--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Wed Dec 07 12:28:34 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/408/SuUR-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/408/SuUR-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/408/SuUR-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/408/SuUR-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -7193.33         -7203.08
2      -7193.02         -7201.25
--------------------------------------
TOTAL    -7193.16         -7202.54
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/408/SuUR-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/408/SuUR-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/408/SuUR-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.301894    0.000304    0.267146    0.335857    0.301437   1146.20   1323.60    1.000
r(A<->C){all}   0.085057    0.000149    0.060970    0.108642    0.084722   1016.96   1139.59    1.000
r(A<->G){all}   0.296519    0.000534    0.254724    0.344019    0.296348    864.97   1068.20    1.000
r(A<->T){all}   0.118988    0.000268    0.087017    0.150341    0.118369   1229.12   1266.40    1.000
r(C<->G){all}   0.083621    0.000159    0.058985    0.107456    0.082927   1100.33   1129.56    1.000
r(C<->T){all}   0.301759    0.000592    0.256728    0.350271    0.301634    840.38   1031.78    1.001
r(G<->T){all}   0.114055    0.000277    0.082403    0.147154    0.113468    555.06    873.12    1.000
pi(A){all}      0.290570    0.000064    0.274874    0.306183    0.290551   1121.33   1127.83    1.001
pi(C){all}      0.261714    0.000059    0.246344    0.276240    0.261703   1134.31   1209.41    1.001
pi(G){all}      0.241103    0.000058    0.225797    0.255565    0.240932   1037.25   1127.92    1.000
pi(T){all}      0.206613    0.000051    0.192465    0.219895    0.206632   1146.67   1203.64    1.000
alpha{1,2}      0.113436    0.003984    0.000395    0.214540    0.113260    729.47    775.05    1.003
alpha{3}        2.142023    0.627377    0.929872    3.698447    2.002188    877.13   1050.24    1.000
pinvar{all}     0.174169    0.008301    0.010663    0.337456    0.169355    664.65    724.49    1.001
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-6863.661434
Model 2: PositiveSelection	-6860.760847
Model 0: one-ratio	-6899.785661
Model 3: discrete	-6860.760847
Model 7: beta	-6866.966389
Model 8: beta&w>1	-6860.777049


Model 0 vs 1	72.24845400000049

Model 2 vs 1	5.801174000000174

Model 8 vs 7	12.378679999999804

Additional information for M7 vs M8:
Naive Empirical Bayes (NEB) analysis
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_SuUR-PA)

            Pr(w>1)     post mean +- SE for w

    16 D      0.598         1.231
    18 A      0.728         1.469
   109 Q      0.597         1.229
   250 S      0.722         1.457
   289 D      0.549         1.142
   332 D      0.999**       1.965
   334 D      0.591         1.218
   361 S      0.802         1.605
   374 F      0.794         1.589
   375 S      0.630         1.289
   378 T      0.965*        1.903
   381 R      0.723         1.459
   394 D      0.995**       1.958
   395 N      0.992**       1.952
   423 V      0.781         1.567
   427 T      0.726         1.465
   454 L      0.975*        1.920
   489 S      0.982*        1.934
   496 S      0.598         1.231
   497 F      0.975*        1.921
   503 L      0.996**       1.960
   511 S      0.729         1.471
   524 V      0.724         1.461
   530 Q      0.998**       1.963
   535 V      0.960*        1.893
   554 K      0.940         1.858
   557 D      0.674         1.369
   566 N      0.558         1.158
   569 H      0.701         1.420
   638 Y      0.974*        1.919
   641 P      0.828         1.652
   675 V      0.593         1.221
   771 A      0.795         1.591
   790 E      0.964*        1.901
   791 S      0.777         1.558
   798 R      0.715         1.445
   882 G      0.756         1.521
   903 A      0.972*        1.915

Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_SuUR-PA)

            Pr(w>1)     post mean +- SE for w

   332 D      0.887         1.645 +- 0.531
   361 S      0.529         1.203 +- 0.705
   374 F      0.521         1.191 +- 0.705
   378 T      0.684         1.418 +- 0.648
   394 D      0.837         1.595 +- 0.570
   395 N      0.826         1.583 +- 0.583
   423 V      0.511         1.178 +- 0.706
   454 L      0.721         1.463 +- 0.636
   489 S      0.758         1.507 +- 0.622
   497 F      0.723         1.465 +- 0.635
   503 L      0.845         1.603 +- 0.563
   530 Q      0.858         1.617 +- 0.552
   535 V      0.669         1.400 +- 0.654
   554 K      0.612         1.325 +- 0.659
   638 Y      0.718         1.459 +- 0.637
   641 P      0.550         1.232 +- 0.701
   771 A      0.521         1.191 +- 0.704
   790 E      0.682         1.415 +- 0.649
   791 S      0.506         1.170 +- 0.704
   903 A      0.710         1.450 +- 0.641

>C1
MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGL
FEETDRLSEHSVDDVAMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSDD
CEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDEA
TDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIVT
PKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHRS
LDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKSKVGQEKKQKTVDVPAQG
TAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEYMQC
AQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIPLYK
DPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGLGLP
PAKRSANKSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQL
AKVNISVPKKKRDRSCLDILEQMFEPRQQQSAKTSPKVLPTLPLTQKDDA
ESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQSVRPS
QANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAKSTQAT
KLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSARSGGAS
GPTKRKRLELFKooo
>C2
MYHFVSEQTPELRLSEEALVTGHVTQYLKSFQLDAVRFVYDRLSKHEFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVKDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NNFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIEHNPAQQNKTGL
FEESDSVDDVAMSPLIFESSESDDEPLTVEPGADQNPVLVVSSDDCEIVT
PPNTPPNRTPSLNESPRTKSKKQYSKKMSPRKKADLTDSEEDDKAMDNMP
PKKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIVTPKTEP
SARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHRALDDVK
RSAPRRVKIGCTQKLRSSKRIVKQEPMSKAEQENKEKTVNEPAQETPKRK
PGRPRKCKTMTEDLGKTTTKPDSNSLPSTPQVLSGSSLSWEYMQCAQRIP
DNLDAIESPAFRVPFTPQQTPVLLTLPSTHNLLNDSEVVAIPLHKEQVET
VVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGLGLPPAKRS
ANKSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQHANVNI
SVPKKKRDRSCLDILEQMFEPRQQQSTKTSPKVLPTLPLTQKDDATPTIT
QRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQPSVRSSQANKI
TNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAKSTQATKLTRW
FGSVFGGVISQTSSVESVSAPSTPVNSSTSAAACQTRSARSGGASGPTKR
KRLELFKoooooooo
>C3
MYHFVSEQTPELRLSEETLVTSHVTQYLKSFQLDAVRFVYDRLSKREYCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTESPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKL
LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIENNPAQQNKTGL
FEESDSVDDVAMSPLIFESSESDDEPLTVEPGADQNPVLVVSSDDCEIVT
PPNTPPNRTPSLNESPKTKSKKKYNKQTSPRKKADLTDSEEDDEAMPPRK
RTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIVTPKTEPSVR
RKNVKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHRTLDDVKRNF
PRRVKIEGTQTPRSSKRKVKQEPKSKAEQEKKQKTVDKPAQETPKRKPGR
PKKCKTMTEDLGKTTTKPDSNPLPSTPQVLSGSSLSSEYMQCAQRIPDNL
DAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIPLHKDQVETVVI
NSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGLGLPPAKRSANK
SPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQHANVNISVP
KKKRDRSCLDILEQMFEPRQQQSTKTSPKVLPTLPLTQKDDATPTITQRR
RTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQPSVRPSQANKITNY
LIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAKSTQATKLTRWFGS
VFGGVGSQTSSVESVSAPSTPVNSSTSAAACQTRSARSGGASGPTKRKRL
ELFKooooooooooo
>C4
MYHFASEQTPELRLSAEALVTSHVTQYLKGFQLDGVRFVYDRLARREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
LPFVAPEQYKHNLNLWLSSKNSQSTLSGSEVCSTVASIDNNPAQQNEAVL
VEESDKLSEHSVDDVVAMSPLIFESSESDDEPITVEAPASENPVLVVSSD
DCEIVTPPNTPPNRMPILSESPRTKSKKKFTKKSSPSKKADLTDSEEDDE
ALTISPRKRTRAATVHFTPKTRRLNVRILRVSLDTLSTPPPSGATTAIVT
PKTEPSARRKYQKKRPVSPMDVGRPTTRGMQRLTRSAESKINSKYLKHHA
LDDAKRSLPRRIKAEGNQTPKSSKRIVKQEPKARPKPEQEKEPKTVDKPA
QETPKRKPGRPRKSKTVTETLEKSKTKPDSKPMPPTPQVLSGSSLSSEYM
QCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIPL
SKDPVETVVINSSHDESSPQDPSQSRRTKALKRKRKPEAPVNSSFGGGLG
LPPAKRSANKSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQFQQ
QHAKVNTPAPKKKRDRSCLDILEQMFEPREQQESAKTSPKVLPTLPLTQK
DDAAPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQQDQQSV
RPSQANKITKYLIGSGITQEKTQPSNGNRNSIVASLRKSPKSPKQSAKTT
QATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRSARSG
GASGPSKRKRLELFK
>C5
MYHFVSEQTPELRLSAETLVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGDRLEHQYKSFS
RFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
LPLVAPEQYKHNLNLWLASKNSQSTLSGSEVCSTVASIENNPPQQNETVL
VEESDRISEHSVDDVVAMSPLIFESSESDDEPITVDPVANENPVLVVSSD
DCEIVTPPNTPPNRTPLVNKSPRTKSKKKCSKKPSPCKEADLTDSEKDDE
GLTMPPRKSTRAATVHFTPKTRRLNVRLLRVSLDALSTPAPSGATTAIIT
PKTEPSARRKNRTKQPMDVGRPATRGMQRLTRSAESKINSKYLKHHVLDD
AKRNFPRRIKAEGNQTPKTSKRIVKQESKAKAKPEQKKKIKTVDKPAQET
PKRKPGRPRKCKTLTETLGKSKTKPNSKPLPPTPQVLSGSSLSSEYMQCA
QRIPDDLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIPLFKD
QVETVVINSSHDESSPQDPSQSRRTKALKRKRKPDAPVNSSFGGGLGLPQ
AKRSATNKSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQFQQQH
AKVTIPAPKKKRDRSCLDILEQMFEPRQQQSSKTSPKVLPTLPLIQKDDA
TTTFTQRRVTLLEDDFFEITNNGQFGSRMRLNASGEVSPVQQDQQSVRPT
QANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPKHGARTTQAT
KLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRTARSGGAT
GPTKRKRLELFKooo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=978 

C1              MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
C2              MYHFVSEQTPELRLSEEALVTGHVTQYLKSFQLDAVRFVYDRLSKHEFCI
C3              MYHFVSEQTPELRLSEETLVTSHVTQYLKSFQLDAVRFVYDRLSKREYCI
C4              MYHFASEQTPELRLSAEALVTSHVTQYLKGFQLDGVRFVYDRLARREFCI
C5              MYHFVSEQTPELRLSAETLVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
                ****.******:**: *:***.*******.****.********:::*:**

C1              LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
C2              LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
C3              LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
C4              LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
C5              LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
                **************************************************

C1              QVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
C2              QVYIIQGVKDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
C3              QVYIIQGVQDTTESPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
C4              QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
C5              QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
                ********:***:*************************************

C1              NSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFA
C2              NNFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
C3              NSFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
C4              NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGGRLEHQYKSFA
C5              NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGDRLEHQYKSFS
                *.**********************:****:*********.*********:

C1              SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
C2              SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
C3              SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKL
C4              SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
C5              RFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
                 ************************************************ 

C1              LPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGL
C2              LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIEHNPAQQNKTGL
C3              LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIENNPAQQNKTGL
C4              LPFVAPEQYKHNLNLWLSSKNSQSTLSGSEVCSTVASIDNNPAQQNEAVL
C5              LPLVAPEQYKHNLNLWLASKNSQSTLSGSEVCSTVASIENNPPQQNETVL
                **:**************:*******:***:****:***::**.***:: *

C1              FEETDRLSEHSVDDV-AMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSD
C2              FEESD-----SVDDV-AMSPLIFESSESDDEPLTVEPGADQNPVLVVSSD
C3              FEESD-----SVDDV-AMSPLIFESSESDDEPLTVEPGADQNPVLVVSSD
C4              VEESDKLSEHSVDDVVAMSPLIFESSESDDEPITVEAPASENPVLVVSSD
C5              VEESDRISEHSVDDVVAMSPLIFESSESDDEPITVDPVANENPVLVVSSD
                .**:*     ***** ******** *******:**:. *.:*********

C1              DCEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDE
C2              DCEIVTPPNTPPNRTPSLNESPRTKSKKQYSKKMSPRKKADLTDSEEDDK
C3              DCEIVTPPNTPPNRTPSLNESPKTKSKKKYNKQTSPRKKADLTDSEEDD-
C4              DCEIVTPPNTPPNRMPILSESPRTKSKKKFTKKSSPSKKADLTDSEEDDE
C5              DCEIVTPPNTPPNRTPLVNKSPRTKSKKKCSKKPSPCKEADLTDSEKDDE
                ********.** ** * :.:**:*****: .*: ** *:*******:** 

C1              ATDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIV
C2              AMDNMPPKKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIV
C3              --EAMPPRKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIV
C4              A-LTISPRKRTRAATVHFTPKTRRLNVRILRVSLDTLSTPPPSGATTAIV
C5              G-LTMPPRKSTRAATVHFTPKTRRLNVRLLRVSLDALSTPAPSGATTAII
                    :.*:* *******:**********:** *** ****.** :****:

C1              TPKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHR
C2              TPKTEPSARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHR
C3              TPKTEPSVRRKNVKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHR
C4              TPKTEPSARRKYQKKRPVSPMDVGRPTTRGMQRLTRSAESKINSKYLKHH
C5              TPKTEPSARRKNRTKQ---PMDVGRPATRGMQRLTRSAESKINSKYLKHH
                ******:.***  .*:   *:*****:************:*:*******:

C1              SLDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKS--KVGQEKKQKTVDVP
C2              ALDDVKRSAPRRVKIGCTQKLRSSKRIVKQEPMS--KAEQENKEKTVNEP
C3              TLDDVKRNFPRRVKIEGTQTPRSSKRKVKQEPKS--KAEQEKKQKTVDKP
C4              ALDDAKRSLPRRIKAEGNQTPKSSKRIVKQEPKARPKPEQEKEPKTVDKP
C5              VLDDAKRNFPRRIKAEGNQTPKTSKRIVKQESKAKAKPEQKKKIKTVDKP
                 ***.**. ***:*   .*. ::**: ****. :  *  *::: ***: *

C1              AQGTAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEY
C2              AQETPKRKPGRPRKCKTMTEDLGKTTTKPDSNSLPSTPQVLSGSSLSWEY
C3              AQETPKRKPGRPKKCKTMTEDLGKTTTKPDSNPLPSTPQVLSGSSLSSEY
C4              AQETPKRKPGRPRKSKTVTETLEKSKTKPDSKPMPPTPQVLSGSSLSSEY
C5              AQETPKRKPGRPRKCKTLTETLGKSKTKPNSKPLPPTPQVLSGSSLSSEY
                ** *.*******:*.:* ** * *:.***:*: :*.*********** **

C1              MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIP
C2              MQCAQRIPDNLDAIESPAFRVPFTPQQTPVLLTLPSTHNLLNDSEVVAIP
C3              MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
C4              MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
C5              MQCAQRIPDDLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
                *********:*******************:*****************:**

C1              LYKDPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
C2              LHKEQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
C3              LHKDQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
C4              LSKDPVETVVINSSHDESSPQDPSQSRRTKALKRKRKPEAPVNSSFGGGL
C5              LFKDQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPDAPVNSSFGGGL
                * *: ************.******************** :.*********

C1              GLPPAKRSAN-KSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQF
C2              GLPPAKRSAN-KSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQF
C3              GLPPAKRSAN-KSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQF
C4              GLPPAKRSAN-KSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQF
C5              GLPQAKRSATNKSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQF
                *** *****. **********: ***************************

C1              QQQLAKVNISVPKKKRDRSCLDILEQMFEPR-QQQSAKTSPKVLPTLPLT
C2              QQQHANVNISVPKKKRDRSCLDILEQMFEPR-QQQSTKTSPKVLPTLPLT
C3              QQQHANVNISVPKKKRDRSCLDILEQMFEPR-QQQSTKTSPKVLPTLPLT
C4              QQQHAKVNTPAPKKKRDRSCLDILEQMFEPREQQESAKTSPKVLPTLPLT
C5              QQQHAKVTIPAPKKKRDRSCLDILEQMFEPR-QQQSSKTSPKVLPTLPLI
                *** *:*. ..******************** **:*:************ 

C1              QKDDAESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQ
C2              QKDDATPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQP
C3              QKDDATPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQP
C4              QKDDAAPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQQDQQ
C5              QKDDATTTFTQRRVTLLEDDFFEITNNGQFGSRMRLNASGEVSPVQQDQQ
                ***** .*:**** ***********************:******** ** 

C1              SVRPSQANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAK
C2              SVRSSQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAK
C3              SVRPSQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAK
C4              SVRPSQANKITKYLIGSGITQEKTQPSNGNRNSIVASLRKSPKSPKQSAK
C5              SVRPTQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPKHGAR
                ***.:******:**********:***********:**********::.*:

C1              STQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSAR
C2              STQATKLTRWFGSVFGGVISQTSSVESVSAPSTPVNSSTSAAACQTRSAR
C3              STQATKLTRWFGSVFGGVGSQTSSVESVSAPSTPVNSSTSAAACQTRSAR
C4              TTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRSAR
C5              TTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRTAR
                :****************  *****************.**********:**

C1              SGGASGPTKRKRLELFKooo--------
C2              SGGASGPTKRKRLELFKoooooooo---
C3              SGGASGPTKRKRLELFKooooooooooo
C4              SGGASGPSKRKRLELFK-----------
C5              SGGATGPTKRKRLELFKooo--------
                ****:**:*********           




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alngins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 gins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  965 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  965 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [20296]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [20296]--->[19963]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/408/SuUR-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.445 Mb, Max= 31.216 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGL
FEETDRLSEHSVDDV-AMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSD
DCEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDE
ATDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIV
TPKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHR
SLDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKS--KVGQEKKQKTVDVP
AQGTAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIP
LYKDPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSAN-KSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQLAKVNISVPKKKRDRSCLDILEQMFEPR-QQQSAKTSPKVLPTLPLT
QKDDAESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQ
SVRPSQANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAK
STQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFKooo--------
>C2
MYHFVSEQTPELRLSEEALVTGHVTQYLKSFQLDAVRFVYDRLSKHEFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVKDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NNFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIEHNPAQQNKTGL
FEESD-----SVDDV-AMSPLIFESSESDDEPLTVEPGADQNPVLVVSSD
DCEIVTPPNTPPNRTPSLNESPRTKSKKQYSKKMSPRKKADLTDSEEDDK
AMDNMPPKKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIV
TPKTEPSARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHR
ALDDVKRSAPRRVKIGCTQKLRSSKRIVKQEPMS--KAEQENKEKTVNEP
AQETPKRKPGRPRKCKTMTEDLGKTTTKPDSNSLPSTPQVLSGSSLSWEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPVLLTLPSTHNLLNDSEVVAIP
LHKEQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSAN-KSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHANVNISVPKKKRDRSCLDILEQMFEPR-QQQSTKTSPKVLPTLPLT
QKDDATPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQP
SVRSSQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAK
STQATKLTRWFGSVFGGVISQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFKoooooooo---
>C3
MYHFVSEQTPELRLSEETLVTSHVTQYLKSFQLDAVRFVYDRLSKREYCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTESPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKL
LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIENNPAQQNKTGL
FEESD-----SVDDV-AMSPLIFESSESDDEPLTVEPGADQNPVLVVSSD
DCEIVTPPNTPPNRTPSLNESPKTKSKKKYNKQTSPRKKADLTDSEEDD-
--EAMPPRKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIV
TPKTEPSVRRKNVKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHR
TLDDVKRNFPRRVKIEGTQTPRSSKRKVKQEPKS--KAEQEKKQKTVDKP
AQETPKRKPGRPKKCKTMTEDLGKTTTKPDSNPLPSTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LHKDQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSAN-KSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHANVNISVPKKKRDRSCLDILEQMFEPR-QQQSTKTSPKVLPTLPLT
QKDDATPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQP
SVRPSQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAK
STQATKLTRWFGSVFGGVGSQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFKooooooooooo
>C4
MYHFASEQTPELRLSAEALVTSHVTQYLKGFQLDGVRFVYDRLARREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
LPFVAPEQYKHNLNLWLSSKNSQSTLSGSEVCSTVASIDNNPAQQNEAVL
VEESDKLSEHSVDDVVAMSPLIFESSESDDEPITVEAPASENPVLVVSSD
DCEIVTPPNTPPNRMPILSESPRTKSKKKFTKKSSPSKKADLTDSEEDDE
A-LTISPRKRTRAATVHFTPKTRRLNVRILRVSLDTLSTPPPSGATTAIV
TPKTEPSARRKYQKKRPVSPMDVGRPTTRGMQRLTRSAESKINSKYLKHH
ALDDAKRSLPRRIKAEGNQTPKSSKRIVKQEPKARPKPEQEKEPKTVDKP
AQETPKRKPGRPRKSKTVTETLEKSKTKPDSKPMPPTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LSKDPVETVVINSSHDESSPQDPSQSRRTKALKRKRKPEAPVNSSFGGGL
GLPPAKRSAN-KSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHAKVNTPAPKKKRDRSCLDILEQMFEPREQQESAKTSPKVLPTLPLT
QKDDAAPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQQDQQ
SVRPSQANKITKYLIGSGITQEKTQPSNGNRNSIVASLRKSPKSPKQSAK
TTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRSAR
SGGASGPSKRKRLELFK-----------
>C5
MYHFVSEQTPELRLSAETLVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGDRLEHQYKSFS
RFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
LPLVAPEQYKHNLNLWLASKNSQSTLSGSEVCSTVASIENNPPQQNETVL
VEESDRISEHSVDDVVAMSPLIFESSESDDEPITVDPVANENPVLVVSSD
DCEIVTPPNTPPNRTPLVNKSPRTKSKKKCSKKPSPCKEADLTDSEKDDE
G-LTMPPRKSTRAATVHFTPKTRRLNVRLLRVSLDALSTPAPSGATTAII
TPKTEPSARRKNRTKQ---PMDVGRPATRGMQRLTRSAESKINSKYLKHH
VLDDAKRNFPRRIKAEGNQTPKTSKRIVKQESKAKAKPEQKKKIKTVDKP
AQETPKRKPGRPRKCKTLTETLGKSKTKPNSKPLPPTPQVLSGSSLSSEY
MQCAQRIPDDLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LFKDQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPDAPVNSSFGGGL
GLPQAKRSATNKSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHAKVTIPAPKKKRDRSCLDILEQMFEPR-QQQSSKTSPKVLPTLPLI
QKDDATTTFTQRRVTLLEDDFFEITNNGQFGSRMRLNASGEVSPVQQDQQ
SVRPTQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPKHGAR
TTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRTAR
SGGATGPTKRKRLELFKooo--------

FORMAT of file /tmp/tmp8794042069031120564aln Not Supported[FATAL:T-COFFEE]
>C1
MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGL
FEETDRLSEHSVDDV-AMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSD
DCEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDE
ATDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIV
TPKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHR
SLDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKS--KVGQEKKQKTVDVP
AQGTAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIP
LYKDPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSAN-KSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQLAKVNISVPKKKRDRSCLDILEQMFEPR-QQQSAKTSPKVLPTLPLT
QKDDAESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQ
SVRPSQANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAK
STQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFKooo--------
>C2
MYHFVSEQTPELRLSEEALVTGHVTQYLKSFQLDAVRFVYDRLSKHEFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVKDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NNFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIEHNPAQQNKTGL
FEESD-----SVDDV-AMSPLIFESSESDDEPLTVEPGADQNPVLVVSSD
DCEIVTPPNTPPNRTPSLNESPRTKSKKQYSKKMSPRKKADLTDSEEDDK
AMDNMPPKKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIV
TPKTEPSARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHR
ALDDVKRSAPRRVKIGCTQKLRSSKRIVKQEPMS--KAEQENKEKTVNEP
AQETPKRKPGRPRKCKTMTEDLGKTTTKPDSNSLPSTPQVLSGSSLSWEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPVLLTLPSTHNLLNDSEVVAIP
LHKEQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSAN-KSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHANVNISVPKKKRDRSCLDILEQMFEPR-QQQSTKTSPKVLPTLPLT
QKDDATPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQP
SVRSSQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAK
STQATKLTRWFGSVFGGVISQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFKoooooooo---
>C3
MYHFVSEQTPELRLSEETLVTSHVTQYLKSFQLDAVRFVYDRLSKREYCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTESPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKL
LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIENNPAQQNKTGL
FEESD-----SVDDV-AMSPLIFESSESDDEPLTVEPGADQNPVLVVSSD
DCEIVTPPNTPPNRTPSLNESPKTKSKKKYNKQTSPRKKADLTDSEEDD-
--EAMPPRKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIV
TPKTEPSVRRKNVKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHR
TLDDVKRNFPRRVKIEGTQTPRSSKRKVKQEPKS--KAEQEKKQKTVDKP
AQETPKRKPGRPKKCKTMTEDLGKTTTKPDSNPLPSTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LHKDQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSAN-KSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHANVNISVPKKKRDRSCLDILEQMFEPR-QQQSTKTSPKVLPTLPLT
QKDDATPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQP
SVRPSQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAK
STQATKLTRWFGSVFGGVGSQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFKooooooooooo
>C4
MYHFASEQTPELRLSAEALVTSHVTQYLKGFQLDGVRFVYDRLARREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
LPFVAPEQYKHNLNLWLSSKNSQSTLSGSEVCSTVASIDNNPAQQNEAVL
VEESDKLSEHSVDDVVAMSPLIFESSESDDEPITVEAPASENPVLVVSSD
DCEIVTPPNTPPNRMPILSESPRTKSKKKFTKKSSPSKKADLTDSEEDDE
A-LTISPRKRTRAATVHFTPKTRRLNVRILRVSLDTLSTPPPSGATTAIV
TPKTEPSARRKYQKKRPVSPMDVGRPTTRGMQRLTRSAESKINSKYLKHH
ALDDAKRSLPRRIKAEGNQTPKSSKRIVKQEPKARPKPEQEKEPKTVDKP
AQETPKRKPGRPRKSKTVTETLEKSKTKPDSKPMPPTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LSKDPVETVVINSSHDESSPQDPSQSRRTKALKRKRKPEAPVNSSFGGGL
GLPPAKRSAN-KSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHAKVNTPAPKKKRDRSCLDILEQMFEPREQQESAKTSPKVLPTLPLT
QKDDAAPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQQDQQ
SVRPSQANKITKYLIGSGITQEKTQPSNGNRNSIVASLRKSPKSPKQSAK
TTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRSAR
SGGASGPSKRKRLELFK-----------
>C5
MYHFVSEQTPELRLSAETLVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGDRLEHQYKSFS
RFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
LPLVAPEQYKHNLNLWLASKNSQSTLSGSEVCSTVASIENNPPQQNETVL
VEESDRISEHSVDDVVAMSPLIFESSESDDEPITVDPVANENPVLVVSSD
DCEIVTPPNTPPNRTPLVNKSPRTKSKKKCSKKPSPCKEADLTDSEKDDE
G-LTMPPRKSTRAATVHFTPKTRRLNVRLLRVSLDALSTPAPSGATTAII
TPKTEPSARRKNRTKQ---PMDVGRPATRGMQRLTRSAESKINSKYLKHH
VLDDAKRNFPRRIKAEGNQTPKTSKRIVKQESKAKAKPEQKKKIKTVDKP
AQETPKRKPGRPRKCKTLTETLGKSKTKPNSKPLPPTPQVLSGSSLSSEY
MQCAQRIPDDLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LFKDQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPDAPVNSSFGGGL
GLPQAKRSATNKSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHAKVTIPAPKKKRDRSCLDILEQMFEPR-QQQSSKTSPKVLPTLPLI
QKDDATTTFTQRRVTLLEDDFFEITNNGQFGSRMRLNASGEVSPVQQDQQ
SVRPTQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPKHGAR
TTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRTAR
SGGATGPTKRKRLELFKooo--------
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:978 S:98 BS:978
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 92.50 C1	 C2	 92.50
TOP	    1    0	 92.50 C2	 C1	 92.50
BOT	    0    2	 93.42 C1	 C3	 93.42
TOP	    2    0	 93.42 C3	 C1	 93.42
BOT	    0    3	 89.80 C1	 C4	 89.80
TOP	    3    0	 89.80 C4	 C1	 89.80
BOT	    0    4	 88.66 C1	 C5	 88.66
TOP	    4    0	 88.66 C5	 C1	 88.66
BOT	    1    2	 95.95 C2	 C3	 95.95
TOP	    2    1	 95.95 C3	 C2	 95.95
BOT	    1    3	 88.49 C2	 C4	 88.49
TOP	    3    1	 88.49 C4	 C2	 88.49
BOT	    1    4	 87.55 C2	 C5	 87.55
TOP	    4    1	 87.55 C5	 C2	 87.55
BOT	    2    3	 89.52 C3	 C4	 89.52
TOP	    3    2	 89.52 C4	 C3	 89.52
BOT	    2    4	 89.20 C3	 C5	 89.20
TOP	    4    2	 89.20 C5	 C3	 89.20
BOT	    3    4	 91.36 C4	 C5	 91.36
TOP	    4    3	 91.36 C5	 C4	 91.36
AVG	 0	 C1	  *	 91.09
AVG	 1	 C2	  *	 91.12
AVG	 2	 C3	  *	 92.02
AVG	 3	 C4	  *	 89.79
AVG	 4	 C5	  *	 89.19
TOT	 TOT	  *	 90.65
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGTATCACTTTGTATCCGAGCAAACGCCGGAGGTGCGGCTCACAGATGA
C2              ATGTATCACTTTGTATCCGAGCAAACGCCGGAGTTGCGGCTCTCGGAGGA
C3              ATGTATCACTTTGTATCCGAGCAAACGCCGGAGTTGCGGCTCTCGGAGGA
C4              ATGTATCACTTTGCATCCGAACAAACACCGGAGTTGCGGCTTTCGGCAGA
C5              ATGTATCACTTCGTATCCGAACAAACGCCGGAGTTGCGGCTCTCAGCGGA
                *********** * ******.*****.****** ******* :*.*. **

C1              GGCACTGGTCACGAGCCACGTGACGCAGTACCTCAAGAGCTTTCAACTGG
C2              GGCACTAGTCACAGGCCACGTGACGCAGTACCTCAAGAGCTTCCAACTGG
C3              GACACTGGTCACAAGCCACGTGACGCAGTACCTCAAGAGCTTCCAACTGG
C4              GGCACTGGTCACGAGCCACGTGACGCAGTACCTCAAGGGCTTCCAGCTGG
C5              GACACTGGTCACGAGCCACGTGACGCAGTACCTCAAGAGCTTCCAGCTGG
                *.****.*****..***********************.**** **.****

C1              ATGCCGTCCGCTTCGTCTACGATCGTTTGGCTAAGCGGGAATTCTGCATC
C2              ATGCTGTCCGTTTCGTATACGATCGTCTGTCCAAGCATGAATTCTGCATC
C3              ATGCTGTCCGTTTCGTCTACGATCGTCTGTCCAAACGGGAATACTGCATC
C4              ATGGAGTGCGCTTCGTCTACGATCGTCTGGCCAGGCGCGAATTCTGCATC
C5              ATGCAGTGCGCTTCGTCTACGATCGGCTGGCAAAGCGCGAGTTCTGCATC
                ***  ** ** *****.********  ** * *..*. **.*:*******

C1              CTGAATGATGAGAGTGGCCTTGGAAAGGTCGCTACGGTGGCGGCACTTCT
C2              CTGAATGATGAGAGTGGCCTAGGAAAAGTCGCCACGGTGGCGGCACTTCT
C3              CTTAATGATGAGAGTGGCCTTGGAAAGGTCGCTACGGTGGCGGCACTTCT
C4              TTGAATGATGAGAGTGGGCTTGGAAAAGTCGCCACGGTGGCGGCGCTACT
C5              TTAAATGATGAGAGTGGTCTTGGAAAAGTCGCCACGGTGGCGGCACTACT
                 * ************** **:*****.***** ***********.**:**

C1              AAGTGCCCTACCACCCGCCAAAAAAACACTTGTGGTGCTCCAGAACGATG
C2              AAGTGCCCTGCCACCCGCCAAAAAAACACTTGTCGTGCTCCAGAACGATG
C3              AAGTGCCCTACCACCCGCCAAAAAAACACTTGTGGTGCTTCAGAACGATG
C4              CAGTGCCCTGCCTCCCGCCAAGAAAACACTTGTGGTGCTGCAGAACGATG
C5              AAGTGCGCTTCCACCCGCCAAGAAAACACTTGTGGTTCTCCAGAACGATG
                .***** ** **:********.*********** ** ** **********

C1              AGCAACTGCTCACCGGTTGGCGATTCCATTTGGACACTCTCACTGACCTC
C2              AGCAACTGCTCACCGGTTGGCGATTTCATTTGGACACTCTCACTGACCTC
C3              AGCAACTGCTCACCGGTTGGCGATTCCATTTGGACACTCTCACTGACCTC
C4              AGCAACTGCTCACCGGTTGGCGGTTCCATTTGGACACTCTCACTGACCTT
C5              AGCAACTGCTCACCGGTTGGCGATTCCATTTGGACACTCTCACTGACCTC
                **********************.** *********************** 

C1              CAGGTGTACATCATTCAGGGGGTGCAAGATACCACCGACTCCCCGCACAG
C2              CAGGTGTACATCATTCAGGGGGTGAAAGATACCACCGACTCCCCGCACAG
C3              CAGGTGTACATCATTCAGGGGGTGCAAGATACCACCGAATCCCCGCACAG
C4              CAGGTGTACATCATTCAAGGGGTGCACGACACCACAGACTCACCGCACAG
C5              CAAGTGTACATCATTCAAGGGGTGCACGACACCACAGACTCGCCGCACAG
                **.**************.******.*.** *****.**.** ********

C1              CGTTTACCTGGCGAAATGGAGCCAACTACGGAGCATTGGAGATCTCAGTC
C2              CGTTTACCTGGCGAAATGGAGCCAACTACGGAGCATTGGAGATCTCAGTC
C3              CGTTTACCTGGCAAAATGGAGCCAACTACGGAGCATTGGAGATCTCAGTC
C4              CGTTTACCTGGCGAAATGGAGCCAGCTACGGAGCATTGGAGATCTCAGTC
C5              CGTTTACCTGGCGAAATGGAGCCAACTACGGAGCATTGGAGATCTCAGTC
                ************.***********.*************************

C1              GCCTCAAGTTCGACTACATTATGGTGGATAATCGGGGGCATTCGCTGAAC
C2              GCCTCAAGTTCGACTACATTATGGTGGATAATCGGGGGCACTCGCTGAAC
C3              GCCTCAAGTTCGACTACATTATGGTGGATAATCGAGGGCACTCGCTGAAC
C4              GCCTCAAGTTCGACTACATTATGGTGGACAATCGGGGGCACTCGCTGAAC
C5              GCCTCAAGTTCGACTACATTATGGTGGATAATCGGGGGCACTCGCTGAAC
                **************************** *****.***** *********

C1              AACAGCTTTTGCACTTCCATGCTGCTGAAGCAATTCGAGGGACGGGTAAA
C2              AACAACTTTTGCACTTCCATGCTGCTGAAGCAATTCGAGGGACGGGTAAA
C3              AACAGCTTTTGCACTTCCATGCTGCTGAAGCAATTCGAGGGACGGGTGAA
C4              AACAGCTTTTGCACTTCCATGCTGCTGAAGCAATTCGAGGGACGCGTAAA
C5              AACAGCTTTTGTACTTCCATGCTGCTGAAGCAATTCGAGGGACGGGTAAA
                ****.****** ******************************** **.**

C1              CGTTCTTATCTCCAGTGTTGACGTTACGTCCGACGTTAGGTTGCTCTACA
C2              CGTTCTTATCTCCAGTGTTGACATTACGTCTGACGTAAGGTTGCTCTACA
C3              CGTTCTTATCTCCAGTGTTGACATTACGTCCGACGTTAGGTTGCTCTACA
C4              CGTTCTTATCTCCAGTGTTGACATTACGTCCGACGTGAAGTTGCTATACA
C5              CGTTCTTATCTCTAGTGTTGACATTACGTCCGACGTGAAGTTGCTCTACA
                ************ *********.******* ***** *.******.****

C1              ATGTTCTACGGTTGGGCGGCCGACTGGAGCATCAGTACAAAAGCTTTGCG
C2              ATGTTCTACGTTTGGGCGGCCGATTGGAGCATCAGTACAAAAGCTTTGCG
C3              ATGTTCTACGGTTGGGCGGCCGACTGGAGCATCAGTACAAAAGCTTTGCG
C4              ATGTTTTACGGTTGGGCGGCCGACTGGAGCATCAGTACAAAAGCTTTGCA
C5              ATGTTTTACGACTGGGCGACCGACTAGAGCATCAGTACAAAAGCTTTTCA
                ***** ****  ******.**** *.********************* *.

C1              AGCTTCGATCGAAAATTCCATCTGCCAGATCCGAAGGAGGTATTCAGTAA
C2              AGCTTCGATCGCAAATTCCACCTGCCAGATCCGAAGGAAGTATTCAGCAA
C3              AGCTTCGATCGTAAATTCCACCTGCCAGATCCGAAGGAGGTATTCAGCAA
C4              AGCTTTGATCGCAAATTCCACCTGCCAGATCCGAAGGAGGTATTCAGCAA
C5              AGGTTCGATCGCAAATTCCACCTGCCAGATCCAAAGGAGGTATTCAGCAA
                ** ** ***** ******** ***********.*****.******** **

C1              GCGCATAGATCTCGAGGAATACTACAAGCAGCGGGGATTCCTCAGCGAGT
C2              GCGTATAGATCTCGAGGAATACTACAAGCAGCGGGGATTCCTCAGCGAGT
C3              GCGCATAGATCTCGAGGAATACTACAAGCAGCGGGGATTCCTCAGCGAGT
C4              GCGCATAGATCTCGAGGAATACTACAAGCAGCGGGGATTCCTCAGCGAGT
C5              GCGCATAGATCTCGAGGAATACTACAAGCAGCGCGGATTCCTCAGCGAGT
                *** ***************************** ****************

C1              ACATCAAGGACTTTCGTCTGCGTCGTTTTCGTCATCAATTCGACAAGTCA
C2              ACATCAAGGACTTTCGTCTGCGTCGTTTCCGCCATCAATTCGACAAGTCG
C3              ACATCAAAGACTTTCGTCTGCGTCGTTTCCGTCATCAATTCGACAAGTTG
C4              ATATCAAGGACTTTCGTCTGCGTCGTTTTCGCCATCAATTCGACAAGACG
C5              ATATCAAGGACTTTCGTCTGCGTCGTTTCCGTCATCAATTCGACAAGACC
                * *****.******************** ** ***************:  

C1              CTGCCACTTGTCGCACCGGAGCAATACAAACACAATCTGAATCTCTGGTT
C2              CTGCCTCTTGTCGCACCGGAGCAATACAAACACAATCTGAATCTCTGGTT
C3              CTGCCTCTTGTCGCACCGGAGCAATACAAACACAATCTGAATCTCTGGTT
C4              CTGCCCTTTGTCGCACCGGAGCAATATAAGCACAATCTGAACCTCTGGTT
C5              CTGCCACTTGTCGCACCGGAGCAATACAAGCACAATCTGAATCTCTGGTT
                *****  ******************* **.*********** ********

C1              GGCCTCAAAGAACAGCCAGAGCACAATAAGCGGCTCAGATGTGTGCTCTA
C2              GGCCTCAAAAAACAGCCAGAGCACAATAAGCGGCTCAGAGGTTTGCTCTA
C3              GGCCTCAAAAAACAGCCAGAGCACAATAAGCGGCTCAGAGGTTTGCTCTA
C4              GTCCTCCAAAAACAGCCAGAGCACACTAAGTGGCTCAGAGGTGTGCTCAA
C5              GGCCTCTAAAAACAGCCAGAGCACATTAAGTGGCTCAGAGGTGTGCTCTA
                * **** **.*************** **** ******** ** *****:*

C1              CAATCGCTTCCATAGACAACAATCCGGCTCAGCAAAATAAAACTGGGCTC
C2              CAATCGCTTCCATAGAACACAATCCGGCTCAGCAAAATAAAACTGGTCTA
C3              CAATCGCTTCCATAGAAAACAATCCGGCTCAGCAAAATAAAACTGGGCTC
C4              CAGTCGCTTCCATCGACAACAATCCGGCTCAGCAAAATGAAGCAGTGCTC
C5              CAGTCGCTTCCATAGAAAACAATCCGCCTCAGCAAAATGAAACTGTGCTC
                **.**********.**..******** ***********.**.*:*  **.

C1              TTTGAAGAAACGGATAGGTTATCCGAGCACAGCGTGGATGATGTG---GC
C2              TTTGAAGAATCGGAC---------------AGTGTAGATGATGTG---GC
C3              TTTGAAGAATCGGAC---------------AGTGTAGATGATGTG---GC
C4              GTCGAGGAATCGGATAAGTTATCCGAGCATAGCGTAGATGATGTTGTGGC
C5              GTTGAAGAATCGGATAGGATATCCGAGCATAGCGTAGATGATGTTGTGGC
                 * **.***:****                ** **.********    **

C1              AATGTCACCGCTGATATTCGAGTATTCCGAGTCTGACGATGAACCCCTAA
C2              AATGTCACCGCTGATATTCGAGTCCTCCGAATCTGACGATGAACCCCTAA
C3              AATGTCACCGCTGATATTCGAGTCCTCCGAATCTGACGATGAACCCCTAA
C4              AATGTCACCGCTGATATTCGAGTCCTCCGAATCTGACGATGAACCCATAA
C5              AATGTCACCCCTGATATTTGAGTCCTCCGAATCTGACGATGAACCCATAA
                ********* ******** ****. *****.***************.***

C1              CAGTAGAACCTGATGCAGATCAAAACCCGGTATTAGTTGTATCCAGCGAT
C2              CAGTAGAACCTGGTGCAGATCAAAACCCGGTATTAGTTGTATCCAGCGAT
C3              CAGTAGAACCTGGTGCAGATCAAAACCCGGTATTAGTTGTATCCAGCGAT
C4              CAGTGGAAGCTCCAGCAAGTGAAAACCCGGTATTAGTTGTATCCAGCGAT
C5              CCGTAGATCCCGTAGCAAATGAAAACCCGGTATTAGTTGTATCCAGCGAT
                *.**.**: *   :***..* *****************************

C1              GATTGTGAGATTGTAACACCTCCAAGTACTCCGCAAAATCGAACGCCCTC
C2              GATTGTGAGATTGTAACACCTCCAAATACTCCGCCAAATCGAACGCCGTC
C3              GATTGTGAGATTGTAACACCTCCAAATACTCCGCCAAATCGAACGCCCTC
C4              GATTGTGAGATTGTGACTCCTCCAAATACACCGCCGAATCGAATGCCTAT
C5              GATTGTGAGATTGTGACTCCTCCAAATACACCGCCGAATCGAACGCCCTT
                **************.**:*******.***:****..******* *** : 

C1              ATTAAATGAATCACCAAGGACGAAATCAAAGAAAAAATTTAGCAAAAAAA
C2              ATTAAATGAATCGCCAAGGACGAAATCAAAGAAACAATATAGCAAGAAAA
C3              ATTAAATGAATCGCCTAAGACGAAATCAAAGAAAAAATATAACAAGCAAA
C4              ATTAAGTGAATCGCCAAGGACGAAATCAAAGAAAAAATTTACCAAGAAAT
C5              AGTAAATAAATCGCCAAGGACGAAATCAAAGAAGAAATGTAGCAAGAAAC
                * ***.*.****.**:*.***************..*** ** ***..** 

C1              CGTCACCGCGCAAAAAAGCTGATCTCACCGATTCCGAAGAGGATGATGAA
C2              TGTCGCCGCGCAAAAAAGCTGATCTCACCGATTCCGAAGAGGATGATAAA
C3              CGTCGCCGCGCAAAAAAGCTGATCTCACCGATTCCGAAGAGGATGAT---
C4              CGTCGCCGAGCAAAAAAGCTGATCTCACCGATTCCGAAGAGGATGATGAA
C5              CGTCACCGTGCAAAGAAGCAGATCTCACCGATTCCGAAAAGGATGATGAA
                 ***.*** *****.****:******************.********   

C1              GCGACCGATAATATGCCGCCAAGGAAGAGAACTCGTGCAGCCACCGTTCA
C2              GCGATGGATAATATGCCGCCAAAAAAGAGAACTCGTGCGGCCACCGTTCA
C3              ------GAAGCGATGCCGCCAAGGAAGAGAACTCGTGCGGCCACCGTTCA
C4              GCG---TTGACAATATCGCCAAGAAAGAGAACTCGTGCGGCTACCGTTCA
C5              GGG---TTGACAATGCCGCCAAGAAAGAGTACTCGTGCGGCTACCGTTCA
                       : .. **. ******..*****:********.** ********

C1              TCTGACACCTAAGACAAGGAGACTCAATGTTCGAATTTTAAGGGTTTCCC
C2              TCTAACACCCAAGACAAGGAGACTCAATGTTCGAATTTTGAGGTGTTCCC
C3              TCTAACACCCAAGACAAGGAGACTCAATGTTCGAATTTTAAGGTGTTCCC
C4              TTTTACACCCAAGACAAGGAGACTCAATGTGCGAATTCTAAGGGTCTCTC
C5              TTTTACACCCAAGACAAGAAGACTTAATGTGCGACTTTTAAGGGTTTCCC
                * * ***** ********.***** ***** ***.** *.***   ** *

C1              TCGATACTCTGAGCACACCACCACCGTCCAGAACCACTACTGCGATCGTA
C2              TAGATAATCTAAGCACCCCACCACCGTCTAGAACCACTACTGCGATCGTA
C3              TAGATAATCTAAGCACGCCACCACCGTCTAGAACCACTACTGCGATCGTA
C4              TAGATACTCTGAGCACACCACCTCCCTCTGGAGCCACCACTGCCATCGTA
C5              TAGATGCTCTAAGCACACCAGCCCCGTCTGGAGCCACTACTGCGATCATA
                *.***..***.***** *** * ** ** .**.**** ***** ***.**

C1              ACGCCCAAAACGGAGCCCACAGCTAGAAGAAAAAATCTGAAAAAGCGCAC
C2              ACACCGAAAACAGAGCCCTCAGCTAGAAGAAAAAATCTGAAAAAGCGCAC
C3              ACACCGAAAACAGAGCCCTCAGTTAGAAGAAAAAATGTGAAAAAGCGCAC
C4              ACGCCCAAGACAGAGCCCTCAGCTAGAAGAAAATATCAGAAAAAGCGGCC
C5              ACGCCCAAAACAGAGCCCTCAGCTAGAAGAAAAAATCGGACAAAACAG--
                **.** **.**.******:*** **********:**  **.***.*.   

C1              GGTGAGCCCAGTGGATGTGGGTCGTCCAGCCACAAGGGGAATGCAGCGCC
C2              GGTGAGCCCAGTGGATGTGGGTCGTCCAGCCACAAGGGGAATGCAGCGCC
C3              GGTGAGCCCAGTGGATGTGGGTCGTCCAGCCACAAGGGGAATGCAGCGCC
C4              GGTGAGCCCAATGGATGTGGGTCGTCCAACTACAAGAGGAATGCAGCGCT
C5              -------CCAATGGATGTGGGTCGCCCAGCTACAAGAGGAATGCAGCGCC
                       ***.************* ***.* *****.************ 

C1              TAACACGATCCGCTGAAACAAAAATAAACAGTAAGTACTTGAAACATCGC
C2              TAACACGATCCGCTGAAACAAAACTAAACAGCAAGTACTTGAAACACCGC
C3              TAACACGATCCGCTGAAACAAAACTAAACAGCAAGTACTTGAAACACCGC
C4              TGACACGATCCGCTGAATCAAAAATAAACAGCAAGTACTTGAAGCACCAC
C5              TAACACGATCCGCTGAATCAAAAATAAACAGCAAGTACTTGAAGCACCAC
                *.***************:*****.******* ***********.** *.*

C1              TCATTGGATGATGTCAAGCGTAGCTTTCCAAGGAGAGTCAAGTTGGAGGG
C2              GCATTGGATGATGTCAAGCGTAGCGCTCCAAGGAGAGTCAAGATTGGATG
C3              ACATTGGATGATGTCAAGCGTAACTTTCCAAGGAGAGTCAAGATTGAGGG
C4              GCACTGGATGATGCCAAGCGTAGCTTGCCCAGGAGAATCAAGGCTGAGGG
C5              GTACTTGATGATGCCAAGCGTAACTTTCCAAGAAGAATCAAGGCTGAGGG
                  * * ******* ********.*   **.**.***.*****   *.. *

C1              TAACCAAACGCCCAGAAGTAGCAAACAAATAGTGAAGCAGGAGCCTAAGT
C2              TACCCAAAAGCTCAGGAGTAGCAAACGAATAGTGAAGCAGGAGCCTATGT
C3              GACCCAAACGCCCAGGAGTAGCAAACGAAAAGTGAAGCAGGAGCCTAAGT
C4              GAACCAAACGCCCAAATCTAGCAAACGAATAGTGAAGCAGGAGCCTAAGG
C5              GAACCAAACACCCAAAACTAGCAAACGAATAGTGAAGCAGGAGTCCAAGG
                 *.*****..* **..: ********.**:************* * *:* 

C1              CT------AAAGTCGGGCAGGAAAAGAAACAGAAGACGGTGGATGTACCT
C2              CT------AAAGCCGAGCAGGAAAACAAAGAGAAGACGGTGAACGAACCT
C3              CT------AAAGCCGAGCAGGAAAAGAAACAGAAGACGGTGGACAAACCT
C4              CAAGGCCCAAGCCCGAGCAGGAAAAGGAACCAAAGACTGTGGACAAACCT
C5              CAAAGGCTAAACCCGAGCAGAAAAAGAAAATAAAGACCGTGGACAAGCCT
                *:      **.  **.****.**** .**  .***** ***.* .:.***

C1              GCTCAAGGAACTGCGAAACGAAAGCCTGGACGTCCGAGAAAATGCCAAAC
C2              GCTCAAGAAACTCCGAAACGAAAGCCTGGACGTCCGAGAAAATGCAAAAC
C3              GCTCAAGAAACTCCGAAACGAAAGCCTGGACGTCCGAAAAAATGCAAAAC
C4              GCACAAGAAACTCCGAAACGAAAACCTGGACGCCCGAGAAAATCAAAAAC
C5              GCTCAAGAAACTCCGAAACGAAAACCTGGACGTCCGAGAAAGTGCAAAAC
                **:****.**** **********.******** ****.***.* ..****

C1              CAAGACTGAAGATTTGGGGAAGACAAAGACTAAGCCGAATTCAAAGCACT
C2              TATGACTGAAGATTTGGGGAAGACAACGACTAAGCCGGATTCAAACTCCT
C3              TATGACTGAAGATTTGGGAAAGACAACGACTAAGCCGGATTCAAACCCCT
C4              GGTGACTGAAACTTTAGAAAAGTCAAAGACTAAGCCGGATTCAAAACCCA
C5              GCTGACGGAAACTTTAGGGAAGTCAAAGACTAAGCCGAATTCAAAGCCCT
                  :*** ***..***.*..***:***.**********.*******  .*:

C1              TGCCACCTACTCCTCAAGTTCTCAGTGGTAGCTCGTTGTCCTCGGAGTAC
C2              TGCCATCTACTCCTCAAGTTCTCAGTGGCAGCTCCTTGTCCTGGGAGTAC
C3              TGCCATCTACTCCTCAAGTTCTCAGTGGCAGCTCCTTGTCGTCGGAGTAC
C4              TGCCACCAACTCCTCAAGTTCTCAGTGGAAGCTCCTTGTCCTCGGAGTAC
C5              TGCCACCTACTCCTCAAGTTCTCAGTGGTAGCTCTTTGTCCTCGGAGTAC
                ***** *:******************** ***** ***** * *******

C1              ATGCAATGTGCTCAGCGAATACCAGACAATTTGGATGCCATTGAGTCGCC
C2              ATGCAATGTGCTCAGCGAATACCAGACAATTTGGACGCCATTGAGTCGCC
C3              ATGCAATGTGCTCAGCGAATACCAGACAATTTGGATGCCATTGAGTCGCC
C4              ATGCAATGTGCTCAGCGTATACCAGACAATTTGGATGCCATTGAGTCACC
C5              ATGCAATGTGCTCAGCGTATCCCAGACGATTTGGATGCCATTGAGTCACC
                *****************:**.******.******* ***********.**

C1              CGCTTTTCGTGTGCCCTTTACACCTCAACAAACTCCAATGCTTCTAACCT
C2              TGCTTTCCGTGTGCCCTTTACACCTCAACAAACTCCAGTGCTTCTAACGC
C3              TGCTTTCCGTGTGCCCTTCACACCTCAACAAACTCCAATGCTTCTAACGC
C4              TGCCTTCCGAGTACCCTTCACGCCCCAACAAACTCCTATGCTTCTAACCT
C5              AGCTTTCCGGGTGCCTTTCACGCCCCAACAAACTCCTATGCTTCTAACCT
                 ** ** ** **.** ** **.** ***********:.**********  

C1              TGCCGTCTACACACAATTTGCTCAACGATTCTGAGGTGGTGTCTATTCCG
C2              TGCCGTCTACTCACAACTTGCTCAACGACTCTGAGGTGGTGGCAATTCCG
C3              TGCCGTCTACTCATAACTTGCTCAACGACTCCGAGGTGGTGGCTATTCCG
C4              TGCCGTCTACTCACAACTTGCTCAACGACTCTGAGGTCGTGGCTATTCCA
C5              TGCCGTCTACTCACAATTTGCTTAACGACTCTGAAGTGGTGGCTATTCCG
                **********:** ** ***** ***** ** **.** *** *:*****.

C1              CTTTACAAAGATCCAGTTGAGACAGTGGTGATCAATAGCTCGCACGATGA
C2              CTTCACAAAGAGCAAGTTGAGACAGTGGTGATCAACAGCTCCCACGATGA
C3              CTTCACAAAGATCAAGTTGAGACAGTGGTGATCAACAGCTCCCACGATGA
C4              CTTTCCAAAGATCCCGTTGAAACGGTGGTGATCAACAGCTCCCACGATGA
C5              CTTTTCAAAGATCAAGTTGAAACAGTGGTGATCAACAGCTCCCACGATGA
                ***  ****** *..*****.**.*********** ***** ********

C1              GTGTTCTCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCTTTGAAAA
C2              GAGTTCGCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCTTTGAAAA
C3              GAGTTCGCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCTTTGAAAA
C4              GAGTTCGCCGCAGGATCCATCGCAGAGTCGGCGCACCAAGGCGTTAAAAA
C5              GAGTTCCCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCGTTAAAAA
                *:**** *********************** *********** **.****

C1              GAAAACGCAAACCCGTGACGTCCGTCAATTCAAGTTTCGGCGGCGGATTG
C2              GAAAACGCAAACCAGTGACGTCTGTCAATTCAAGTTTTGGCGGGGGATTG
C3              GAAAACGCAAACCCGTGACGTCCGTTAATTCAAGTTTTGGCGGAGGATTG
C4              GAAAACGCAAACCCGAGGCGCCTGTCAATTCAAGTTTCGGCGGTGGATTG
C5              GAAAACGCAAACCCGACGCGCCTGTCAATTCAAGCTTTGGCGGGGGATTG
                *************.*: .** * ** ******** ** ***** ******

C1              GGTCTACCACCGGCCAAGAGGAGTGCCAAC---AAATCTCCAGATCTATT
C2              GGTCTACCACCGGCCAAGAGGAGTGCCAAC---AAATCTCCAGATCTGTT
C3              GGTCTACCACCGGCCAAGAGGAGTGCCAAC---AAATCTCCAGATCTGTT
C4              GGTCTGCCACCGGCTAAGAGGAGTGCCAAC---AAATCTCCAGATCTGTT
C5              GGTCTACCACAGGCTAAGAGGAGTGCCACCAACAAATCTCCAGATCTGTT
                *****.****.*** *************.*   **************.**

C1              TAGCATATCCTCGGAACACTCGCAGATTCCGCTGGCGCAACCAAGACCCT
C2              TAGCATATCCTCGGATCACTCCCAGATTCCGCTGGCGCAACCGCGACCTT
C3              TAGCATATCCTCGGATCACTCCCAGATTCCGCTGGCGCAACCGCGACCCT
C4              TAGCATATCCTCGGATCTCTCGCAGATTCCTCTGGCACAGCCACGACCCT
C5              TAGCATATCCTCTGATCTCTCACAGATTCCTCTGGCGCAGCCACGACCCT
                ************ **:*:*** ******** *****.**.**..**** *

C1              CATCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTGAAGCAGTTT
C2              CGTCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTGAAGCAGTTT
C3              CGTCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTTAAGCAGTTT
C4              CATCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTGAAGCAGTTT
C5              CATCGCCCTTCGAAGGCTTCAAGATCTTTGGCTCTGAGGTGAAGCAGTTT
                *.***************** ******************** *********

C1              CAGCAGCAGCTAGCGAAAGTAAATATATCGGTGCCAAAAAAGAAGCGAGA
C2              CAGCAGCAACACGCGAATGTAAATATATCAGTGCCAAAAAAGAAACGAGA
C3              CAGCAGCAACACGCGAATGTAAATATATCAGTGCCAAAAAAGAAGCGAGA
C4              CAGCAGCAGCACGCGAAAGTAAATACACCAGCGCCGAAAAAGAAGCGAGA
C5              CAGCAGCAGCATGCGAAAGTAACTATACCAGCGCCAAAAAAGAAGCGAGA
                ********.*: *****:****.** * *.* ***.********.*****

C1              TCGCTCGTGTTTGGATATCCTGGAGCAAATGTTCGAGCCACGA---CAAC
C2              TCGCTCGTGTTTGGATATACTAGAGCAAATGTTCGAGCCACGA---CAAC
C3              TCGCTCGTGCTTGGATATCCTGGAGCAAATGTTCGAGCCACGA---CAAC
C4              TCGCTCGTGTTTGGATATCCTGGAGCAAATGTTCGAGCCACGGGAGCAGC
C5              TCGCTCGTGTTTGGATATCCTAGAGCAAATGTTCGAGCCACGA---CAAC
                ********* ********.**.********************.   **.*

C1              AGCAGTCGGCTAAAACTAGTCCCAAAGTCTTGCCAACCTTGCCACTGACC
C2              AGCAGTCGACGAAAACTAGTCCCAAAGTCTTGCCAACCTTGCCACTGACC
C3              AGCAGTCGACGAAAACTAGTCCCAAAGTCTTGCCAACCTTGCCACTGACC
C4              AGGAGTCGGCTAAAACTAGTCCCAAAGTCTTGCCCACCTTGCCACTGACC
C5              AGCAGTCGTCTAAAACTAGTCCCAAAGTCTTGCCTACCTTGCCACTGATC
                ** ***** * *********************** ************* *

C1              CAGAAGGATGATGCAGAGTCTACCATTACGCAGAGAAGAAGAACCCTGCT
C2              CAGAAGGATGATGCAACGCCCACCATAACGCAGAGGAGAAGAACCCTGCT
C3              CAGAAGGATGATGCAACGCCTACGATTACGCAGAGGAGAAGAACCCTGCT
C4              CAGAAAGATGATGCAGCGCCTACCATTACGCAGCGAAGAAGAACCCTCCT
C5              CAGAAAGATGATGCAACAACTACCTTTACGCAGAGAAGAGTAACTCTCCT
                *****.*********... * ** :*:******.*.***. *** ** **

C1              GGAAGATGACTTCTTTGAGATAACGAACAATGGCCAATTTGGCAGTCGCA
C2              GGAAGATGACTTTTTCGAGATAACGAACAATGGCCAATTTGGCAGTCGCA
C3              GGAAGATGACTTCTTCGAGATAACGAACAATGGCCAGTTTGGCAGTCGCA
C4              GGAGGATGACTTCTTTGAGATAACGAACAACGGCCAGTTTGGCAGTCGCA
C5              GGAAGATGACTTCTTTGAGATAACGAACAATGGGCAGTTTGGCAGTCGCA
                ***.******** ** ************** ** **.*************

C1              TGCGATTGAACTCCTCTGGCGAAGTATCGCCCGTGCAACCGGATCAACAG
C2              TGCGGTTGAATTCCTCTGGCGAGGTCTCGCCCGTGCAACCGGATCAGCCG
C3              TGCGGTTGAACTCCTCTGGCGAGGTCTCGCCCGTGCAACCGGATCAACCG
C4              TGCGGTTGAACTCCTCCGGAGAGGTTTCGCCCGTGCAACAGGATCAGCAG
C5              TGAGGTTGAACGCTTCTGGAGAGGTCTCGCCCGTGCAACAGGATCAACAG
                **.*.*****  * ** **.**.** *************.******.*.*

C1              TCCGTCAGGCCGTCGCAGGCCAATAAAATCACCAATTATTTGATAGGTTC
C2              TCCGTCAGGTCGTCGCAGGCCAATAAAATCACCAATTACTTGATAGGTTC
C3              TCCGTCAGGCCGTCGCAGGCCAATAAAATCACCAATTACTTGATAGGTTC
C4              TCCGTCAGGCCGTCGCAGGCCAATAAAATCACTAAATACTTGATAGGTTC
C5              TCCGTCAGGCCGACGCAGGCCAATAAAATCACAAATTACTTGATTGGTTC
                ********* **:******************* **:** *****:*****

C1              TGGAATTACGCAGGAGCGAACGCAACCTTCGAATGGTAATCGCAATTCCA
C2              CGGAATTACCCAGGAGCGAACGCAGCCCTCCAATGGTAATCGCAACTCCA
C3              CGGAATTACCCAGGAGAGAACGCAACCCTCCAATGGTAATCGCAACTCCA
C4              TGGAATTACCCAGGAGAAGACACAGCCTTCTAATGGCAATCGCAACTCCA
C5              TGGAATTACCCAGGAGCGAACGCAGCCTTCTAATGGTAATCGCAACTCCA
                 ******** ******...**.**.** ** ***** ******** ****

C1              TTCTTGCATCGCTGCGCAAGTCACCCAAATCTCCCAAACAGGGTGCTAAA
C2              TTGTCGCATCGCTGCGCAAGTCACCCAAATCTCCGAGACAGGCTGCTAAA
C3              TTGTCGCATCGCTGCGCAAGTCACCCAAATCTCCGAGACAGGCTGCTAAA
C4              TCGTCGCATCGCTGCGCAAGTCCCCAAAATCGCCGAAACAGAGTGCAAAA
C5              TCGTCGCATCGCTTCGCAAGTCCCCCAAATCCCCGAAACATGGTGCAAGA
                *  * ******** ********.**.***** ** *.*** . ***:*.*

C1              TCCACTCAGGCCACGAAACTAACACGCTGGTTTGGCTCCGTCTTCGGCGG
C2              TCCACGCAGGCCACGAAGCTCACACGCTGGTTTGGCTCGGTCTTCGGCGG
C3              TCCACGCAGGCCACGAAGCTAACACGCTGGTTTGGCTCGGTCTTCGGCGG
C4              ACCACTCAAGCCACGAAGCTAACGCGCTGGTTTGGCTCCGTCTTCGGAGG
C5              ACCACTCAAGCCACGAAGTTAACGCGCTGGTTTGGCTCGGTCTTCGGAGG
                :**** **.********. *.**.************** ********.**

C1              TGGAGCCTCACAGACCAGCTCCGTGGAATCGGTTAGTGCACCAAGTACGC
C2              AGTAATCTCACAGACCAGCTCCGTAGAATCGGTCAGTGCACCAAGTACGC
C3              AGTAGGCTCACAGACCAGCTCCGTGGAGTCGGTCAGTGCACCAAGTACGC
C4              AGGAGCCTCACAGACCAGCTCCGTGGAGTCGGTCAGCGCACCGAGTACCC
C5              AGGAGCCTCACAGACCAGCTCCGTGGAATCGGTTAGCGCACCGAGTACCC
                :* *. ******************.**.***** ** *****.***** *

C1              CGGTGAATTCATCCACAAGTGCAGCAGCTTGTCAAACGCGATCGGCGAGA
C2              CGGTCAATTCATCCACAAGTGCAGCTGCGTGTCAAACGCGATCGGCGAGA
C3              CGGTTAATTCATCCACAAGTGCAGCTGCGTGTCAAACGCGATCGGCGAGA
C4              CGGTTAATCCTTCCACGAGTGCAGCAGCGTGTCAAACGCGATCGGCGCGA
C5              CGGTAAATCCTTCCACAAGTGCAGCAGCATGTCAAACGCGAACGGCGAGA
                **** *** *:*****.********:** ************:*****.**

C1              AGTGGTGGAGCATCAGGACCGACCAAAAGAAAGCGATTGGAACTGTTCAA
C2              AGTGGTGGAGCATCAGGACCGACCAAAAGAAAGCGACTGGAACTGTTCAA
C3              AGTGGTGGAGCATCAGGACCGACCAAAAGAAAGCGACTGGAACTGTTCAA
C4              AGTGGTGGAGCCTCGGGACCCAGCAAAAGAAAGCGATTGGAACTGTTCAA
C5              AGTGGTGGAGCCACAGGACCCACCAAAAGGAAGCGATTGGAACTGTTCAA
                ***********.:*.***** * ******.****** *************

C1              G---------------------------------
C2              G---------------------------------
C3              G---------------------------------
C4              G---------------------------------
C5              G---------------------------------
                *                                 



>C1
ATGTATCACTTTGTATCCGAGCAAACGCCGGAGGTGCGGCTCACAGATGA
GGCACTGGTCACGAGCCACGTGACGCAGTACCTCAAGAGCTTTCAACTGG
ATGCCGTCCGCTTCGTCTACGATCGTTTGGCTAAGCGGGAATTCTGCATC
CTGAATGATGAGAGTGGCCTTGGAAAGGTCGCTACGGTGGCGGCACTTCT
AAGTGCCCTACCACCCGCCAAAAAAACACTTGTGGTGCTCCAGAACGATG
AGCAACTGCTCACCGGTTGGCGATTCCATTTGGACACTCTCACTGACCTC
CAGGTGTACATCATTCAGGGGGTGCAAGATACCACCGACTCCCCGCACAG
CGTTTACCTGGCGAAATGGAGCCAACTACGGAGCATTGGAGATCTCAGTC
GCCTCAAGTTCGACTACATTATGGTGGATAATCGGGGGCATTCGCTGAAC
AACAGCTTTTGCACTTCCATGCTGCTGAAGCAATTCGAGGGACGGGTAAA
CGTTCTTATCTCCAGTGTTGACGTTACGTCCGACGTTAGGTTGCTCTACA
ATGTTCTACGGTTGGGCGGCCGACTGGAGCATCAGTACAAAAGCTTTGCG
AGCTTCGATCGAAAATTCCATCTGCCAGATCCGAAGGAGGTATTCAGTAA
GCGCATAGATCTCGAGGAATACTACAAGCAGCGGGGATTCCTCAGCGAGT
ACATCAAGGACTTTCGTCTGCGTCGTTTTCGTCATCAATTCGACAAGTCA
CTGCCACTTGTCGCACCGGAGCAATACAAACACAATCTGAATCTCTGGTT
GGCCTCAAAGAACAGCCAGAGCACAATAAGCGGCTCAGATGTGTGCTCTA
CAATCGCTTCCATAGACAACAATCCGGCTCAGCAAAATAAAACTGGGCTC
TTTGAAGAAACGGATAGGTTATCCGAGCACAGCGTGGATGATGTG---GC
AATGTCACCGCTGATATTCGAGTATTCCGAGTCTGACGATGAACCCCTAA
CAGTAGAACCTGATGCAGATCAAAACCCGGTATTAGTTGTATCCAGCGAT
GATTGTGAGATTGTAACACCTCCAAGTACTCCGCAAAATCGAACGCCCTC
ATTAAATGAATCACCAAGGACGAAATCAAAGAAAAAATTTAGCAAAAAAA
CGTCACCGCGCAAAAAAGCTGATCTCACCGATTCCGAAGAGGATGATGAA
GCGACCGATAATATGCCGCCAAGGAAGAGAACTCGTGCAGCCACCGTTCA
TCTGACACCTAAGACAAGGAGACTCAATGTTCGAATTTTAAGGGTTTCCC
TCGATACTCTGAGCACACCACCACCGTCCAGAACCACTACTGCGATCGTA
ACGCCCAAAACGGAGCCCACAGCTAGAAGAAAAAATCTGAAAAAGCGCAC
GGTGAGCCCAGTGGATGTGGGTCGTCCAGCCACAAGGGGAATGCAGCGCC
TAACACGATCCGCTGAAACAAAAATAAACAGTAAGTACTTGAAACATCGC
TCATTGGATGATGTCAAGCGTAGCTTTCCAAGGAGAGTCAAGTTGGAGGG
TAACCAAACGCCCAGAAGTAGCAAACAAATAGTGAAGCAGGAGCCTAAGT
CT------AAAGTCGGGCAGGAAAAGAAACAGAAGACGGTGGATGTACCT
GCTCAAGGAACTGCGAAACGAAAGCCTGGACGTCCGAGAAAATGCCAAAC
CAAGACTGAAGATTTGGGGAAGACAAAGACTAAGCCGAATTCAAAGCACT
TGCCACCTACTCCTCAAGTTCTCAGTGGTAGCTCGTTGTCCTCGGAGTAC
ATGCAATGTGCTCAGCGAATACCAGACAATTTGGATGCCATTGAGTCGCC
CGCTTTTCGTGTGCCCTTTACACCTCAACAAACTCCAATGCTTCTAACCT
TGCCGTCTACACACAATTTGCTCAACGATTCTGAGGTGGTGTCTATTCCG
CTTTACAAAGATCCAGTTGAGACAGTGGTGATCAATAGCTCGCACGATGA
GTGTTCTCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCTTTGAAAA
GAAAACGCAAACCCGTGACGTCCGTCAATTCAAGTTTCGGCGGCGGATTG
GGTCTACCACCGGCCAAGAGGAGTGCCAAC---AAATCTCCAGATCTATT
TAGCATATCCTCGGAACACTCGCAGATTCCGCTGGCGCAACCAAGACCCT
CATCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTGAAGCAGTTT
CAGCAGCAGCTAGCGAAAGTAAATATATCGGTGCCAAAAAAGAAGCGAGA
TCGCTCGTGTTTGGATATCCTGGAGCAAATGTTCGAGCCACGA---CAAC
AGCAGTCGGCTAAAACTAGTCCCAAAGTCTTGCCAACCTTGCCACTGACC
CAGAAGGATGATGCAGAGTCTACCATTACGCAGAGAAGAAGAACCCTGCT
GGAAGATGACTTCTTTGAGATAACGAACAATGGCCAATTTGGCAGTCGCA
TGCGATTGAACTCCTCTGGCGAAGTATCGCCCGTGCAACCGGATCAACAG
TCCGTCAGGCCGTCGCAGGCCAATAAAATCACCAATTATTTGATAGGTTC
TGGAATTACGCAGGAGCGAACGCAACCTTCGAATGGTAATCGCAATTCCA
TTCTTGCATCGCTGCGCAAGTCACCCAAATCTCCCAAACAGGGTGCTAAA
TCCACTCAGGCCACGAAACTAACACGCTGGTTTGGCTCCGTCTTCGGCGG
TGGAGCCTCACAGACCAGCTCCGTGGAATCGGTTAGTGCACCAAGTACGC
CGGTGAATTCATCCACAAGTGCAGCAGCTTGTCAAACGCGATCGGCGAGA
AGTGGTGGAGCATCAGGACCGACCAAAAGAAAGCGATTGGAACTGTTCAA
G---------------------------------
>C2
ATGTATCACTTTGTATCCGAGCAAACGCCGGAGTTGCGGCTCTCGGAGGA
GGCACTAGTCACAGGCCACGTGACGCAGTACCTCAAGAGCTTCCAACTGG
ATGCTGTCCGTTTCGTATACGATCGTCTGTCCAAGCATGAATTCTGCATC
CTGAATGATGAGAGTGGCCTAGGAAAAGTCGCCACGGTGGCGGCACTTCT
AAGTGCCCTGCCACCCGCCAAAAAAACACTTGTCGTGCTCCAGAACGATG
AGCAACTGCTCACCGGTTGGCGATTTCATTTGGACACTCTCACTGACCTC
CAGGTGTACATCATTCAGGGGGTGAAAGATACCACCGACTCCCCGCACAG
CGTTTACCTGGCGAAATGGAGCCAACTACGGAGCATTGGAGATCTCAGTC
GCCTCAAGTTCGACTACATTATGGTGGATAATCGGGGGCACTCGCTGAAC
AACAACTTTTGCACTTCCATGCTGCTGAAGCAATTCGAGGGACGGGTAAA
CGTTCTTATCTCCAGTGTTGACATTACGTCTGACGTAAGGTTGCTCTACA
ATGTTCTACGTTTGGGCGGCCGATTGGAGCATCAGTACAAAAGCTTTGCG
AGCTTCGATCGCAAATTCCACCTGCCAGATCCGAAGGAAGTATTCAGCAA
GCGTATAGATCTCGAGGAATACTACAAGCAGCGGGGATTCCTCAGCGAGT
ACATCAAGGACTTTCGTCTGCGTCGTTTCCGCCATCAATTCGACAAGTCG
CTGCCTCTTGTCGCACCGGAGCAATACAAACACAATCTGAATCTCTGGTT
GGCCTCAAAAAACAGCCAGAGCACAATAAGCGGCTCAGAGGTTTGCTCTA
CAATCGCTTCCATAGAACACAATCCGGCTCAGCAAAATAAAACTGGTCTA
TTTGAAGAATCGGAC---------------AGTGTAGATGATGTG---GC
AATGTCACCGCTGATATTCGAGTCCTCCGAATCTGACGATGAACCCCTAA
CAGTAGAACCTGGTGCAGATCAAAACCCGGTATTAGTTGTATCCAGCGAT
GATTGTGAGATTGTAACACCTCCAAATACTCCGCCAAATCGAACGCCGTC
ATTAAATGAATCGCCAAGGACGAAATCAAAGAAACAATATAGCAAGAAAA
TGTCGCCGCGCAAAAAAGCTGATCTCACCGATTCCGAAGAGGATGATAAA
GCGATGGATAATATGCCGCCAAAAAAGAGAACTCGTGCGGCCACCGTTCA
TCTAACACCCAAGACAAGGAGACTCAATGTTCGAATTTTGAGGTGTTCCC
TAGATAATCTAAGCACCCCACCACCGTCTAGAACCACTACTGCGATCGTA
ACACCGAAAACAGAGCCCTCAGCTAGAAGAAAAAATCTGAAAAAGCGCAC
GGTGAGCCCAGTGGATGTGGGTCGTCCAGCCACAAGGGGAATGCAGCGCC
TAACACGATCCGCTGAAACAAAACTAAACAGCAAGTACTTGAAACACCGC
GCATTGGATGATGTCAAGCGTAGCGCTCCAAGGAGAGTCAAGATTGGATG
TACCCAAAAGCTCAGGAGTAGCAAACGAATAGTGAAGCAGGAGCCTATGT
CT------AAAGCCGAGCAGGAAAACAAAGAGAAGACGGTGAACGAACCT
GCTCAAGAAACTCCGAAACGAAAGCCTGGACGTCCGAGAAAATGCAAAAC
TATGACTGAAGATTTGGGGAAGACAACGACTAAGCCGGATTCAAACTCCT
TGCCATCTACTCCTCAAGTTCTCAGTGGCAGCTCCTTGTCCTGGGAGTAC
ATGCAATGTGCTCAGCGAATACCAGACAATTTGGACGCCATTGAGTCGCC
TGCTTTCCGTGTGCCCTTTACACCTCAACAAACTCCAGTGCTTCTAACGC
TGCCGTCTACTCACAACTTGCTCAACGACTCTGAGGTGGTGGCAATTCCG
CTTCACAAAGAGCAAGTTGAGACAGTGGTGATCAACAGCTCCCACGATGA
GAGTTCGCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCTTTGAAAA
GAAAACGCAAACCAGTGACGTCTGTCAATTCAAGTTTTGGCGGGGGATTG
GGTCTACCACCGGCCAAGAGGAGTGCCAAC---AAATCTCCAGATCTGTT
TAGCATATCCTCGGATCACTCCCAGATTCCGCTGGCGCAACCGCGACCTT
CGTCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTGAAGCAGTTT
CAGCAGCAACACGCGAATGTAAATATATCAGTGCCAAAAAAGAAACGAGA
TCGCTCGTGTTTGGATATACTAGAGCAAATGTTCGAGCCACGA---CAAC
AGCAGTCGACGAAAACTAGTCCCAAAGTCTTGCCAACCTTGCCACTGACC
CAGAAGGATGATGCAACGCCCACCATAACGCAGAGGAGAAGAACCCTGCT
GGAAGATGACTTTTTCGAGATAACGAACAATGGCCAATTTGGCAGTCGCA
TGCGGTTGAATTCCTCTGGCGAGGTCTCGCCCGTGCAACCGGATCAGCCG
TCCGTCAGGTCGTCGCAGGCCAATAAAATCACCAATTACTTGATAGGTTC
CGGAATTACCCAGGAGCGAACGCAGCCCTCCAATGGTAATCGCAACTCCA
TTGTCGCATCGCTGCGCAAGTCACCCAAATCTCCGAGACAGGCTGCTAAA
TCCACGCAGGCCACGAAGCTCACACGCTGGTTTGGCTCGGTCTTCGGCGG
AGTAATCTCACAGACCAGCTCCGTAGAATCGGTCAGTGCACCAAGTACGC
CGGTCAATTCATCCACAAGTGCAGCTGCGTGTCAAACGCGATCGGCGAGA
AGTGGTGGAGCATCAGGACCGACCAAAAGAAAGCGACTGGAACTGTTCAA
G---------------------------------
>C3
ATGTATCACTTTGTATCCGAGCAAACGCCGGAGTTGCGGCTCTCGGAGGA
GACACTGGTCACAAGCCACGTGACGCAGTACCTCAAGAGCTTCCAACTGG
ATGCTGTCCGTTTCGTCTACGATCGTCTGTCCAAACGGGAATACTGCATC
CTTAATGATGAGAGTGGCCTTGGAAAGGTCGCTACGGTGGCGGCACTTCT
AAGTGCCCTACCACCCGCCAAAAAAACACTTGTGGTGCTTCAGAACGATG
AGCAACTGCTCACCGGTTGGCGATTCCATTTGGACACTCTCACTGACCTC
CAGGTGTACATCATTCAGGGGGTGCAAGATACCACCGAATCCCCGCACAG
CGTTTACCTGGCAAAATGGAGCCAACTACGGAGCATTGGAGATCTCAGTC
GCCTCAAGTTCGACTACATTATGGTGGATAATCGAGGGCACTCGCTGAAC
AACAGCTTTTGCACTTCCATGCTGCTGAAGCAATTCGAGGGACGGGTGAA
CGTTCTTATCTCCAGTGTTGACATTACGTCCGACGTTAGGTTGCTCTACA
ATGTTCTACGGTTGGGCGGCCGACTGGAGCATCAGTACAAAAGCTTTGCG
AGCTTCGATCGTAAATTCCACCTGCCAGATCCGAAGGAGGTATTCAGCAA
GCGCATAGATCTCGAGGAATACTACAAGCAGCGGGGATTCCTCAGCGAGT
ACATCAAAGACTTTCGTCTGCGTCGTTTCCGTCATCAATTCGACAAGTTG
CTGCCTCTTGTCGCACCGGAGCAATACAAACACAATCTGAATCTCTGGTT
GGCCTCAAAAAACAGCCAGAGCACAATAAGCGGCTCAGAGGTTTGCTCTA
CAATCGCTTCCATAGAAAACAATCCGGCTCAGCAAAATAAAACTGGGCTC
TTTGAAGAATCGGAC---------------AGTGTAGATGATGTG---GC
AATGTCACCGCTGATATTCGAGTCCTCCGAATCTGACGATGAACCCCTAA
CAGTAGAACCTGGTGCAGATCAAAACCCGGTATTAGTTGTATCCAGCGAT
GATTGTGAGATTGTAACACCTCCAAATACTCCGCCAAATCGAACGCCCTC
ATTAAATGAATCGCCTAAGACGAAATCAAAGAAAAAATATAACAAGCAAA
CGTCGCCGCGCAAAAAAGCTGATCTCACCGATTCCGAAGAGGATGAT---
------GAAGCGATGCCGCCAAGGAAGAGAACTCGTGCGGCCACCGTTCA
TCTAACACCCAAGACAAGGAGACTCAATGTTCGAATTTTAAGGTGTTCCC
TAGATAATCTAAGCACGCCACCACCGTCTAGAACCACTACTGCGATCGTA
ACACCGAAAACAGAGCCCTCAGTTAGAAGAAAAAATGTGAAAAAGCGCAC
GGTGAGCCCAGTGGATGTGGGTCGTCCAGCCACAAGGGGAATGCAGCGCC
TAACACGATCCGCTGAAACAAAACTAAACAGCAAGTACTTGAAACACCGC
ACATTGGATGATGTCAAGCGTAACTTTCCAAGGAGAGTCAAGATTGAGGG
GACCCAAACGCCCAGGAGTAGCAAACGAAAAGTGAAGCAGGAGCCTAAGT
CT------AAAGCCGAGCAGGAAAAGAAACAGAAGACGGTGGACAAACCT
GCTCAAGAAACTCCGAAACGAAAGCCTGGACGTCCGAAAAAATGCAAAAC
TATGACTGAAGATTTGGGAAAGACAACGACTAAGCCGGATTCAAACCCCT
TGCCATCTACTCCTCAAGTTCTCAGTGGCAGCTCCTTGTCGTCGGAGTAC
ATGCAATGTGCTCAGCGAATACCAGACAATTTGGATGCCATTGAGTCGCC
TGCTTTCCGTGTGCCCTTCACACCTCAACAAACTCCAATGCTTCTAACGC
TGCCGTCTACTCATAACTTGCTCAACGACTCCGAGGTGGTGGCTATTCCG
CTTCACAAAGATCAAGTTGAGACAGTGGTGATCAACAGCTCCCACGATGA
GAGTTCGCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCTTTGAAAA
GAAAACGCAAACCCGTGACGTCCGTTAATTCAAGTTTTGGCGGAGGATTG
GGTCTACCACCGGCCAAGAGGAGTGCCAAC---AAATCTCCAGATCTGTT
TAGCATATCCTCGGATCACTCCCAGATTCCGCTGGCGCAACCGCGACCCT
CGTCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTTAAGCAGTTT
CAGCAGCAACACGCGAATGTAAATATATCAGTGCCAAAAAAGAAGCGAGA
TCGCTCGTGCTTGGATATCCTGGAGCAAATGTTCGAGCCACGA---CAAC
AGCAGTCGACGAAAACTAGTCCCAAAGTCTTGCCAACCTTGCCACTGACC
CAGAAGGATGATGCAACGCCTACGATTACGCAGAGGAGAAGAACCCTGCT
GGAAGATGACTTCTTCGAGATAACGAACAATGGCCAGTTTGGCAGTCGCA
TGCGGTTGAACTCCTCTGGCGAGGTCTCGCCCGTGCAACCGGATCAACCG
TCCGTCAGGCCGTCGCAGGCCAATAAAATCACCAATTACTTGATAGGTTC
CGGAATTACCCAGGAGAGAACGCAACCCTCCAATGGTAATCGCAACTCCA
TTGTCGCATCGCTGCGCAAGTCACCCAAATCTCCGAGACAGGCTGCTAAA
TCCACGCAGGCCACGAAGCTAACACGCTGGTTTGGCTCGGTCTTCGGCGG
AGTAGGCTCACAGACCAGCTCCGTGGAGTCGGTCAGTGCACCAAGTACGC
CGGTTAATTCATCCACAAGTGCAGCTGCGTGTCAAACGCGATCGGCGAGA
AGTGGTGGAGCATCAGGACCGACCAAAAGAAAGCGACTGGAACTGTTCAA
G---------------------------------
>C4
ATGTATCACTTTGCATCCGAACAAACACCGGAGTTGCGGCTTTCGGCAGA
GGCACTGGTCACGAGCCACGTGACGCAGTACCTCAAGGGCTTCCAGCTGG
ATGGAGTGCGCTTCGTCTACGATCGTCTGGCCAGGCGCGAATTCTGCATC
TTGAATGATGAGAGTGGGCTTGGAAAAGTCGCCACGGTGGCGGCGCTACT
CAGTGCCCTGCCTCCCGCCAAGAAAACACTTGTGGTGCTGCAGAACGATG
AGCAACTGCTCACCGGTTGGCGGTTCCATTTGGACACTCTCACTGACCTT
CAGGTGTACATCATTCAAGGGGTGCACGACACCACAGACTCACCGCACAG
CGTTTACCTGGCGAAATGGAGCCAGCTACGGAGCATTGGAGATCTCAGTC
GCCTCAAGTTCGACTACATTATGGTGGACAATCGGGGGCACTCGCTGAAC
AACAGCTTTTGCACTTCCATGCTGCTGAAGCAATTCGAGGGACGCGTAAA
CGTTCTTATCTCCAGTGTTGACATTACGTCCGACGTGAAGTTGCTATACA
ATGTTTTACGGTTGGGCGGCCGACTGGAGCATCAGTACAAAAGCTTTGCA
AGCTTTGATCGCAAATTCCACCTGCCAGATCCGAAGGAGGTATTCAGCAA
GCGCATAGATCTCGAGGAATACTACAAGCAGCGGGGATTCCTCAGCGAGT
ATATCAAGGACTTTCGTCTGCGTCGTTTTCGCCATCAATTCGACAAGACG
CTGCCCTTTGTCGCACCGGAGCAATATAAGCACAATCTGAACCTCTGGTT
GTCCTCCAAAAACAGCCAGAGCACACTAAGTGGCTCAGAGGTGTGCTCAA
CAGTCGCTTCCATCGACAACAATCCGGCTCAGCAAAATGAAGCAGTGCTC
GTCGAGGAATCGGATAAGTTATCCGAGCATAGCGTAGATGATGTTGTGGC
AATGTCACCGCTGATATTCGAGTCCTCCGAATCTGACGATGAACCCATAA
CAGTGGAAGCTCCAGCAAGTGAAAACCCGGTATTAGTTGTATCCAGCGAT
GATTGTGAGATTGTGACTCCTCCAAATACACCGCCGAATCGAATGCCTAT
ATTAAGTGAATCGCCAAGGACGAAATCAAAGAAAAAATTTACCAAGAAAT
CGTCGCCGAGCAAAAAAGCTGATCTCACCGATTCCGAAGAGGATGATGAA
GCG---TTGACAATATCGCCAAGAAAGAGAACTCGTGCGGCTACCGTTCA
TTTTACACCCAAGACAAGGAGACTCAATGTGCGAATTCTAAGGGTCTCTC
TAGATACTCTGAGCACACCACCTCCCTCTGGAGCCACCACTGCCATCGTA
ACGCCCAAGACAGAGCCCTCAGCTAGAAGAAAATATCAGAAAAAGCGGCC
GGTGAGCCCAATGGATGTGGGTCGTCCAACTACAAGAGGAATGCAGCGCT
TGACACGATCCGCTGAATCAAAAATAAACAGCAAGTACTTGAAGCACCAC
GCACTGGATGATGCCAAGCGTAGCTTGCCCAGGAGAATCAAGGCTGAGGG
GAACCAAACGCCCAAATCTAGCAAACGAATAGTGAAGCAGGAGCCTAAGG
CAAGGCCCAAGCCCGAGCAGGAAAAGGAACCAAAGACTGTGGACAAACCT
GCACAAGAAACTCCGAAACGAAAACCTGGACGCCCGAGAAAATCAAAAAC
GGTGACTGAAACTTTAGAAAAGTCAAAGACTAAGCCGGATTCAAAACCCA
TGCCACCAACTCCTCAAGTTCTCAGTGGAAGCTCCTTGTCCTCGGAGTAC
ATGCAATGTGCTCAGCGTATACCAGACAATTTGGATGCCATTGAGTCACC
TGCCTTCCGAGTACCCTTCACGCCCCAACAAACTCCTATGCTTCTAACCT
TGCCGTCTACTCACAACTTGCTCAACGACTCTGAGGTCGTGGCTATTCCA
CTTTCCAAAGATCCCGTTGAAACGGTGGTGATCAACAGCTCCCACGATGA
GAGTTCGCCGCAGGATCCATCGCAGAGTCGGCGCACCAAGGCGTTAAAAA
GAAAACGCAAACCCGAGGCGCCTGTCAATTCAAGTTTCGGCGGTGGATTG
GGTCTGCCACCGGCTAAGAGGAGTGCCAAC---AAATCTCCAGATCTGTT
TAGCATATCCTCGGATCTCTCGCAGATTCCTCTGGCACAGCCACGACCCT
CATCGCCCTTCGAAGGCTTTAAGATCTTTGGCTCTGAGGTGAAGCAGTTT
CAGCAGCAGCACGCGAAAGTAAATACACCAGCGCCGAAAAAGAAGCGAGA
TCGCTCGTGTTTGGATATCCTGGAGCAAATGTTCGAGCCACGGGAGCAGC
AGGAGTCGGCTAAAACTAGTCCCAAAGTCTTGCCCACCTTGCCACTGACC
CAGAAAGATGATGCAGCGCCTACCATTACGCAGCGAAGAAGAACCCTCCT
GGAGGATGACTTCTTTGAGATAACGAACAACGGCCAGTTTGGCAGTCGCA
TGCGGTTGAACTCCTCCGGAGAGGTTTCGCCCGTGCAACAGGATCAGCAG
TCCGTCAGGCCGTCGCAGGCCAATAAAATCACTAAATACTTGATAGGTTC
TGGAATTACCCAGGAGAAGACACAGCCTTCTAATGGCAATCGCAACTCCA
TCGTCGCATCGCTGCGCAAGTCCCCAAAATCGCCGAAACAGAGTGCAAAA
ACCACTCAAGCCACGAAGCTAACGCGCTGGTTTGGCTCCGTCTTCGGAGG
AGGAGCCTCACAGACCAGCTCCGTGGAGTCGGTCAGCGCACCGAGTACCC
CGGTTAATCCTTCCACGAGTGCAGCAGCGTGTCAAACGCGATCGGCGCGA
AGTGGTGGAGCCTCGGGACCCAGCAAAAGAAAGCGATTGGAACTGTTCAA
G---------------------------------
>C5
ATGTATCACTTCGTATCCGAACAAACGCCGGAGTTGCGGCTCTCAGCGGA
GACACTGGTCACGAGCCACGTGACGCAGTACCTCAAGAGCTTCCAGCTGG
ATGCAGTGCGCTTCGTCTACGATCGGCTGGCAAAGCGCGAGTTCTGCATC
TTAAATGATGAGAGTGGTCTTGGAAAAGTCGCCACGGTGGCGGCACTACT
AAGTGCGCTTCCACCCGCCAAGAAAACACTTGTGGTTCTCCAGAACGATG
AGCAACTGCTCACCGGTTGGCGATTCCATTTGGACACTCTCACTGACCTC
CAAGTGTACATCATTCAAGGGGTGCACGACACCACAGACTCGCCGCACAG
CGTTTACCTGGCGAAATGGAGCCAACTACGGAGCATTGGAGATCTCAGTC
GCCTCAAGTTCGACTACATTATGGTGGATAATCGGGGGCACTCGCTGAAC
AACAGCTTTTGTACTTCCATGCTGCTGAAGCAATTCGAGGGACGGGTAAA
CGTTCTTATCTCTAGTGTTGACATTACGTCCGACGTGAAGTTGCTCTACA
ATGTTTTACGACTGGGCGACCGACTAGAGCATCAGTACAAAAGCTTTTCA
AGGTTCGATCGCAAATTCCACCTGCCAGATCCAAAGGAGGTATTCAGCAA
GCGCATAGATCTCGAGGAATACTACAAGCAGCGCGGATTCCTCAGCGAGT
ATATCAAGGACTTTCGTCTGCGTCGTTTCCGTCATCAATTCGACAAGACC
CTGCCACTTGTCGCACCGGAGCAATACAAGCACAATCTGAATCTCTGGTT
GGCCTCTAAAAACAGCCAGAGCACATTAAGTGGCTCAGAGGTGTGCTCTA
CAGTCGCTTCCATAGAAAACAATCCGCCTCAGCAAAATGAAACTGTGCTC
GTTGAAGAATCGGATAGGATATCCGAGCATAGCGTAGATGATGTTGTGGC
AATGTCACCCCTGATATTTGAGTCCTCCGAATCTGACGATGAACCCATAA
CCGTAGATCCCGTAGCAAATGAAAACCCGGTATTAGTTGTATCCAGCGAT
GATTGTGAGATTGTGACTCCTCCAAATACACCGCCGAATCGAACGCCCTT
AGTAAATAAATCGCCAAGGACGAAATCAAAGAAGAAATGTAGCAAGAAAC
CGTCACCGTGCAAAGAAGCAGATCTCACCGATTCCGAAAAGGATGATGAA
GGG---TTGACAATGCCGCCAAGAAAGAGTACTCGTGCGGCTACCGTTCA
TTTTACACCCAAGACAAGAAGACTTAATGTGCGACTTTTAAGGGTTTCCC
TAGATGCTCTAAGCACACCAGCCCCGTCTGGAGCCACTACTGCGATCATA
ACGCCCAAAACAGAGCCCTCAGCTAGAAGAAAAAATCGGACAAAACAG--
-------CCAATGGATGTGGGTCGCCCAGCTACAAGAGGAATGCAGCGCC
TAACACGATCCGCTGAATCAAAAATAAACAGCAAGTACTTGAAGCACCAC
GTACTTGATGATGCCAAGCGTAACTTTCCAAGAAGAATCAAGGCTGAGGG
GAACCAAACACCCAAAACTAGCAAACGAATAGTGAAGCAGGAGTCCAAGG
CAAAGGCTAAACCCGAGCAGAAAAAGAAAATAAAGACCGTGGACAAGCCT
GCTCAAGAAACTCCGAAACGAAAACCTGGACGTCCGAGAAAGTGCAAAAC
GCTGACGGAAACTTTAGGGAAGTCAAAGACTAAGCCGAATTCAAAGCCCT
TGCCACCTACTCCTCAAGTTCTCAGTGGTAGCTCTTTGTCCTCGGAGTAC
ATGCAATGTGCTCAGCGTATCCCAGACGATTTGGATGCCATTGAGTCACC
AGCTTTCCGGGTGCCTTTCACGCCCCAACAAACTCCTATGCTTCTAACCT
TGCCGTCTACTCACAATTTGCTTAACGACTCTGAAGTGGTGGCTATTCCG
CTTTTCAAAGATCAAGTTGAAACAGTGGTGATCAACAGCTCCCACGATGA
GAGTTCCCCGCAGGATCCATCGCAGAGTCGTCGCACCAAGGCGTTAAAAA
GAAAACGCAAACCCGACGCGCCTGTCAATTCAAGCTTTGGCGGGGGATTG
GGTCTACCACAGGCTAAGAGGAGTGCCACCAACAAATCTCCAGATCTGTT
TAGCATATCCTCTGATCTCTCACAGATTCCTCTGGCGCAGCCACGACCCT
CATCGCCCTTCGAAGGCTTCAAGATCTTTGGCTCTGAGGTGAAGCAGTTT
CAGCAGCAGCATGCGAAAGTAACTATACCAGCGCCAAAAAAGAAGCGAGA
TCGCTCGTGTTTGGATATCCTAGAGCAAATGTTCGAGCCACGA---CAAC
AGCAGTCGTCTAAAACTAGTCCCAAAGTCTTGCCTACCTTGCCACTGATC
CAGAAAGATGATGCAACAACTACCTTTACGCAGAGAAGAGTAACTCTCCT
GGAAGATGACTTCTTTGAGATAACGAACAATGGGCAGTTTGGCAGTCGCA
TGAGGTTGAACGCTTCTGGAGAGGTCTCGCCCGTGCAACAGGATCAACAG
TCCGTCAGGCCGACGCAGGCCAATAAAATCACAAATTACTTGATTGGTTC
TGGAATTACCCAGGAGCGAACGCAGCCTTCTAATGGTAATCGCAACTCCA
TCGTCGCATCGCTTCGCAAGTCCCCCAAATCCCCGAAACATGGTGCAAGA
ACCACTCAAGCCACGAAGTTAACGCGCTGGTTTGGCTCGGTCTTCGGAGG
AGGAGCCTCACAGACCAGCTCCGTGGAATCGGTTAGCGCACCGAGTACCC
CGGTAAATCCTTCCACAAGTGCAGCAGCATGTCAAACGCGAACGGCGAGA
AGTGGTGGAGCCACAGGACCCACCAAAAGGAAGCGATTGGAACTGTTCAA
G---------------------------------
>C1
MYHFVSEQTPEVRLTDEALVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDVTSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSDVCSTIASIDNNPAQQNKTGL
FEETDRLSEHSVDDVoAMSPLIFEYSESDDEPLTVEPDADQNPVLVVSSD
DCEIVTPPSTPQNRTPSLNESPRTKSKKKFSKKTSPRKKADLTDSEEDDE
ATDNMPPRKRTRAATVHLTPKTRRLNVRILRVSLDTLSTPPPSRTTTAIV
TPKTEPTARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKINSKYLKHR
SLDDVKRSFPRRVKLEGNQTPRSSKQIVKQEPKSooKVGQEKKQKTVDVP
AQGTAKRKPGRPRKCQTKTEDLGKTKTKPNSKHLPPTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVSIP
LYKDPVETVVINSSHDECSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSANoKSPDLFSISSEHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQLAKVNISVPKKKRDRSCLDILEQMFEPRoQQQSAKTSPKVLPTLPLT
QKDDAESTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQQ
SVRPSQANKITNYLIGSGITQERTQPSNGNRNSILASLRKSPKSPKQGAK
STQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFK
>C2
MYHFVSEQTPELRLSEEALVTGHVTQYLKSFQLDAVRFVYDRLSKHEFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVKDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NNFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKS
LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIEHNPAQQNKTGL
FEESDoooooSVDDVoAMSPLIFESSESDDEPLTVEPGADQNPVLVVSSD
DCEIVTPPNTPPNRTPSLNESPRTKSKKQYSKKMSPRKKADLTDSEEDDK
AMDNMPPKKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIV
TPKTEPSARRKNLKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHR
ALDDVKRSAPRRVKIGCTQKLRSSKRIVKQEPMSooKAEQENKEKTVNEP
AQETPKRKPGRPRKCKTMTEDLGKTTTKPDSNSLPSTPQVLSGSSLSWEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPVLLTLPSTHNLLNDSEVVAIP
LHKEQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSANoKSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHANVNISVPKKKRDRSCLDILEQMFEPRoQQQSTKTSPKVLPTLPLT
QKDDATPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQP
SVRSSQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAK
STQATKLTRWFGSVFGGVISQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFK
>C3
MYHFVSEQTPELRLSEETLVTSHVTQYLKSFQLDAVRFVYDRLSKREYCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVQDTTESPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVRLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKL
LPLVAPEQYKHNLNLWLASKNSQSTISGSEVCSTIASIENNPAQQNKTGL
FEESDoooooSVDDVoAMSPLIFESSESDDEPLTVEPGADQNPVLVVSSD
DCEIVTPPNTPPNRTPSLNESPKTKSKKKYNKQTSPRKKADLTDSEEDDo
ooEAMPPRKRTRAATVHLTPKTRRLNVRILRCSLDNLSTPPPSRTTTAIV
TPKTEPSVRRKNVKKRTVSPVDVGRPATRGMQRLTRSAETKLNSKYLKHR
TLDDVKRNFPRRVKIEGTQTPRSSKRKVKQEPKSooKAEQEKKQKTVDKP
AQETPKRKPGRPKKCKTMTEDLGKTTTKPDSNPLPSTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LHKDQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPVTSVNSSFGGGL
GLPPAKRSANoKSPDLFSISSDHSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHANVNISVPKKKRDRSCLDILEQMFEPRoQQQSTKTSPKVLPTLPLT
QKDDATPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQPDQP
SVRPSQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPRQAAK
STQATKLTRWFGSVFGGVGSQTSSVESVSAPSTPVNSSTSAAACQTRSAR
SGGASGPTKRKRLELFK
>C4
MYHFASEQTPELRLSAEALVTSHVTQYLKGFQLDGVRFVYDRLARREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGGRLEHQYKSFA
SFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
LPFVAPEQYKHNLNLWLSSKNSQSTLSGSEVCSTVASIDNNPAQQNEAVL
VEESDKLSEHSVDDVVAMSPLIFESSESDDEPITVEAPASENPVLVVSSD
DCEIVTPPNTPPNRMPILSESPRTKSKKKFTKKSSPSKKADLTDSEEDDE
AoLTISPRKRTRAATVHFTPKTRRLNVRILRVSLDTLSTPPPSGATTAIV
TPKTEPSARRKYQKKRPVSPMDVGRPTTRGMQRLTRSAESKINSKYLKHH
ALDDAKRSLPRRIKAEGNQTPKSSKRIVKQEPKARPKPEQEKEPKTVDKP
AQETPKRKPGRPRKSKTVTETLEKSKTKPDSKPMPPTPQVLSGSSLSSEY
MQCAQRIPDNLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LSKDPVETVVINSSHDESSPQDPSQSRRTKALKRKRKPEAPVNSSFGGGL
GLPPAKRSANoKSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHAKVNTPAPKKKRDRSCLDILEQMFEPREQQESAKTSPKVLPTLPLT
QKDDAAPTITQRRRTLLEDDFFEITNNGQFGSRMRLNSSGEVSPVQQDQQ
SVRPSQANKITKYLIGSGITQEKTQPSNGNRNSIVASLRKSPKSPKQSAK
TTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRSAR
SGGASGPSKRKRLELFK
>C5
MYHFVSEQTPELRLSAETLVTSHVTQYLKSFQLDAVRFVYDRLAKREFCI
LNDESGLGKVATVAALLSALPPAKKTLVVLQNDEQLLTGWRFHLDTLTDL
QVYIIQGVHDTTDSPHSVYLAKWSQLRSIGDLSRLKFDYIMVDNRGHSLN
NSFCTSMLLKQFEGRVNVLISSVDITSDVKLLYNVLRLGDRLEHQYKSFS
RFDRKFHLPDPKEVFSKRIDLEEYYKQRGFLSEYIKDFRLRRFRHQFDKT
LPLVAPEQYKHNLNLWLASKNSQSTLSGSEVCSTVASIENNPPQQNETVL
VEESDRISEHSVDDVVAMSPLIFESSESDDEPITVDPVANENPVLVVSSD
DCEIVTPPNTPPNRTPLVNKSPRTKSKKKCSKKPSPCKEADLTDSEKDDE
GoLTMPPRKSTRAATVHFTPKTRRLNVRLLRVSLDALSTPAPSGATTAII
TPKTEPSARRKNRTKQoooPMDVGRPATRGMQRLTRSAESKINSKYLKHH
VLDDAKRNFPRRIKAEGNQTPKTSKRIVKQESKAKAKPEQKKKIKTVDKP
AQETPKRKPGRPRKCKTLTETLGKSKTKPNSKPLPPTPQVLSGSSLSSEY
MQCAQRIPDDLDAIESPAFRVPFTPQQTPMLLTLPSTHNLLNDSEVVAIP
LFKDQVETVVINSSHDESSPQDPSQSRRTKALKRKRKPDAPVNSSFGGGL
GLPQAKRSATNKSPDLFSISSDLSQIPLAQPRPSSPFEGFKIFGSEVKQF
QQQHAKVTIPAPKKKRDRSCLDILEQMFEPRoQQQSSKTSPKVLPTLPLI
QKDDATTTFTQRRVTLLEDDFFEITNNGQFGSRMRLNASGEVSPVQQDQQ
SVRPTQANKITNYLIGSGITQERTQPSNGNRNSIVASLRKSPKSPKHGAR
TTQATKLTRWFGSVFGGGASQTSSVESVSAPSTPVNPSTSAAACQTRTAR
SGGATGPTKRKRLELFK


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/408/SuUR-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 2934 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1481113088
      Setting output file names to "/opt/ADOPS/408/SuUR-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 139242081
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 7502167134
      Seed = 1413846104
      Swapseed = 1481113088
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 92 unique site patterns
      Division 2 has 72 unique site patterns
      Division 3 has 145 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -8387.610798 -- -25.624409
         Chain 2 -- -8385.525594 -- -25.624409
         Chain 3 -- -8389.980300 -- -25.624409
         Chain 4 -- -8218.418224 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -8059.005027 -- -25.624409
         Chain 2 -- -8356.073433 -- -25.624409
         Chain 3 -- -8387.610798 -- -25.624409
         Chain 4 -- -8385.525594 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-8387.611] (-8385.526) (-8389.980) (-8218.418) * [-8059.005] (-8356.073) (-8387.611) (-8385.526) 
        500 -- (-7312.239) [-7251.147] (-7296.266) (-7313.393) * (-7306.026) [-7278.020] (-7294.666) (-7304.123) -- 0:33:19
       1000 -- (-7257.611) [-7219.249] (-7251.979) (-7264.034) * (-7269.917) (-7246.556) (-7280.541) [-7263.701] -- 0:16:39
       1500 -- (-7226.222) [-7203.329] (-7228.202) (-7235.153) * (-7233.382) (-7236.435) [-7239.701] (-7222.966) -- 0:11:05
       2000 -- (-7216.003) [-7195.315] (-7194.234) (-7210.565) * (-7215.183) (-7237.141) (-7203.646) [-7215.013] -- 0:08:19
       2500 -- (-7207.951) (-7195.160) [-7192.804] (-7207.080) * [-7196.139] (-7208.131) (-7198.362) (-7204.161) -- 0:13:18
       3000 -- (-7207.539) [-7197.838] (-7194.293) (-7202.886) * [-7194.138] (-7194.818) (-7206.041) (-7203.465) -- 0:11:04
       3500 -- (-7203.261) (-7195.240) (-7191.257) [-7201.440] * (-7196.395) (-7199.608) [-7199.241] (-7197.914) -- 0:09:29
       4000 -- (-7203.656) [-7199.810] (-7189.884) (-7200.003) * (-7195.788) [-7192.422] (-7197.681) (-7195.399) -- 0:08:18
       4500 -- [-7202.718] (-7197.697) (-7198.100) (-7194.084) * (-7196.557) (-7192.940) (-7197.742) [-7195.019] -- 0:07:22
       5000 -- (-7203.316) (-7204.089) (-7197.305) [-7196.269] * (-7200.446) [-7195.216] (-7194.555) (-7204.047) -- 0:09:57

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-7197.265] (-7191.287) (-7198.779) (-7199.710) * [-7200.170] (-7195.827) (-7195.303) (-7202.036) -- 0:09:02
       6000 -- (-7197.376) [-7191.085] (-7195.450) (-7193.579) * [-7193.657] (-7195.507) (-7191.791) (-7196.910) -- 0:08:17
       6500 -- (-7195.681) (-7191.418) [-7194.600] (-7202.141) * (-7197.614) [-7195.405] (-7195.637) (-7200.108) -- 0:07:38
       7000 -- [-7200.477] (-7203.184) (-7201.617) (-7198.896) * (-7197.824) [-7195.067] (-7195.192) (-7196.428) -- 0:09:27
       7500 -- (-7204.018) (-7199.887) (-7197.229) [-7193.574] * [-7194.296] (-7194.448) (-7201.761) (-7197.338) -- 0:08:49
       8000 -- (-7204.792) [-7197.527] (-7196.951) (-7196.631) * (-7199.315) (-7199.087) [-7193.762] (-7200.654) -- 0:08:16
       8500 -- (-7198.064) [-7193.473] (-7196.215) (-7206.854) * [-7195.709] (-7195.997) (-7196.292) (-7195.843) -- 0:07:46
       9000 -- (-7193.693) (-7197.819) (-7193.611) [-7201.393] * (-7191.604) (-7195.802) (-7195.266) [-7193.619] -- 0:09:10
       9500 -- (-7193.726) [-7196.152] (-7200.031) (-7205.340) * (-7189.651) (-7194.176) [-7193.276] (-7205.234) -- 0:08:41
      10000 -- (-7195.499) (-7193.928) (-7196.129) [-7197.727] * (-7197.919) [-7193.158] (-7200.283) (-7196.983) -- 0:08:15

      Average standard deviation of split frequencies: 0.000000

      10500 -- [-7195.078] (-7201.030) (-7196.470) (-7203.195) * (-7199.299) (-7191.652) (-7202.999) [-7194.934] -- 0:07:51
      11000 -- (-7195.924) (-7195.794) (-7191.882) [-7194.369] * [-7199.754] (-7200.329) (-7195.635) (-7192.814) -- 0:07:29
      11500 -- (-7194.454) (-7203.220) [-7192.484] (-7199.205) * (-7197.338) (-7194.133) [-7194.571] (-7192.075) -- 0:08:35
      12000 -- (-7193.229) [-7198.050] (-7195.924) (-7196.979) * [-7201.773] (-7197.638) (-7193.532) (-7195.995) -- 0:08:14
      12500 -- (-7197.486) (-7194.703) [-7197.368] (-7200.226) * (-7192.427) [-7199.262] (-7197.202) (-7203.982) -- 0:07:54
      13000 -- [-7202.762] (-7199.764) (-7193.519) (-7192.083) * (-7193.199) (-7199.311) (-7196.975) [-7197.246] -- 0:07:35
      13500 -- (-7199.342) (-7195.035) (-7196.600) [-7197.316] * (-7195.097) (-7194.821) (-7195.726) [-7194.301] -- 0:08:31
      14000 -- [-7192.825] (-7194.705) (-7193.839) (-7192.416) * [-7198.040] (-7196.026) (-7196.309) (-7197.253) -- 0:08:13
      14500 -- (-7192.406) (-7200.569) [-7192.387] (-7192.412) * [-7195.804] (-7194.369) (-7195.395) (-7199.790) -- 0:07:55
      15000 -- [-7195.598] (-7194.722) (-7193.955) (-7196.162) * (-7194.719) [-7194.397] (-7194.080) (-7200.055) -- 0:07:39

      Average standard deviation of split frequencies: 0.000000

      15500 -- (-7200.078) (-7196.105) [-7194.542] (-7195.535) * (-7192.373) [-7196.681] (-7198.920) (-7201.153) -- 0:08:28
      16000 -- (-7192.879) [-7199.392] (-7196.969) (-7194.780) * [-7198.988] (-7197.398) (-7196.078) (-7203.084) -- 0:08:12
      16500 -- (-7198.407) (-7200.822) [-7201.184] (-7198.611) * (-7197.091) [-7195.764] (-7198.917) (-7195.585) -- 0:07:56
      17000 -- [-7197.235] (-7188.368) (-7191.158) (-7197.473) * (-7196.322) (-7200.129) [-7199.774] (-7198.273) -- 0:07:42
      17500 -- (-7203.058) (-7188.075) (-7192.870) [-7196.476] * [-7197.860] (-7202.850) (-7195.130) (-7196.836) -- 0:07:29
      18000 -- (-7194.842) [-7189.730] (-7202.092) (-7197.488) * [-7196.705] (-7196.717) (-7199.619) (-7198.713) -- 0:08:11
      18500 -- (-7197.738) (-7193.342) (-7207.058) [-7198.794] * (-7196.554) [-7191.484] (-7197.925) (-7198.414) -- 0:07:57
      19000 -- [-7195.817] (-7197.178) (-7201.149) (-7197.148) * (-7198.339) (-7192.585) (-7196.460) [-7192.341] -- 0:07:44
      19500 -- (-7200.555) (-7190.997) [-7194.639] (-7194.314) * [-7195.943] (-7194.109) (-7195.230) (-7194.567) -- 0:07:32
      20000 -- (-7200.882) (-7193.471) (-7200.761) [-7195.263] * (-7195.301) [-7191.127] (-7199.592) (-7194.715) -- 0:08:10

      Average standard deviation of split frequencies: 0.000000

      20500 -- [-7192.263] (-7194.419) (-7194.735) (-7198.848) * (-7191.929) (-7190.511) (-7198.740) [-7196.624] -- 0:07:57
      21000 -- (-7199.271) (-7194.830) (-7196.350) [-7195.588] * (-7195.895) (-7197.866) (-7194.284) [-7191.232] -- 0:07:46
      21500 -- (-7194.834) (-7194.272) [-7196.884] (-7203.727) * (-7192.013) [-7204.150] (-7197.837) (-7204.885) -- 0:07:35
      22000 -- (-7194.102) [-7195.567] (-7197.499) (-7195.561) * (-7195.397) [-7200.498] (-7193.484) (-7195.448) -- 0:07:24
      22500 -- (-7196.666) (-7196.294) (-7199.925) [-7203.462] * (-7201.009) [-7197.566] (-7192.490) (-7197.213) -- 0:07:57
      23000 -- (-7195.686) (-7193.437) (-7201.698) [-7198.243] * (-7192.891) [-7195.745] (-7193.592) (-7193.158) -- 0:07:47
      23500 -- (-7197.233) (-7200.303) [-7193.794] (-7200.203) * (-7195.503) (-7197.835) [-7191.188] (-7195.851) -- 0:07:37
      24000 -- (-7200.360) (-7198.402) [-7196.693] (-7200.002) * (-7203.747) [-7192.075] (-7192.835) (-7194.947) -- 0:07:27
      24500 -- [-7201.111] (-7205.046) (-7194.735) (-7196.897) * (-7201.909) [-7190.158] (-7194.113) (-7197.858) -- 0:07:57
      25000 -- (-7193.370) [-7199.243] (-7191.965) (-7199.623) * (-7203.390) [-7196.623] (-7195.981) (-7199.981) -- 0:07:48

      Average standard deviation of split frequencies: 0.000000

      25500 -- [-7193.184] (-7195.516) (-7199.118) (-7194.797) * (-7202.947) [-7192.096] (-7193.008) (-7198.110) -- 0:07:38
      26000 -- (-7200.102) [-7198.447] (-7205.148) (-7194.561) * (-7206.494) [-7190.880] (-7190.596) (-7198.817) -- 0:07:29
      26500 -- (-7198.331) [-7190.799] (-7202.169) (-7196.428) * (-7202.551) [-7192.369] (-7195.651) (-7200.036) -- 0:07:57
      27000 -- [-7195.066] (-7193.458) (-7198.340) (-7193.993) * (-7196.042) (-7201.185) (-7195.172) [-7197.640] -- 0:07:48
      27500 -- [-7196.638] (-7196.879) (-7200.451) (-7191.621) * (-7199.959) [-7194.808] (-7200.948) (-7195.683) -- 0:07:39
      28000 -- (-7196.390) (-7198.863) (-7198.030) [-7195.423] * (-7195.268) (-7194.210) [-7198.051] (-7206.003) -- 0:07:31
      28500 -- (-7198.050) (-7194.625) [-7198.933] (-7200.419) * (-7198.339) (-7191.697) (-7202.278) [-7196.280] -- 0:07:23
      29000 -- [-7202.323] (-7195.264) (-7194.175) (-7199.221) * (-7194.721) [-7200.928] (-7194.581) (-7192.295) -- 0:07:48
      29500 -- (-7197.348) (-7194.135) (-7194.363) [-7196.392] * (-7200.671) [-7204.300] (-7197.527) (-7193.183) -- 0:07:40
      30000 -- (-7196.439) [-7193.308] (-7193.556) (-7204.952) * (-7193.504) [-7201.171] (-7202.992) (-7195.201) -- 0:07:32

      Average standard deviation of split frequencies: 0.000000

      30500 -- [-7193.107] (-7193.548) (-7200.350) (-7197.088) * (-7194.509) [-7197.524] (-7201.778) (-7200.593) -- 0:07:25
      31000 -- [-7196.670] (-7199.218) (-7197.475) (-7195.216) * (-7201.244) [-7202.703] (-7196.444) (-7198.879) -- 0:07:48
      31500 -- [-7196.803] (-7193.813) (-7197.208) (-7193.104) * (-7195.278) (-7194.758) (-7199.675) [-7196.101] -- 0:07:41
      32000 -- (-7197.729) (-7198.152) [-7196.187] (-7193.689) * (-7205.331) (-7199.646) (-7194.487) [-7197.560] -- 0:07:33
      32500 -- (-7200.532) [-7198.049] (-7194.441) (-7199.412) * [-7194.874] (-7194.257) (-7197.537) (-7197.613) -- 0:07:26
      33000 -- (-7194.252) (-7191.846) (-7196.542) [-7201.672] * [-7196.148] (-7193.705) (-7198.477) (-7210.050) -- 0:07:48
      33500 -- (-7205.120) [-7194.448] (-7198.329) (-7198.122) * (-7195.907) [-7194.409] (-7198.746) (-7201.409) -- 0:07:41
      34000 -- (-7191.837) (-7192.193) (-7201.771) [-7198.967] * [-7197.220] (-7191.445) (-7203.139) (-7205.404) -- 0:07:34
      34500 -- (-7191.673) [-7197.106] (-7199.729) (-7201.026) * (-7197.081) (-7195.585) (-7194.918) [-7199.572] -- 0:07:27
      35000 -- (-7193.718) (-7201.551) (-7200.994) [-7200.545] * (-7205.315) [-7195.173] (-7194.413) (-7195.536) -- 0:07:21

      Average standard deviation of split frequencies: 0.000000

      35500 -- (-7196.234) [-7193.490] (-7204.459) (-7209.057) * (-7194.979) [-7196.042] (-7193.776) (-7200.892) -- 0:07:41
      36000 -- (-7194.081) (-7197.440) (-7195.964) [-7201.156] * (-7195.915) (-7195.302) [-7193.212] (-7196.190) -- 0:07:35
      36500 -- (-7194.448) [-7193.743] (-7195.886) (-7202.258) * [-7193.151] (-7202.208) (-7198.168) (-7194.326) -- 0:07:28
      37000 -- [-7195.941] (-7193.847) (-7199.562) (-7201.247) * (-7193.100) (-7195.574) (-7196.040) [-7194.803] -- 0:07:22
      37500 -- (-7199.143) (-7197.746) [-7196.009] (-7200.154) * (-7197.951) (-7202.106) [-7192.982] (-7200.075) -- 0:07:42
      38000 -- (-7200.800) (-7197.931) (-7197.025) [-7191.744] * (-7190.912) [-7191.696] (-7197.955) (-7198.242) -- 0:07:35
      38500 -- (-7203.446) [-7198.464] (-7199.396) (-7196.371) * (-7194.206) [-7196.199] (-7195.922) (-7200.574) -- 0:07:29
      39000 -- (-7198.477) (-7203.820) (-7198.176) [-7203.583] * (-7195.912) (-7200.985) (-7200.298) [-7200.586] -- 0:07:23
      39500 -- (-7193.145) (-7197.042) [-7194.821] (-7194.269) * (-7198.596) (-7199.798) [-7195.700] (-7197.439) -- 0:07:42
      40000 -- (-7193.824) (-7195.159) [-7191.365] (-7195.522) * [-7192.090] (-7194.463) (-7196.444) (-7195.826) -- 0:07:36

      Average standard deviation of split frequencies: 0.000000

      40500 -- [-7195.260] (-7199.235) (-7198.889) (-7200.245) * (-7194.617) [-7195.168] (-7194.407) (-7200.710) -- 0:07:30
      41000 -- [-7192.903] (-7203.291) (-7195.256) (-7195.932) * (-7196.929) (-7196.272) [-7197.949] (-7208.565) -- 0:07:24
      41500 -- [-7196.003] (-7194.923) (-7196.184) (-7196.320) * (-7200.457) [-7191.764] (-7195.141) (-7208.129) -- 0:07:18
      42000 -- (-7195.297) (-7199.113) [-7200.774] (-7198.518) * [-7194.392] (-7200.059) (-7197.009) (-7195.873) -- 0:07:36
      42500 -- (-7199.745) (-7194.572) [-7197.595] (-7200.360) * (-7200.213) [-7193.938] (-7195.454) (-7195.930) -- 0:07:30
      43000 -- (-7199.399) (-7194.489) [-7197.141] (-7205.424) * (-7201.957) (-7196.320) (-7197.091) [-7196.346] -- 0:07:25
      43500 -- [-7195.334] (-7197.247) (-7194.286) (-7201.298) * (-7194.231) (-7199.417) (-7197.816) [-7192.739] -- 0:07:19
      44000 -- (-7197.341) (-7202.727) [-7192.339] (-7199.641) * (-7200.941) (-7197.310) [-7192.129] (-7198.012) -- 0:07:36
      44500 -- (-7194.260) (-7196.313) (-7190.315) [-7194.719] * (-7195.775) [-7200.164] (-7197.209) (-7195.714) -- 0:07:30
      45000 -- (-7201.428) (-7195.568) (-7192.817) [-7194.440] * (-7202.038) (-7203.469) (-7196.647) [-7194.074] -- 0:07:25

      Average standard deviation of split frequencies: 0.000000

      45500 -- [-7199.337] (-7200.619) (-7195.113) (-7205.732) * (-7202.514) (-7201.679) (-7195.231) [-7195.660] -- 0:07:20
      46000 -- (-7202.148) (-7199.844) [-7199.699] (-7198.223) * [-7195.198] (-7197.121) (-7197.059) (-7197.699) -- 0:07:36
      46500 -- [-7199.126] (-7207.236) (-7193.670) (-7196.424) * [-7195.551] (-7199.825) (-7191.601) (-7195.626) -- 0:07:31
      47000 -- (-7201.298) (-7202.148) (-7196.750) [-7190.926] * (-7202.554) (-7192.388) [-7190.818] (-7198.644) -- 0:07:26
      47500 -- [-7196.889] (-7205.749) (-7191.688) (-7201.455) * (-7198.820) (-7194.818) (-7197.621) [-7197.843] -- 0:07:21
      48000 -- [-7197.429] (-7201.570) (-7199.194) (-7194.466) * (-7195.689) (-7190.737) (-7196.931) [-7195.525] -- 0:07:16
      48500 -- (-7194.573) (-7191.914) [-7194.970] (-7195.817) * (-7195.365) [-7196.904] (-7192.385) (-7195.323) -- 0:07:31
      49000 -- (-7203.120) (-7191.922) [-7204.201] (-7193.801) * [-7197.456] (-7193.043) (-7201.040) (-7197.292) -- 0:07:26
      49500 -- (-7207.784) [-7193.936] (-7196.158) (-7195.131) * (-7195.164) (-7201.024) [-7195.672] (-7192.307) -- 0:07:21
      50000 -- (-7198.284) [-7192.787] (-7198.440) (-7194.825) * (-7195.475) (-7196.854) (-7195.866) [-7199.295] -- 0:07:17

      Average standard deviation of split frequencies: 0.000000

      50500 -- (-7200.026) [-7193.736] (-7200.719) (-7198.082) * [-7197.345] (-7202.737) (-7194.162) (-7195.058) -- 0:07:31
      51000 -- (-7208.350) (-7196.230) [-7202.379] (-7201.797) * (-7205.671) (-7197.525) (-7199.604) [-7195.939] -- 0:07:26
      51500 -- (-7205.758) (-7197.015) [-7198.118] (-7198.950) * [-7196.798] (-7194.878) (-7200.008) (-7196.289) -- 0:07:22
      52000 -- (-7201.352) (-7196.497) [-7198.837] (-7196.654) * (-7201.343) (-7194.538) (-7205.834) [-7198.136] -- 0:07:17
      52500 -- (-7203.080) (-7194.826) [-7195.077] (-7193.038) * (-7191.977) (-7198.417) (-7200.324) [-7194.415] -- 0:07:31
      53000 -- (-7198.900) [-7196.027] (-7196.299) (-7199.982) * [-7194.112] (-7195.768) (-7208.445) (-7200.364) -- 0:07:26
      53500 -- (-7200.053) [-7194.568] (-7195.366) (-7199.358) * [-7197.144] (-7194.605) (-7200.668) (-7198.297) -- 0:07:22
      54000 -- [-7192.652] (-7195.087) (-7195.905) (-7194.128) * [-7198.431] (-7209.061) (-7205.959) (-7197.701) -- 0:07:17
      54500 -- (-7194.251) (-7199.493) (-7198.666) [-7199.485] * [-7193.901] (-7194.921) (-7199.951) (-7194.262) -- 0:07:13
      55000 -- (-7196.908) (-7198.414) [-7194.405] (-7195.606) * [-7194.493] (-7191.939) (-7197.357) (-7202.381) -- 0:07:26

      Average standard deviation of split frequencies: 0.000000

      55500 -- [-7193.230] (-7195.913) (-7196.799) (-7196.890) * (-7198.215) (-7202.003) [-7194.806] (-7201.972) -- 0:07:22
      56000 -- [-7193.066] (-7195.379) (-7197.750) (-7195.026) * [-7194.457] (-7199.075) (-7194.528) (-7199.401) -- 0:07:18
      56500 -- (-7189.648) (-7196.844) (-7196.218) [-7196.160] * (-7195.158) (-7197.807) (-7196.802) [-7192.103] -- 0:07:14
      57000 -- (-7194.490) [-7195.038] (-7196.934) (-7195.704) * [-7192.144] (-7198.310) (-7200.013) (-7195.373) -- 0:07:26
      57500 -- (-7195.689) (-7199.520) (-7196.912) [-7193.491] * (-7197.390) [-7194.760] (-7200.173) (-7197.159) -- 0:07:22
      58000 -- (-7195.062) (-7199.160) (-7195.852) [-7190.199] * (-7200.275) (-7194.834) [-7195.749] (-7200.227) -- 0:07:18
      58500 -- (-7200.878) (-7197.150) (-7196.250) [-7195.256] * (-7201.181) (-7196.169) (-7198.183) [-7198.253] -- 0:07:14
      59000 -- (-7195.097) [-7191.715] (-7192.225) (-7200.930) * [-7198.224] (-7199.268) (-7198.359) (-7202.168) -- 0:07:26
      59500 -- (-7194.576) [-7189.344] (-7191.221) (-7195.746) * (-7197.680) (-7194.567) [-7192.890] (-7194.057) -- 0:07:22
      60000 -- (-7203.825) (-7194.484) [-7193.819] (-7194.499) * [-7198.379] (-7194.641) (-7192.720) (-7197.549) -- 0:07:18

      Average standard deviation of split frequencies: 0.000000

      60500 -- (-7204.759) (-7198.056) [-7190.740] (-7200.675) * (-7201.162) (-7198.732) (-7198.748) [-7195.971] -- 0:07:14
      61000 -- (-7196.157) (-7193.466) (-7198.377) [-7194.863] * (-7200.048) [-7195.570] (-7199.456) (-7203.156) -- 0:07:11
      61500 -- (-7199.911) (-7201.619) (-7193.822) [-7194.568] * [-7196.947] (-7197.182) (-7203.887) (-7205.403) -- 0:07:22
      62000 -- [-7190.531] (-7198.266) (-7198.151) (-7194.536) * (-7197.656) (-7198.728) [-7195.493] (-7203.308) -- 0:07:18
      62500 -- (-7191.880) (-7195.162) (-7201.688) [-7193.957] * (-7196.947) [-7199.427] (-7203.917) (-7203.160) -- 0:07:15
      63000 -- [-7191.835] (-7196.770) (-7198.026) (-7193.831) * (-7194.373) [-7195.996] (-7205.785) (-7202.303) -- 0:07:11
      63500 -- [-7195.061] (-7199.380) (-7197.891) (-7193.344) * (-7200.226) [-7198.032] (-7197.199) (-7194.071) -- 0:07:22
      64000 -- (-7197.802) (-7199.009) (-7198.884) [-7198.253] * (-7195.014) (-7197.588) [-7197.624] (-7196.259) -- 0:07:18
      64500 -- (-7192.769) [-7199.075] (-7204.039) (-7201.028) * (-7196.436) (-7196.782) (-7192.800) [-7196.786] -- 0:07:15
      65000 -- (-7197.522) [-7194.507] (-7203.752) (-7194.705) * (-7196.443) (-7199.101) [-7198.828] (-7201.965) -- 0:07:11

      Average standard deviation of split frequencies: 0.000000

      65500 -- (-7194.944) (-7195.304) (-7200.299) [-7192.027] * (-7202.705) [-7194.176] (-7201.080) (-7197.605) -- 0:07:22
      66000 -- (-7204.393) [-7196.523] (-7205.326) (-7191.334) * [-7199.808] (-7206.064) (-7198.622) (-7195.463) -- 0:07:18
      66500 -- [-7199.230] (-7199.945) (-7207.519) (-7197.083) * (-7196.240) (-7195.429) [-7201.125] (-7194.290) -- 0:07:15
      67000 -- (-7197.943) (-7197.474) (-7201.341) [-7194.415] * (-7194.206) (-7201.678) (-7203.969) [-7194.614] -- 0:07:11
      67500 -- [-7198.964] (-7195.602) (-7195.447) (-7193.911) * (-7200.521) (-7199.810) [-7197.439] (-7203.470) -- 0:07:08
      68000 -- (-7202.756) [-7200.136] (-7195.967) (-7196.140) * (-7200.196) [-7195.449] (-7197.322) (-7195.256) -- 0:07:18
      68500 -- (-7196.151) (-7197.564) [-7199.066] (-7196.519) * (-7195.280) (-7197.705) (-7195.241) [-7197.732] -- 0:07:15
      69000 -- [-7192.513] (-7191.881) (-7195.280) (-7200.056) * (-7200.384) [-7195.880] (-7197.089) (-7199.904) -- 0:07:11
      69500 -- [-7197.250] (-7195.534) (-7195.896) (-7202.469) * (-7198.295) (-7194.724) [-7195.545] (-7193.511) -- 0:07:08
      70000 -- (-7194.496) [-7194.170] (-7192.344) (-7204.398) * (-7195.839) [-7192.546] (-7197.254) (-7200.130) -- 0:07:18

      Average standard deviation of split frequencies: 0.000000

      70500 -- (-7196.579) (-7195.626) [-7192.632] (-7203.362) * (-7199.111) (-7190.583) [-7196.800] (-7201.710) -- 0:07:15
      71000 -- [-7195.815] (-7191.730) (-7194.803) (-7200.563) * (-7195.360) (-7194.396) (-7197.349) [-7197.595] -- 0:07:11
      71500 -- [-7199.838] (-7193.544) (-7198.651) (-7191.814) * (-7194.188) (-7192.052) (-7197.851) [-7191.887] -- 0:07:08
      72000 -- (-7193.908) (-7197.390) (-7194.460) [-7196.882] * (-7198.533) [-7196.319] (-7195.080) (-7200.407) -- 0:07:18
      72500 -- (-7198.839) (-7204.422) [-7191.513] (-7199.828) * (-7196.014) [-7193.174] (-7199.292) (-7195.766) -- 0:07:14
      73000 -- (-7201.087) (-7203.400) (-7190.763) [-7197.868] * (-7199.423) [-7192.456] (-7193.135) (-7200.897) -- 0:07:11
      73500 -- [-7201.894] (-7198.779) (-7191.529) (-7194.571) * (-7192.451) (-7200.464) (-7201.999) [-7191.666] -- 0:07:08
      74000 -- (-7199.705) [-7194.537] (-7193.088) (-7200.220) * (-7207.259) (-7198.437) (-7208.781) [-7193.033] -- 0:07:05
      74500 -- (-7197.247) (-7193.676) [-7195.159] (-7198.603) * (-7196.143) (-7195.633) (-7207.690) [-7192.056] -- 0:07:14
      75000 -- [-7193.820] (-7192.218) (-7198.850) (-7190.944) * (-7196.476) (-7190.252) (-7200.152) [-7189.870] -- 0:07:11

      Average standard deviation of split frequencies: 0.000000

      75500 -- (-7191.676) (-7195.541) (-7194.492) [-7192.592] * [-7197.954] (-7195.708) (-7201.536) (-7193.027) -- 0:07:08
      76000 -- [-7194.680] (-7197.029) (-7196.049) (-7192.850) * [-7193.354] (-7193.307) (-7197.330) (-7196.651) -- 0:07:05
      76500 -- [-7196.993] (-7205.529) (-7196.289) (-7197.351) * [-7195.852] (-7196.342) (-7198.885) (-7198.936) -- 0:07:14
      77000 -- (-7195.705) [-7195.384] (-7203.011) (-7195.111) * (-7202.934) (-7194.523) [-7200.960] (-7193.129) -- 0:07:11
      77500 -- (-7195.655) (-7195.403) [-7198.838] (-7192.812) * (-7193.638) (-7194.532) (-7199.850) [-7195.701] -- 0:07:08
      78000 -- (-7196.730) (-7196.971) (-7197.636) [-7196.321] * (-7200.641) (-7200.572) [-7195.144] (-7195.751) -- 0:07:05
      78500 -- (-7198.894) (-7195.370) (-7200.592) [-7194.165] * (-7201.873) [-7195.745] (-7194.564) (-7197.719) -- 0:07:14
      79000 -- (-7202.736) [-7197.209] (-7201.997) (-7198.422) * (-7203.442) [-7195.959] (-7198.944) (-7200.337) -- 0:07:11
      79500 -- (-7202.137) (-7194.507) [-7197.532] (-7198.814) * (-7200.952) (-7195.795) [-7193.262] (-7193.010) -- 0:07:08
      80000 -- (-7197.101) [-7193.976] (-7195.109) (-7195.434) * [-7194.160] (-7200.068) (-7200.106) (-7194.448) -- 0:07:05

      Average standard deviation of split frequencies: 0.000000

      80500 -- (-7197.010) [-7192.718] (-7193.975) (-7195.173) * (-7196.096) [-7197.390] (-7197.503) (-7195.009) -- 0:07:02
      81000 -- [-7196.024] (-7196.654) (-7196.620) (-7194.268) * (-7194.964) [-7197.553] (-7195.245) (-7189.638) -- 0:07:11
      81500 -- (-7195.076) (-7195.312) [-7196.105] (-7207.112) * (-7196.137) (-7195.332) (-7195.699) [-7189.222] -- 0:07:08
      82000 -- (-7196.345) (-7192.070) (-7204.487) [-7199.446] * (-7200.462) [-7201.463] (-7208.412) (-7195.569) -- 0:07:05
      82500 -- (-7195.120) [-7193.168] (-7195.097) (-7199.409) * (-7204.622) [-7194.789] (-7197.536) (-7197.621) -- 0:07:02
      83000 -- [-7199.223] (-7195.388) (-7201.250) (-7193.882) * (-7193.451) (-7198.171) (-7194.347) [-7196.086] -- 0:07:10
      83500 -- (-7195.469) [-7199.626] (-7198.909) (-7199.294) * (-7196.512) (-7189.382) (-7194.517) [-7193.258] -- 0:07:08
      84000 -- (-7201.317) (-7193.067) (-7193.512) [-7193.323] * [-7194.920] (-7193.611) (-7193.421) (-7195.902) -- 0:07:05
      84500 -- [-7190.377] (-7196.827) (-7195.088) (-7194.719) * (-7191.392) (-7200.684) (-7208.086) [-7200.956] -- 0:07:02
      85000 -- (-7198.488) [-7195.487] (-7194.413) (-7197.971) * (-7193.428) (-7194.467) [-7195.014] (-7197.767) -- 0:07:10

      Average standard deviation of split frequencies: 0.000000

      85500 -- (-7197.159) (-7199.754) [-7197.259] (-7192.498) * [-7194.947] (-7196.929) (-7201.464) (-7197.037) -- 0:07:07
      86000 -- (-7200.201) (-7196.300) (-7192.535) [-7195.335] * [-7193.581] (-7194.467) (-7203.956) (-7204.615) -- 0:07:05
      86500 -- (-7199.568) (-7202.044) [-7196.658] (-7200.413) * (-7195.214) (-7196.398) [-7200.351] (-7203.827) -- 0:07:02
      87000 -- (-7194.867) (-7194.939) (-7196.005) [-7197.009] * [-7200.425] (-7197.329) (-7196.704) (-7198.975) -- 0:06:59
      87500 -- (-7197.889) [-7199.180] (-7201.231) (-7197.104) * (-7204.854) (-7198.449) (-7195.891) [-7196.739] -- 0:07:07
      88000 -- (-7198.404) (-7195.336) (-7201.922) [-7196.944] * (-7196.977) (-7199.301) (-7192.200) [-7195.694] -- 0:07:04
      88500 -- (-7196.641) (-7204.922) (-7208.331) [-7192.355] * (-7200.519) (-7194.290) [-7196.241] (-7195.708) -- 0:07:02
      89000 -- (-7201.542) (-7196.461) [-7200.550] (-7200.476) * (-7195.701) (-7199.347) (-7201.630) [-7191.730] -- 0:06:59
      89500 -- (-7202.629) (-7196.882) [-7193.709] (-7192.046) * (-7199.564) (-7194.554) (-7207.449) [-7194.011] -- 0:07:07
      90000 -- (-7195.145) (-7198.055) [-7197.557] (-7197.381) * (-7198.558) [-7187.709] (-7197.087) (-7195.861) -- 0:07:04

      Average standard deviation of split frequencies: 0.000000

      90500 -- (-7196.818) (-7196.155) [-7195.805] (-7196.779) * (-7200.972) (-7195.454) (-7199.339) [-7197.316] -- 0:07:02
      91000 -- (-7197.569) [-7193.490] (-7194.088) (-7198.620) * (-7200.268) (-7196.296) (-7198.445) [-7196.240] -- 0:06:59
      91500 -- (-7197.110) [-7195.612] (-7198.486) (-7197.026) * (-7195.795) (-7197.470) [-7192.637] (-7194.886) -- 0:07:06
      92000 -- [-7198.750] (-7196.180) (-7196.118) (-7193.241) * (-7199.172) [-7195.653] (-7192.382) (-7194.900) -- 0:07:04
      92500 -- (-7198.392) (-7198.718) [-7196.018] (-7199.836) * (-7194.451) (-7197.971) (-7188.703) [-7191.501] -- 0:07:01
      93000 -- (-7197.441) (-7200.763) (-7199.694) [-7191.819] * (-7199.076) (-7194.617) (-7205.361) [-7192.944] -- 0:06:59
      93500 -- [-7195.429] (-7209.072) (-7204.171) (-7200.264) * [-7196.614] (-7194.414) (-7196.107) (-7195.035) -- 0:06:56
      94000 -- (-7195.986) (-7199.953) (-7195.724) [-7194.195] * [-7192.472] (-7199.093) (-7194.357) (-7193.334) -- 0:07:04
      94500 -- (-7198.706) (-7197.267) (-7197.277) [-7195.956] * (-7194.528) (-7203.122) [-7190.953] (-7196.857) -- 0:07:01
      95000 -- (-7198.003) [-7195.018] (-7196.846) (-7194.321) * (-7197.356) (-7197.648) (-7199.210) [-7191.717] -- 0:06:59

      Average standard deviation of split frequencies: 0.000000

      95500 -- (-7203.361) [-7200.233] (-7198.163) (-7192.893) * (-7201.725) [-7195.874] (-7195.815) (-7194.492) -- 0:06:56
      96000 -- (-7197.503) (-7195.631) [-7192.123] (-7204.798) * (-7202.852) (-7201.989) (-7199.349) [-7194.399] -- 0:07:03
      96500 -- (-7205.041) [-7196.303] (-7194.417) (-7194.041) * (-7196.158) [-7197.018] (-7200.154) (-7194.847) -- 0:07:01
      97000 -- (-7198.883) (-7200.891) (-7196.619) [-7195.877] * [-7194.696] (-7200.395) (-7195.826) (-7202.052) -- 0:06:58
      97500 -- (-7202.003) [-7195.520] (-7197.966) (-7195.789) * (-7195.833) [-7194.148] (-7192.972) (-7197.820) -- 0:06:56
      98000 -- (-7198.846) (-7195.552) [-7196.205] (-7196.219) * [-7196.850] (-7202.245) (-7195.439) (-7196.483) -- 0:07:03
      98500 -- (-7197.832) (-7202.303) (-7194.239) [-7196.017] * (-7197.537) (-7200.047) (-7201.403) [-7197.170] -- 0:07:01
      99000 -- (-7192.633) (-7201.174) (-7196.392) [-7193.212] * [-7195.739] (-7199.734) (-7202.633) (-7198.345) -- 0:06:58
      99500 -- [-7194.263] (-7206.618) (-7201.934) (-7196.612) * (-7198.549) (-7198.102) (-7193.940) [-7198.416] -- 0:06:56
      100000 -- (-7196.381) [-7200.355] (-7200.990) (-7199.291) * (-7195.253) (-7196.828) [-7188.591] (-7194.048) -- 0:06:54

      Average standard deviation of split frequencies: 0.000000

      100500 -- [-7190.152] (-7192.407) (-7201.113) (-7203.720) * (-7197.048) (-7199.893) (-7194.545) [-7192.996] -- 0:07:00
      101000 -- (-7194.236) [-7197.372] (-7194.009) (-7198.892) * (-7192.669) (-7200.710) (-7196.563) [-7192.064] -- 0:06:58
      101500 -- [-7201.391] (-7197.991) (-7206.156) (-7198.417) * (-7197.867) [-7195.221] (-7198.318) (-7193.735) -- 0:06:56
      102000 -- (-7191.881) (-7193.172) [-7202.618] (-7197.064) * [-7196.859] (-7195.507) (-7193.357) (-7190.460) -- 0:06:53
      102500 -- (-7200.328) [-7196.346] (-7203.299) (-7192.436) * [-7195.518] (-7201.689) (-7195.849) (-7196.659) -- 0:07:00
      103000 -- (-7197.519) (-7196.062) (-7199.748) [-7194.018] * (-7200.121) (-7195.297) [-7197.321] (-7202.652) -- 0:06:58
      103500 -- (-7201.251) (-7192.490) [-7196.703] (-7192.503) * (-7198.960) (-7198.733) (-7192.910) [-7193.332] -- 0:06:55
      104000 -- (-7201.022) [-7196.176] (-7207.236) (-7193.989) * (-7200.283) [-7192.385] (-7197.749) (-7200.012) -- 0:06:53
      104500 -- (-7193.587) (-7202.592) (-7204.469) [-7192.152] * (-7198.146) (-7202.081) [-7197.153] (-7196.913) -- 0:06:59
      105000 -- (-7202.940) (-7197.563) (-7209.293) [-7195.938] * (-7196.723) (-7198.616) [-7195.448] (-7193.528) -- 0:06:57

      Average standard deviation of split frequencies: 0.000000

      105500 -- [-7199.823] (-7200.320) (-7201.649) (-7194.613) * [-7195.406] (-7192.180) (-7195.661) (-7200.588) -- 0:06:55
      106000 -- (-7196.953) (-7197.679) (-7202.257) [-7196.305] * [-7196.355] (-7199.216) (-7200.794) (-7202.087) -- 0:06:53
      106500 -- (-7205.197) (-7202.416) (-7200.217) [-7200.684] * (-7196.608) (-7192.585) [-7199.966] (-7201.595) -- 0:06:51
      107000 -- (-7200.053) [-7190.412] (-7201.289) (-7199.975) * (-7201.598) (-7197.736) [-7201.816] (-7209.598) -- 0:06:57
      107500 -- (-7192.804) (-7197.683) [-7193.280] (-7201.037) * [-7194.040] (-7193.054) (-7193.023) (-7211.099) -- 0:06:55
      108000 -- (-7196.394) (-7198.761) [-7204.666] (-7194.178) * [-7195.703] (-7201.886) (-7194.865) (-7195.171) -- 0:06:52
      108500 -- [-7196.781] (-7196.874) (-7192.483) (-7195.767) * [-7197.522] (-7197.230) (-7193.783) (-7195.101) -- 0:06:50
      109000 -- (-7204.336) [-7197.198] (-7198.092) (-7194.045) * [-7192.869] (-7194.532) (-7197.536) (-7197.218) -- 0:06:56
      109500 -- (-7196.813) [-7196.321] (-7195.599) (-7201.490) * (-7194.030) (-7202.685) (-7199.480) [-7197.203] -- 0:06:54
      110000 -- (-7195.499) (-7195.821) [-7202.346] (-7192.275) * (-7189.525) [-7194.937] (-7194.082) (-7201.801) -- 0:06:52

      Average standard deviation of split frequencies: 0.000000

      110500 -- (-7196.282) (-7196.699) [-7194.737] (-7194.710) * (-7192.509) (-7197.235) [-7193.919] (-7194.336) -- 0:06:50
      111000 -- (-7193.380) [-7198.312] (-7193.836) (-7202.953) * (-7196.254) (-7199.652) [-7197.593] (-7196.928) -- 0:06:56
      111500 -- (-7201.100) (-7196.095) [-7192.579] (-7195.783) * [-7196.939] (-7202.731) (-7200.557) (-7203.280) -- 0:06:54
      112000 -- (-7200.925) (-7204.380) (-7199.987) [-7206.168] * [-7192.771] (-7203.194) (-7197.033) (-7197.568) -- 0:06:52
      112500 -- (-7195.693) (-7193.889) (-7197.153) [-7198.156] * [-7199.228] (-7201.013) (-7201.419) (-7191.987) -- 0:06:50
      113000 -- [-7199.023] (-7198.578) (-7193.084) (-7203.135) * (-7194.733) (-7196.320) (-7193.898) [-7194.881] -- 0:06:56
      113500 -- (-7203.309) [-7201.851] (-7194.562) (-7203.140) * (-7194.401) (-7204.222) [-7195.724] (-7193.099) -- 0:06:53
      114000 -- (-7202.475) [-7197.954] (-7200.230) (-7194.690) * [-7197.219] (-7202.846) (-7202.710) (-7194.096) -- 0:06:51
      114500 -- (-7201.646) [-7202.798] (-7199.454) (-7194.636) * (-7198.374) (-7195.744) (-7194.685) [-7191.286] -- 0:06:49
      115000 -- (-7193.889) [-7199.271] (-7193.637) (-7194.462) * (-7194.745) (-7197.973) (-7199.879) [-7192.463] -- 0:06:47

      Average standard deviation of split frequencies: 0.000000

      115500 -- (-7197.893) [-7199.242] (-7195.563) (-7197.300) * (-7194.830) (-7195.827) [-7195.568] (-7190.844) -- 0:06:53
      116000 -- (-7196.176) (-7197.338) (-7198.909) [-7196.373] * (-7201.476) (-7195.222) [-7199.255] (-7197.004) -- 0:06:51
      116500 -- (-7199.567) (-7197.485) (-7194.116) [-7198.574] * [-7194.623] (-7193.302) (-7206.883) (-7196.294) -- 0:06:49
      117000 -- (-7196.553) (-7197.138) [-7197.304] (-7200.013) * (-7204.753) (-7194.381) [-7194.698] (-7198.816) -- 0:06:47
      117500 -- (-7197.943) (-7195.259) [-7198.866] (-7194.980) * (-7199.457) (-7192.949) (-7198.960) [-7197.986] -- 0:06:53
      118000 -- (-7203.959) [-7203.918] (-7200.075) (-7207.935) * [-7196.377] (-7204.006) (-7202.820) (-7195.491) -- 0:06:51
      118500 -- (-7201.327) (-7195.972) [-7200.839] (-7198.007) * (-7197.033) [-7194.488] (-7199.078) (-7200.307) -- 0:06:49
      119000 -- (-7196.878) [-7194.973] (-7197.114) (-7194.481) * [-7193.503] (-7194.393) (-7193.697) (-7199.230) -- 0:06:47
      119500 -- [-7193.417] (-7195.422) (-7198.495) (-7196.814) * [-7191.919] (-7199.281) (-7193.853) (-7196.141) -- 0:06:52
      120000 -- (-7193.828) [-7193.018] (-7196.774) (-7192.407) * (-7194.329) [-7201.813] (-7197.747) (-7195.671) -- 0:06:50

      Average standard deviation of split frequencies: 0.000000

      120500 -- (-7197.209) (-7197.413) (-7202.183) [-7191.812] * (-7195.969) (-7199.388) (-7202.035) [-7204.039] -- 0:06:48
      121000 -- (-7198.648) [-7190.301] (-7192.867) (-7199.729) * (-7198.802) [-7200.814] (-7208.733) (-7195.387) -- 0:06:46
      121500 -- (-7193.524) (-7191.100) [-7193.178] (-7201.916) * (-7199.868) (-7199.361) (-7212.121) [-7192.939] -- 0:06:44
      122000 -- (-7197.809) [-7193.629] (-7192.811) (-7197.933) * (-7197.663) (-7201.000) (-7196.271) [-7208.376] -- 0:06:50
      122500 -- (-7199.312) (-7194.991) (-7203.278) [-7198.268] * (-7198.234) [-7197.114] (-7203.701) (-7192.630) -- 0:06:48
      123000 -- (-7197.113) [-7191.169] (-7197.910) (-7193.806) * (-7198.812) (-7197.586) (-7199.351) [-7195.879] -- 0:06:46
      123500 -- (-7199.325) (-7198.247) [-7198.997] (-7199.939) * [-7197.502] (-7195.856) (-7197.560) (-7197.710) -- 0:06:44
      124000 -- (-7200.405) (-7200.418) [-7204.395] (-7197.442) * (-7193.359) [-7194.585] (-7192.914) (-7202.381) -- 0:06:49
      124500 -- [-7196.653] (-7195.711) (-7199.274) (-7195.608) * (-7191.534) (-7199.020) (-7200.043) [-7194.543] -- 0:06:47
      125000 -- (-7204.820) (-7195.150) (-7196.876) [-7192.340] * [-7200.494] (-7200.867) (-7195.922) (-7196.112) -- 0:06:46

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-7198.836) (-7197.615) (-7197.896) [-7195.061] * (-7194.811) [-7196.593] (-7200.917) (-7196.245) -- 0:06:44
      126000 -- (-7197.262) (-7196.806) (-7195.910) [-7195.012] * (-7200.253) (-7193.297) (-7194.448) [-7192.138] -- 0:06:49
      126500 -- (-7202.136) [-7191.989] (-7196.920) (-7199.076) * (-7200.014) [-7193.256] (-7196.916) (-7197.340) -- 0:06:47
      127000 -- (-7196.791) (-7197.215) (-7199.925) [-7191.452] * (-7196.360) [-7197.849] (-7197.892) (-7197.369) -- 0:06:45
      127500 -- (-7192.778) [-7195.480] (-7198.469) (-7197.531) * (-7203.226) (-7195.249) [-7199.464] (-7199.433) -- 0:06:43
      128000 -- (-7198.442) (-7199.532) [-7199.501] (-7193.229) * (-7201.774) (-7198.830) (-7195.541) [-7200.894] -- 0:06:41
      128500 -- (-7201.236) (-7193.532) (-7196.193) [-7195.080] * (-7204.246) [-7190.148] (-7200.157) (-7203.649) -- 0:06:46
      129000 -- (-7197.075) (-7199.583) [-7194.812] (-7193.810) * (-7203.621) (-7196.004) [-7202.121] (-7198.128) -- 0:06:45
      129500 -- [-7195.420] (-7198.243) (-7201.130) (-7199.380) * (-7203.974) (-7195.718) [-7194.159] (-7193.910) -- 0:06:43
      130000 -- (-7195.727) (-7194.872) [-7197.220] (-7196.997) * (-7197.545) [-7194.542] (-7194.150) (-7198.497) -- 0:06:41

      Average standard deviation of split frequencies: 0.000000

      130500 -- (-7195.608) (-7196.513) [-7195.690] (-7197.033) * [-7196.803] (-7198.109) (-7191.864) (-7199.582) -- 0:06:46
      131000 -- (-7200.393) (-7201.215) [-7192.818] (-7198.551) * [-7205.561] (-7192.512) (-7199.049) (-7196.536) -- 0:06:44
      131500 -- (-7200.451) [-7206.596] (-7194.705) (-7196.192) * [-7192.479] (-7195.201) (-7203.984) (-7198.268) -- 0:06:42
      132000 -- (-7195.674) (-7194.915) (-7199.003) [-7194.495] * (-7191.733) [-7194.751] (-7198.299) (-7191.334) -- 0:06:41
      132500 -- (-7199.941) (-7193.209) [-7198.947] (-7201.632) * (-7193.835) [-7194.452] (-7193.936) (-7199.676) -- 0:06:45
      133000 -- (-7196.460) (-7193.454) [-7196.075] (-7195.669) * (-7198.557) [-7196.853] (-7199.670) (-7197.801) -- 0:06:44
      133500 -- [-7195.028] (-7198.288) (-7194.996) (-7196.429) * (-7202.430) (-7194.545) (-7194.801) [-7198.461] -- 0:06:42
      134000 -- (-7199.212) [-7193.837] (-7202.496) (-7192.745) * (-7198.237) [-7193.201] (-7196.380) (-7192.427) -- 0:06:40
      134500 -- [-7197.542] (-7194.964) (-7199.073) (-7195.344) * (-7204.924) (-7198.416) [-7198.517] (-7196.016) -- 0:06:38
      135000 -- (-7198.310) [-7202.612] (-7205.189) (-7198.517) * (-7198.784) [-7201.916] (-7198.398) (-7201.290) -- 0:06:43

      Average standard deviation of split frequencies: 0.000000

      135500 -- (-7202.552) [-7193.660] (-7198.563) (-7193.144) * [-7193.473] (-7194.946) (-7192.647) (-7197.092) -- 0:06:41
      136000 -- (-7204.046) (-7194.945) (-7200.846) [-7195.249] * (-7197.067) (-7192.992) (-7195.517) [-7194.525] -- 0:06:40
      136500 -- (-7201.968) (-7193.849) (-7196.281) [-7193.892] * (-7194.936) (-7196.512) [-7193.497] (-7198.068) -- 0:06:38
      137000 -- (-7196.228) (-7192.272) [-7196.064] (-7192.071) * (-7196.863) (-7197.748) [-7198.252] (-7193.611) -- 0:06:43
      137500 -- (-7196.433) [-7196.785] (-7194.696) (-7200.252) * [-7194.288] (-7199.824) (-7199.637) (-7197.820) -- 0:06:41
      138000 -- (-7193.151) (-7203.665) (-7194.677) [-7199.905] * [-7196.872] (-7194.934) (-7197.986) (-7195.274) -- 0:06:39
      138500 -- (-7197.627) [-7194.533] (-7192.694) (-7199.053) * [-7197.888] (-7194.464) (-7198.429) (-7197.980) -- 0:06:38
      139000 -- (-7200.111) [-7199.191] (-7191.439) (-7199.252) * (-7202.910) (-7192.738) [-7195.441] (-7197.480) -- 0:06:36
      139500 -- (-7194.877) [-7191.856] (-7199.545) (-7198.648) * [-7196.001] (-7194.945) (-7193.386) (-7196.662) -- 0:06:40
      140000 -- (-7199.588) [-7196.463] (-7196.197) (-7192.027) * (-7200.829) (-7196.259) (-7191.334) [-7200.670] -- 0:06:39

      Average standard deviation of split frequencies: 0.000000

      140500 -- [-7193.057] (-7194.535) (-7204.466) (-7196.600) * (-7201.664) (-7195.856) [-7191.562] (-7199.621) -- 0:06:37
      141000 -- (-7195.385) [-7196.660] (-7195.711) (-7198.072) * (-7199.556) (-7195.201) [-7193.088] (-7202.085) -- 0:06:35
      141500 -- (-7203.626) (-7199.926) [-7197.546] (-7199.630) * (-7199.379) (-7202.528) [-7199.625] (-7196.795) -- 0:06:40
      142000 -- [-7196.001] (-7202.085) (-7193.036) (-7194.306) * (-7193.236) (-7197.422) [-7194.086] (-7199.532) -- 0:06:38
      142500 -- (-7194.951) (-7200.317) (-7195.125) [-7198.571] * (-7201.327) (-7196.771) (-7196.892) [-7192.696] -- 0:06:37
      143000 -- (-7202.861) (-7196.002) [-7193.308] (-7199.130) * [-7199.280] (-7202.494) (-7196.325) (-7193.452) -- 0:06:35
      143500 -- (-7204.257) [-7196.538] (-7195.468) (-7197.438) * [-7195.418] (-7193.847) (-7199.590) (-7192.943) -- 0:06:39
      144000 -- (-7197.236) (-7200.946) (-7202.406) [-7195.694] * (-7193.156) (-7195.583) (-7193.470) [-7194.799] -- 0:06:38
      144500 -- (-7196.480) (-7200.152) (-7201.423) [-7199.234] * (-7193.341) [-7194.068] (-7193.796) (-7192.892) -- 0:06:36
      145000 -- (-7206.209) (-7200.222) [-7193.852] (-7197.283) * [-7203.081] (-7193.966) (-7199.181) (-7194.795) -- 0:06:35

      Average standard deviation of split frequencies: 0.000000

      145500 -- (-7196.108) (-7197.352) (-7196.851) [-7196.607] * (-7198.491) (-7195.314) [-7200.792] (-7201.430) -- 0:06:33
      146000 -- (-7197.052) [-7197.157] (-7199.701) (-7197.230) * [-7199.839] (-7193.233) (-7202.247) (-7193.319) -- 0:06:37
      146500 -- (-7197.910) (-7201.660) [-7193.864] (-7194.722) * [-7204.711] (-7202.365) (-7199.576) (-7196.675) -- 0:06:36
      147000 -- (-7196.767) (-7201.634) [-7197.589] (-7197.441) * (-7201.264) (-7206.267) (-7199.127) [-7195.872] -- 0:06:34
      147500 -- [-7196.007] (-7197.080) (-7209.052) (-7198.083) * (-7202.750) (-7197.400) [-7193.984] (-7192.363) -- 0:06:33
      148000 -- (-7196.591) (-7200.101) [-7199.238] (-7199.259) * [-7195.062] (-7199.375) (-7200.305) (-7199.419) -- 0:06:37
      148500 -- [-7200.923] (-7208.223) (-7204.701) (-7200.039) * [-7196.076] (-7206.664) (-7195.107) (-7195.953) -- 0:06:35
      149000 -- (-7196.332) [-7203.683] (-7196.788) (-7190.905) * [-7191.913] (-7193.304) (-7201.156) (-7194.519) -- 0:06:34
      149500 -- [-7192.913] (-7199.957) (-7201.426) (-7191.251) * (-7192.951) (-7198.944) [-7197.820] (-7198.091) -- 0:06:32
      150000 -- (-7199.478) (-7195.214) (-7196.552) [-7194.761] * (-7195.628) (-7198.126) [-7198.804] (-7196.841) -- 0:06:36

      Average standard deviation of split frequencies: 0.000000

      150500 -- (-7192.860) (-7198.487) [-7195.301] (-7197.218) * (-7200.683) (-7193.647) [-7197.058] (-7199.443) -- 0:06:35
      151000 -- [-7192.936] (-7200.967) (-7193.230) (-7196.908) * (-7197.959) (-7200.873) (-7202.566) [-7200.155] -- 0:06:33
      151500 -- (-7203.724) (-7196.641) [-7195.714] (-7202.906) * (-7198.644) (-7193.268) (-7201.050) [-7197.290] -- 0:06:32
      152000 -- (-7197.282) (-7195.555) (-7194.850) [-7196.057] * (-7198.772) (-7203.066) (-7197.494) [-7198.064] -- 0:06:30
      152500 -- (-7207.492) (-7194.638) (-7192.699) [-7198.093] * (-7198.306) [-7197.909] (-7197.002) (-7202.146) -- 0:06:34
      153000 -- (-7201.629) (-7196.527) [-7198.967] (-7198.599) * (-7199.283) (-7195.612) (-7193.511) [-7193.738] -- 0:06:33
      153500 -- [-7197.541] (-7200.818) (-7204.828) (-7196.736) * [-7201.799] (-7196.819) (-7200.727) (-7198.491) -- 0:06:31
      154000 -- (-7197.001) (-7198.552) (-7198.200) [-7197.251] * (-7197.411) [-7199.291] (-7198.798) (-7194.694) -- 0:06:30
      154500 -- (-7195.593) (-7197.408) [-7197.726] (-7196.226) * (-7191.929) [-7205.418] (-7200.725) (-7192.260) -- 0:06:34
      155000 -- (-7199.122) (-7200.079) [-7193.994] (-7195.740) * (-7199.584) (-7203.515) (-7194.655) [-7191.181] -- 0:06:32

      Average standard deviation of split frequencies: 0.000000

      155500 -- (-7193.817) (-7202.924) (-7193.110) [-7200.044] * (-7194.576) [-7204.305] (-7197.689) (-7196.353) -- 0:06:31
      156000 -- [-7193.340] (-7201.406) (-7194.569) (-7194.591) * (-7197.289) [-7195.902] (-7191.243) (-7202.869) -- 0:06:29
      156500 -- [-7197.612] (-7196.530) (-7191.867) (-7192.491) * (-7194.363) (-7198.754) (-7202.011) [-7196.503] -- 0:06:33
      157000 -- (-7193.146) (-7203.123) (-7195.035) [-7193.138] * (-7192.872) (-7197.463) [-7200.234] (-7197.879) -- 0:06:31
      157500 -- (-7192.939) (-7196.495) (-7194.728) [-7189.615] * (-7201.615) (-7195.394) (-7194.850) [-7195.790] -- 0:06:30
      158000 -- [-7192.461] (-7200.118) (-7202.060) (-7193.790) * (-7197.311) (-7196.597) [-7194.737] (-7192.042) -- 0:06:29
      158500 -- (-7194.477) (-7194.702) [-7197.372] (-7195.177) * [-7193.994] (-7194.981) (-7195.071) (-7196.280) -- 0:06:27
      159000 -- (-7193.268) (-7200.403) [-7191.080] (-7199.183) * [-7193.908] (-7199.316) (-7190.251) (-7200.969) -- 0:06:31
      159500 -- (-7201.857) (-7196.866) [-7195.490] (-7195.209) * (-7202.418) (-7202.571) [-7190.738] (-7196.539) -- 0:06:29
      160000 -- (-7195.011) (-7197.994) [-7197.299] (-7194.227) * (-7205.269) (-7203.055) (-7194.185) [-7195.995] -- 0:06:28

      Average standard deviation of split frequencies: 0.000000

      160500 -- (-7195.757) (-7197.573) [-7199.115] (-7191.387) * (-7198.103) (-7209.064) (-7191.839) [-7192.732] -- 0:06:27
      161000 -- [-7193.301] (-7200.376) (-7193.927) (-7197.100) * (-7197.322) (-7203.786) [-7195.749] (-7199.741) -- 0:06:30
      161500 -- (-7196.947) (-7207.635) (-7196.275) [-7196.965] * (-7198.125) (-7205.925) (-7195.701) [-7197.505] -- 0:06:29
      162000 -- [-7195.909] (-7204.154) (-7193.464) (-7194.308) * (-7210.149) (-7203.640) [-7195.350] (-7197.571) -- 0:06:27
      162500 -- (-7197.288) (-7200.834) [-7202.042] (-7199.557) * (-7199.159) [-7201.932] (-7196.985) (-7196.318) -- 0:06:26
      163000 -- (-7204.188) (-7195.940) [-7197.728] (-7201.993) * (-7196.645) (-7206.610) (-7196.269) [-7192.500] -- 0:06:30
      163500 -- [-7201.544] (-7196.270) (-7198.534) (-7197.311) * (-7199.408) [-7198.742] (-7204.578) (-7204.132) -- 0:06:28
      164000 -- (-7209.540) [-7194.254] (-7198.302) (-7195.626) * (-7194.142) (-7197.118) (-7202.081) [-7199.193] -- 0:06:27
      164500 -- (-7195.655) (-7198.829) [-7203.170] (-7193.683) * (-7199.970) (-7193.145) (-7198.184) [-7198.393] -- 0:06:26
      165000 -- [-7199.943] (-7198.863) (-7202.338) (-7195.741) * (-7197.114) (-7196.959) (-7200.838) [-7196.654] -- 0:06:24

      Average standard deviation of split frequencies: 0.000000

      165500 -- [-7194.845] (-7196.866) (-7193.832) (-7195.629) * [-7192.560] (-7192.009) (-7196.504) (-7197.697) -- 0:06:28
      166000 -- (-7194.945) (-7192.022) [-7198.371] (-7195.193) * (-7203.866) [-7202.935] (-7200.908) (-7205.109) -- 0:06:26
      166500 -- (-7198.206) [-7189.392] (-7196.204) (-7194.216) * [-7193.538] (-7198.594) (-7193.399) (-7200.590) -- 0:06:25
      167000 -- (-7196.398) (-7193.285) [-7197.857] (-7198.969) * (-7194.734) [-7198.133] (-7194.507) (-7192.299) -- 0:06:24
      167500 -- (-7201.298) (-7195.440) (-7198.312) [-7191.761] * [-7195.728] (-7192.642) (-7195.735) (-7193.500) -- 0:06:27
      168000 -- (-7199.523) (-7197.266) [-7203.119] (-7195.084) * [-7190.936] (-7199.761) (-7196.240) (-7197.370) -- 0:06:26
      168500 -- (-7194.190) [-7192.208] (-7195.474) (-7195.829) * (-7200.176) (-7200.079) (-7193.823) [-7194.732] -- 0:06:24
      169000 -- (-7201.442) (-7195.788) (-7194.435) [-7198.728] * (-7193.679) (-7197.099) [-7196.931] (-7206.935) -- 0:06:23
      169500 -- [-7194.361] (-7198.926) (-7200.722) (-7197.655) * [-7203.660] (-7201.425) (-7199.286) (-7204.399) -- 0:06:27
      170000 -- [-7197.487] (-7197.077) (-7197.008) (-7196.013) * (-7196.094) (-7193.857) (-7205.633) [-7193.8