8038.357] (-8041.551) (-8040.879) (-8041.587) * (-8045.649) [-8038.166] (-8043.160) (-8041.906) -- 0:03:15
      306000 -- (-8038.466) (-8047.510) [-8044.811] (-8035.760) * (-8042.488) [-8036.086] (-8050.229) (-8042.407) -- 0:03:15
      306500 -- (-8039.314) (-8042.362) (-8046.265) [-8035.610] * (-8039.071) (-8037.218) (-8043.525) [-8040.641] -- 0:03:14
      307000 -- [-8038.673] (-8042.644) (-8037.977) (-8043.614) * (-8042.406) (-8042.507) (-8036.459) [-8042.984] -- 0:03:14
      307500 -- (-8047.301) (-8036.161) (-8043.445) [-8039.559] * (-8044.322) (-8044.996) (-8038.470) [-8042.372] -- 0:03:13
      308000 -- (-8040.257) (-8042.627) [-8044.674] (-8046.192) * (-8042.209) [-8045.801] (-8043.411) (-8041.247) -- 0:03:13
      308500 -- (-8039.888) (-8047.335) (-8044.117) [-8036.893] * (-8044.566) (-8048.675) [-8036.698] (-8040.195) -- 0:03:12
      309000 -- (-8040.344) (-8036.217) [-8045.730] (-8045.118) * (-8045.337) [-8037.316] (-8045.701) (-8045.049) -- 0:03:12
      309500 -- (-8037.619) [-8044.474] (-8042.833) (-8038.381) * (-8045.238) (-8039.879) [-8038.863] (-8046.951) -- 0:03:14
      310000 -- (-8041.924) (-8046.442) [-8041.017] (-8036.787) * (-8048.282) (-8040.265) (-8038.304) [-8038.682] -- 0:03:13

      Average standard deviation of split frequencies: 0.000000

      310500 -- (-8040.742) [-8038.595] (-8048.827) (-8038.218) * (-8044.889) (-8040.505) (-8038.947) [-8037.731] -- 0:03:13
      311000 -- (-8043.710) (-8037.471) (-8045.414) [-8038.444] * (-8046.095) [-8038.768] (-8044.207) (-8041.485) -- 0:03:12
      311500 -- (-8047.788) (-8037.639) [-8042.833] (-8040.261) * [-8047.544] (-8039.058) (-8043.270) (-8036.303) -- 0:03:12
      312000 -- [-8046.081] (-8039.822) (-8051.320) (-8039.335) * (-8043.828) (-8041.420) (-8051.202) [-8038.917] -- 0:03:11
      312500 -- [-8044.264] (-8040.846) (-8038.536) (-8035.809) * (-8052.814) (-8046.472) (-8045.466) [-8035.230] -- 0:03:11
      313000 -- (-8038.627) (-8037.540) [-8038.150] (-8038.585) * (-8045.443) (-8044.958) (-8041.792) [-8037.663] -- 0:03:13
      313500 -- (-8041.919) (-8045.055) [-8038.353] (-8043.899) * (-8041.252) (-8043.305) (-8042.669) [-8037.660] -- 0:03:12
      314000 -- (-8041.001) (-8042.126) (-8041.966) [-8045.150] * (-8050.599) (-8044.291) (-8042.429) [-8039.559] -- 0:03:12
      314500 -- [-8045.116] (-8042.952) (-8040.546) (-8039.329) * [-8045.421] (-8047.482) (-8049.376) (-8035.681) -- 0:03:11
      315000 -- (-8047.648) (-8045.115) (-8048.546) [-8042.371] * (-8040.081) (-8044.660) (-8043.466) [-8042.449] -- 0:03:11

      Average standard deviation of split frequencies: 0.000000

      315500 -- (-8043.178) (-8046.921) (-8044.855) [-8040.949] * (-8042.817) (-8043.213) [-8044.309] (-8039.219) -- 0:03:10
      316000 -- (-8044.595) [-8040.763] (-8051.419) (-8042.235) * (-8046.484) [-8040.322] (-8038.894) (-8043.698) -- 0:03:10
      316500 -- [-8038.106] (-8042.696) (-8044.251) (-8042.342) * (-8046.317) [-8042.117] (-8041.393) (-8040.812) -- 0:03:12
      317000 -- (-8038.315) (-8039.220) (-8037.003) [-8040.607] * (-8046.073) [-8042.383] (-8044.415) (-8044.703) -- 0:03:11
      317500 -- [-8038.829] (-8044.354) (-8037.453) (-8040.928) * (-8037.587) (-8044.780) [-8044.401] (-8053.925) -- 0:03:11
      318000 -- (-8040.624) (-8052.333) (-8044.162) [-8042.604] * (-8039.079) (-8037.580) [-8037.450] (-8043.577) -- 0:03:10
      318500 -- (-8037.732) [-8044.783] (-8037.753) (-8039.435) * [-8039.885] (-8040.689) (-8041.357) (-8046.190) -- 0:03:10
      319000 -- (-8036.386) (-8042.734) (-8041.885) [-8038.416] * (-8040.010) [-8039.635] (-8041.099) (-8046.372) -- 0:03:09
      319500 -- (-8038.853) [-8035.778] (-8039.149) (-8041.236) * (-8042.426) [-8046.509] (-8043.895) (-8050.238) -- 0:03:11
      320000 -- (-8046.187) (-8035.157) (-8051.269) [-8035.129] * [-8044.217] (-8043.189) (-8040.615) (-8046.677) -- 0:03:11

      Average standard deviation of split frequencies: 0.000000

      320500 -- (-8040.994) [-8040.988] (-8039.777) (-8046.900) * (-8046.686) [-8039.071] (-8039.953) (-8044.445) -- 0:03:10
      321000 -- (-8041.752) (-8038.602) [-8040.344] (-8040.852) * (-8048.560) (-8046.293) (-8043.067) [-8043.704] -- 0:03:10
      321500 -- (-8043.832) (-8041.809) (-8041.278) [-8041.139] * [-8046.237] (-8040.216) (-8043.238) (-8041.371) -- 0:03:09
      322000 -- (-8045.707) (-8049.000) (-8045.455) [-8038.668] * (-8041.346) [-8043.143] (-8038.566) (-8038.835) -- 0:03:09
      322500 -- (-8041.871) [-8041.468] (-8048.863) (-8044.641) * (-8041.519) (-8043.450) [-8042.192] (-8035.579) -- 0:03:09
      323000 -- (-8048.491) (-8046.684) [-8037.092] (-8038.922) * (-8045.071) (-8040.820) (-8040.682) [-8040.318] -- 0:03:10
      323500 -- [-8039.908] (-8036.957) (-8043.827) (-8039.828) * (-8040.749) [-8042.984] (-8043.768) (-8038.904) -- 0:03:10
      324000 -- [-8038.801] (-8042.667) (-8040.953) (-8046.403) * (-8039.324) (-8049.560) (-8043.169) [-8038.580] -- 0:03:09
      324500 -- (-8041.576) (-8047.090) (-8038.268) [-8043.537] * (-8041.514) (-8042.458) (-8047.404) [-8040.856] -- 0:03:09
      325000 -- [-8041.869] (-8039.290) (-8043.278) (-8040.034) * (-8045.171) (-8038.425) (-8038.573) [-8040.556] -- 0:03:08

      Average standard deviation of split frequencies: 0.000000

      325500 -- (-8037.796) [-8041.299] (-8039.540) (-8039.928) * (-8050.449) [-8038.761] (-8046.416) (-8043.521) -- 0:03:08
      326000 -- (-8038.678) (-8047.720) [-8042.823] (-8039.469) * [-8046.358] (-8040.511) (-8047.752) (-8047.457) -- 0:03:08
      326500 -- [-8038.390] (-8038.832) (-8039.618) (-8050.546) * (-8043.986) [-8038.378] (-8042.256) (-8043.370) -- 0:03:09
      327000 -- (-8041.367) (-8040.892) (-8040.431) [-8039.066] * (-8044.132) [-8037.215] (-8040.626) (-8038.340) -- 0:03:09
      327500 -- (-8040.258) [-8041.661] (-8037.201) (-8043.641) * (-8045.357) (-8036.935) [-8039.662] (-8040.909) -- 0:03:08
      328000 -- (-8040.709) (-8044.857) (-8038.178) [-8045.991] * (-8054.201) (-8042.863) (-8042.677) [-8043.003] -- 0:03:08
      328500 -- (-8047.415) (-8036.264) [-8038.674] (-8036.090) * (-8042.317) (-8037.043) [-8038.091] (-8046.791) -- 0:03:08
      329000 -- [-8040.729] (-8038.521) (-8043.219) (-8039.742) * [-8043.011] (-8040.852) (-8043.108) (-8039.288) -- 0:03:07
      329500 -- (-8045.476) [-8042.755] (-8039.849) (-8042.069) * (-8044.507) (-8043.954) (-8040.625) [-8035.149] -- 0:03:07
      330000 -- (-8041.539) (-8041.389) [-8041.389] (-8043.262) * (-8037.449) (-8046.993) (-8045.967) [-8038.101] -- 0:03:08

      Average standard deviation of split frequencies: 0.000000

      330500 -- (-8042.535) (-8044.150) (-8036.415) [-8041.658] * [-8040.985] (-8039.485) (-8043.786) (-8036.611) -- 0:03:08
      331000 -- [-8040.737] (-8039.659) (-8036.373) (-8035.367) * [-8040.753] (-8039.928) (-8050.433) (-8038.335) -- 0:03:07
      331500 -- (-8041.441) [-8037.770] (-8047.916) (-8046.062) * (-8040.625) [-8047.981] (-8040.296) (-8040.676) -- 0:03:07
      332000 -- (-8040.428) (-8038.016) (-8044.192) [-8039.237] * (-8039.342) [-8049.321] (-8045.806) (-8045.357) -- 0:03:07
      332500 -- (-8037.829) (-8043.004) (-8038.280) [-8041.420] * (-8040.831) (-8042.817) [-8040.583] (-8042.401) -- 0:03:06
      333000 -- [-8039.873] (-8042.650) (-8037.895) (-8038.614) * (-8040.658) [-8036.157] (-8041.450) (-8041.707) -- 0:03:06
      333500 -- (-8046.621) [-8038.332] (-8041.718) (-8039.812) * (-8038.455) [-8036.086] (-8042.866) (-8043.069) -- 0:03:07
      334000 -- (-8042.732) (-8045.262) [-8040.656] (-8035.636) * (-8038.607) (-8043.556) (-8039.565) [-8044.458] -- 0:03:07
      334500 -- (-8043.005) [-8039.754] (-8040.559) (-8041.442) * [-8040.055] (-8050.061) (-8038.609) (-8045.027) -- 0:03:07
      335000 -- (-8042.044) [-8042.068] (-8052.660) (-8039.065) * (-8038.421) (-8046.224) [-8037.814] (-8041.508) -- 0:03:06

      Average standard deviation of split frequencies: 0.000000

      335500 -- [-8043.271] (-8041.021) (-8044.722) (-8037.904) * [-8037.182] (-8039.380) (-8037.810) (-8039.135) -- 0:03:06
      336000 -- [-8046.196] (-8040.828) (-8046.158) (-8041.689) * [-8038.482] (-8041.289) (-8043.063) (-8041.733) -- 0:03:05
      336500 -- [-8036.665] (-8045.380) (-8042.468) (-8040.162) * (-8043.695) [-8038.896] (-8037.929) (-8041.660) -- 0:03:05
      337000 -- (-8039.245) (-8052.314) (-8047.754) [-8042.389] * [-8043.030] (-8042.999) (-8038.799) (-8044.249) -- 0:03:06
      337500 -- [-8039.186] (-8039.623) (-8045.116) (-8040.742) * (-8039.986) (-8045.643) (-8048.705) [-8040.071] -- 0:03:06
      338000 -- [-8038.995] (-8043.226) (-8043.630) (-8040.786) * [-8034.967] (-8044.319) (-8042.980) (-8045.385) -- 0:03:06
      338500 -- (-8041.852) [-8039.411] (-8041.337) (-8041.824) * [-8041.462] (-8037.970) (-8037.455) (-8045.115) -- 0:03:05
      339000 -- [-8042.772] (-8039.330) (-8037.128) (-8035.903) * (-8040.603) (-8040.669) (-8038.130) [-8041.886] -- 0:03:05
      339500 -- [-8039.545] (-8045.304) (-8041.339) (-8043.899) * (-8045.040) [-8034.910] (-8041.635) (-8040.435) -- 0:03:04
      340000 -- (-8040.087) (-8042.362) (-8038.777) [-8040.098] * [-8042.455] (-8042.378) (-8043.237) (-8038.936) -- 0:03:04

      Average standard deviation of split frequencies: 0.000000

      340500 -- [-8041.156] (-8042.880) (-8042.544) (-8046.459) * (-8038.665) [-8044.238] (-8042.686) (-8038.628) -- 0:03:05
      341000 -- [-8042.688] (-8038.361) (-8041.251) (-8048.627) * (-8039.637) (-8041.625) (-8039.575) [-8038.754] -- 0:03:05
      341500 -- (-8042.529) (-8040.045) (-8038.807) [-8042.879] * (-8043.025) (-8039.725) [-8036.410] (-8041.821) -- 0:03:05
      342000 -- (-8055.542) (-8046.754) [-8040.507] (-8037.240) * (-8040.122) (-8039.475) (-8039.444) [-8042.317] -- 0:03:04
      342500 -- (-8041.180) [-8042.273] (-8039.365) (-8042.509) * (-8036.356) (-8046.883) [-8039.229] (-8041.413) -- 0:03:04
      343000 -- (-8049.281) [-8041.742] (-8046.083) (-8038.598) * [-8046.977] (-8040.535) (-8038.972) (-8038.041) -- 0:03:03
      343500 -- (-8041.830) (-8036.880) [-8041.060] (-8048.239) * [-8039.357] (-8045.316) (-8042.617) (-8039.738) -- 0:03:03
      344000 -- (-8042.360) (-8037.088) [-8038.200] (-8042.746) * (-8043.504) (-8043.137) [-8043.349] (-8044.514) -- 0:03:04
      344500 -- [-8040.697] (-8041.662) (-8045.075) (-8045.554) * [-8045.678] (-8040.067) (-8051.801) (-8041.975) -- 0:03:04
      345000 -- (-8042.465) [-8041.535] (-8037.982) (-8042.470) * (-8048.564) [-8043.543] (-8054.259) (-8043.266) -- 0:03:04

      Average standard deviation of split frequencies: 0.000000

      345500 -- (-8045.314) [-8039.287] (-8047.150) (-8043.621) * (-8037.914) [-8040.079] (-8045.864) (-8040.789) -- 0:03:03
      346000 -- (-8045.195) (-8044.193) [-8042.659] (-8038.697) * (-8036.842) (-8039.511) [-8037.613] (-8046.439) -- 0:03:03
      346500 -- (-8045.253) (-8040.247) [-8037.404] (-8041.530) * (-8039.688) (-8048.741) [-8039.713] (-8041.774) -- 0:03:02
      347000 -- (-8038.481) (-8039.650) [-8039.988] (-8040.926) * [-8043.613] (-8046.320) (-8038.022) (-8050.413) -- 0:03:02
      347500 -- (-8039.691) (-8041.676) [-8040.299] (-8044.006) * (-8040.977) (-8037.782) [-8038.409] (-8042.663) -- 0:03:04
      348000 -- [-8037.498] (-8046.909) (-8040.224) (-8042.382) * (-8043.280) (-8036.754) (-8041.144) [-8039.910] -- 0:03:03
      348500 -- [-8035.330] (-8039.774) (-8044.027) (-8039.323) * [-8039.191] (-8047.194) (-8038.878) (-8043.519) -- 0:03:03
      349000 -- (-8039.747) (-8039.927) (-8041.853) [-8044.674] * [-8038.339] (-8036.573) (-8039.575) (-8043.689) -- 0:03:02
      349500 -- (-8046.737) (-8044.077) [-8039.509] (-8042.281) * (-8040.924) (-8046.505) (-8042.083) [-8039.199] -- 0:03:02
      350000 -- (-8043.590) [-8035.638] (-8047.173) (-8041.043) * (-8044.672) [-8035.798] (-8053.866) (-8044.041) -- 0:03:01

      Average standard deviation of split frequencies: 0.000000

      350500 -- (-8050.454) [-8041.605] (-8039.123) (-8041.893) * (-8038.986) [-8037.474] (-8044.391) (-8039.315) -- 0:03:01
      351000 -- (-8046.369) [-8042.858] (-8045.314) (-8037.172) * (-8044.796) (-8042.826) (-8039.551) [-8043.399] -- 0:03:03
      351500 -- (-8040.494) [-8036.401] (-8042.097) (-8046.964) * (-8041.717) (-8037.277) [-8048.778] (-8037.720) -- 0:03:02
      352000 -- (-8041.515) [-8040.821] (-8036.832) (-8041.797) * (-8042.057) [-8038.717] (-8037.403) (-8048.621) -- 0:03:02
      352500 -- (-8038.088) (-8040.316) [-8047.995] (-8041.263) * (-8037.929) (-8038.935) (-8037.512) [-8039.332] -- 0:03:01
      353000 -- [-8036.472] (-8039.576) (-8044.546) (-8048.260) * (-8042.459) (-8045.116) [-8042.639] (-8039.764) -- 0:03:01
      353500 -- (-8038.505) (-8044.055) (-8038.655) [-8041.186] * [-8039.059] (-8041.391) (-8043.638) (-8043.211) -- 0:03:01
      354000 -- [-8039.835] (-8045.558) (-8044.644) (-8038.851) * (-8038.859) (-8040.188) (-8044.486) [-8048.133] -- 0:03:00
      354500 -- [-8041.536] (-8039.769) (-8043.720) (-8045.059) * [-8037.631] (-8044.101) (-8047.190) (-8045.720) -- 0:03:02
      355000 -- (-8036.478) (-8039.369) (-8038.583) [-8040.745] * (-8044.408) [-8036.656] (-8040.540) (-8047.245) -- 0:03:01

      Average standard deviation of split frequencies: 0.000000

      355500 -- (-8045.822) (-8036.456) [-8037.893] (-8045.775) * (-8040.519) [-8035.004] (-8038.749) (-8042.506) -- 0:03:01
      356000 -- (-8040.857) (-8039.144) [-8039.654] (-8038.628) * [-8039.414] (-8