--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 09:25:22 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/acj6-PL/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2298.26 -2318.69
2 -2298.43 -2317.24
--------------------------------------
TOTAL -2298.34 -2318.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.385422 0.003186 0.285139 0.501020 0.382228 1256.91 1270.69 1.000
r(A<->C){all} 0.117348 0.001195 0.053253 0.186696 0.114094 777.46 817.87 1.000
r(A<->G){all} 0.260672 0.003090 0.155466 0.363654 0.256585 551.21 719.48 1.000
r(A<->T){all} 0.122000 0.001662 0.051686 0.206977 0.118424 748.03 786.59 1.000
r(C<->G){all} 0.063051 0.000408 0.024987 0.103635 0.060645 843.36 965.71 1.002
r(C<->T){all} 0.426503 0.003724 0.309816 0.545263 0.424279 605.28 705.98 1.000
r(G<->T){all} 0.010426 0.000095 0.000007 0.029784 0.007550 897.68 1025.79 1.001
pi(A){all} 0.239497 0.000153 0.215039 0.262443 0.239234 1234.44 1241.30 1.000
pi(C){all} 0.303275 0.000174 0.278360 0.329285 0.303265 1166.91 1250.79 1.000
pi(G){all} 0.270450 0.000176 0.243600 0.295813 0.270446 1157.68 1165.09 1.000
pi(T){all} 0.186778 0.000117 0.166299 0.208001 0.186486 1178.36 1245.65 1.000
alpha{1,2} 0.046951 0.000666 0.000101 0.087423 0.049117 1057.99 1154.03 1.000
alpha{3} 2.367067 0.660360 1.003678 3.947117 2.222249 1408.85 1454.92 1.000
pinvar{all} 0.765000 0.000593 0.717879 0.811266 0.765715 1366.61 1411.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2207.775789
Model 2: PositiveSelection -2207.773192
Model 0: one-ratio -2207.820215
Model 3: discrete -2207.773192
Model 7: beta -2207.772726
Model 8: beta&w>1 -2207.775324
Model 0 vs 1 0.0888520000007702
Model 2 vs 1 0.005193999999391963
Model 8 vs 7 0.005196000000069034
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=376
C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
**************************************************
C1 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C2 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C3 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C4 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C5 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C6 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C7 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C8 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C9 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C10 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
C11 LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
**************************************************
C1 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C2 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C3 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C4 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C5 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C6 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C7 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C8 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C9 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C10 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
C11 KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
**************************************************
C1 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C2 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C3 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C4 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C5 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C6 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C7 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C8 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C9 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C10 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
C11 THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
**************************************************
C1 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C2 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C3 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C4 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C5 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C6 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C7 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C8 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C9 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C10 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
C11 LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
**************************************************
C1 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C2 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C3 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C4 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C5 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C6 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C7 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C8 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C9 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C10 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
C11 STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
**************************************************
C1 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C2 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C3 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C4 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C5 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C6 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C7 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C8 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C9 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C10 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
C11 EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
**************************************************
C1 QRQKQKRIVSSVTPSMTGHGSAGFGY
C2 QRQKQKRIVSSVTPSMTGHGSAGFGY
C3 QRQKQKRIVSSVTPSMTGHGSAGFGY
C4 QRQKQKRIVSSVTPSMTGHGSAGFGY
C5 QRQKQKRIVSSVTPSMTGHGSAGFGY
C6 QRQKQKRIVSSVTPSMTGHGSAGFGY
C7 QRQKQKRIVSSVTPSMTGHGSAGFGY
C8 QRQKQKRIVSSVTPSMTGHGSAGFGY
C9 QRQKQKRIVSSVTPSMTGHGSAGFGY
C10 QRQKQKRIVSSVTPSMTGHGSAGFGY
C11 QRQKQKRIVSSVTPSMTGHGSAGFGY
**************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 376 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 376 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [41360]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [41360]--->[41360]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/acj6-PL/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.681 Mb, Max= 31.856 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
FORMAT of file /tmp/tmp7059953254716935092aln Not Supported[FATAL:T-COFFEE]
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:376 S:100 BS:376
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 100.00 C1 C8 100.00
TOP 7 0 100.00 C8 C1 100.00
BOT 0 8 100.00 C1 C9 100.00
TOP 8 0 100.00 C9 C1 100.00
BOT 0 9 100.00 C1 C10 100.00
TOP 9 0 100.00 C10 C1 100.00
BOT 0 10 100.00 C1 C11 100.00
TOP 10 0 100.00 C11 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 1 6 100.00 C2 C7 100.00
TOP 6 1 100.00 C7 C2 100.00
BOT 1 7 100.00 C2 C8 100.00
TOP 7 1 100.00 C8 C2 100.00
BOT 1 8 100.00 C2 C9 100.00
TOP 8 1 100.00 C9 C2 100.00
BOT 1 9 100.00 C2 C10 100.00
TOP 9 1 100.00 C10 C2 100.00
BOT 1 10 100.00 C2 C11 100.00
TOP 10 1 100.00 C11 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 100.00 C3 C8 100.00
TOP 7 2 100.00 C8 C3 100.00
BOT 2 8 100.00 C3 C9 100.00
TOP 8 2 100.00 C9 C3 100.00
BOT 2 9 100.00 C3 C10 100.00
TOP 9 2 100.00 C10 C3 100.00
BOT 2 10 100.00 C3 C11 100.00
TOP 10 2 100.00 C11 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 100.00 C4 C7 100.00
TOP 6 3 100.00 C7 C4 100.00
BOT 3 7 100.00 C4 C8 100.00
TOP 7 3 100.00 C8 C4 100.00
BOT 3 8 100.00 C4 C9 100.00
TOP 8 3 100.00 C9 C4 100.00
BOT 3 9 100.00 C4 C10 100.00
TOP 9 3 100.00 C10 C4 100.00
BOT 3 10 100.00 C4 C11 100.00
TOP 10 3 100.00 C11 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 100.00 C5 C8 100.00
TOP 7 4 100.00 C8 C5 100.00
BOT 4 8 100.00 C5 C9 100.00
TOP 8 4 100.00 C9 C5 100.00
BOT 4 9 100.00 C5 C10 100.00
TOP 9 4 100.00 C10 C5 100.00
BOT 4 10 100.00 C5 C11 100.00
TOP 10 4 100.00 C11 C5 100.00
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
AVG 6 C7 * 100.00
AVG 7 C8 * 100.00
AVG 8 C9 * 100.00
AVG 9 C10 * 100.00
AVG 10 C11 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
C2 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C3 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C4 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C5 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C6 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C7 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C8 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C9 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C10 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C11 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
***************** ********************************
C1 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C2 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C3 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C4 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C5 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C6 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C7 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C8 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
C9 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA
C10 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C11 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
********************************* **************.*
C1 TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
C2 TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
C3 TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
C4 TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
C5 TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC
C6 TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
C7 TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
C8 TGCGTCGCTGTATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
C9 TGCGCCGCTGCATGCCAAATCCGTCGAGTCGTTTGTTAGAAGATGCTTCC
C10 TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC
C11 TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC
**** ***** ***********.** ********.***************
C1 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C2 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C3 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C4 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C5 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C6 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C7 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C8 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C9 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C10 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
C11 CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
**************************************************
C1 CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
C2 CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
C3 CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
C4 CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
C5 CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
C6 CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
C7 CATCAACGATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
C8 CATCAACGATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACA
C9 CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACA
C10 CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
C11 CATCAACGATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
********* ** **.****************** ****.**********
C1 TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATT
C2 TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
C3 TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
C4 TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
C5 TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
C6 TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
C7 TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
C8 TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
C9 TCCAGAAGCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATC
C10 TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
C11 TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
********** *********** **.** *****************.**
C1 AAGCACGACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCG
C2 AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCG
C3 AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCG
C4 AAGCACGACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCG
C5 AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
C6 AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
C7 AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
C8 AAGCACGATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACG
C9 AAGCACGACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCG
C10 AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
C11 AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
******** ******** ** ** ***************** ** **.**
C1 TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA
C2 TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA
C3 TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA
C4 TCCGTTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAA
C5 TCCACTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA
C6 TCCTCTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA
C7 TCCACTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGA
C8 TCCATTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAA
C9 TCCCCTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA
C10 TCCATTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA
C11 TCCATTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGA
*** *************************.************** **.*
C1 CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTAACGCCC
C2 CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC
C3 CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC
C4 CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC
C5 CGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC
C6 CGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC
C7 CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC
C8 CGGGCTCAATGACCACGTTGGCGCCCATATCGGAGTCGCCTCTAACGCCA
C9 CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC
C10 CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCCCCACTGACGCCC
C11 CGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGTCCCCTCTGACGCCC
*******.********. ********** ******** ** **.*****.
C1 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C2 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C3 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C4 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C5 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C6 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C7 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C8 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C9 ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C10 ACACACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
C11 ACACACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
********.*****************************************
C1 CCACCACCATCCGGGCACGTTAAGTGGCCATACGGGGGGACATCATGGAC
C2 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC
C3 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC
C4 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC
C5 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC
C6 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGAC
C7 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGAC
C8 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGCCACCATGGAC
C9 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC
C10 CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC
C11 CCACCACCATCCGGGCACGCTAAGTGGCCACACGGGGGGACACCATGGAC
******************* ********** ******** ** *******
C1 ACTCGGCGGTACATCATCCTGTTATCACGGCGGCAGTGGCTGCCGCTGGC
C2 ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC
C3 ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC
C4 ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC
C5 ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTAGCTGCCGCTGGC
C6 ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC
C7 ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC
C8 ACTCAGCGGTACATCATCCTGTTATCACAGCGGCAGTGGCAGCCGCTGGC
C9 ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC
C10 ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC
C11 ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC
****.***********************.*****.**.**:*********
C1 CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
C2 CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
C3 CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
C4 CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
C5 CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
C6 CTGCATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
C7 CTGCATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
C8 CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
C9 CTGCATCCCGACACAGACACCGATCCCCGCGAGCTGGAGGCCTTCGCGGA
C10 CTGCATCCCGACACCGACACCGATCCCCGCGAGCTGGAGGCGTTTGCGGA
C11 CTGCATCCCGACACCGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
**************.** ******** ************** ** *****
C1 GCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C2 GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C3 GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C4 GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C5 GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C6 GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C7 GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C8 GCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTACGCAGGCGGACGTGG
C9 GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C10 GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
C11 GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
*** ************************** ** ****************
C1 GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
C2 GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
C3 GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
C4 GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
C5 GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAG
C6 GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
C7 GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
C8 GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCACAG
C9 GCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAG
C10 GCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAG
C11 GCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCACTGTCGCAG
****.**************.***************** **.*****.***
C1 AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT
C2 AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAATATGAT
C3 AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT
C4 AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT
C5 AGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
C6 AGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
C7 AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCGCACAACAACATGAT
C8 AGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
C9 AGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
C10 AGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
C11 AGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
*********** .* ************** ***** ******** *****
C1 CGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C2 CGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C3 CGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C4 CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C5 CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C6 CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C7 CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C8 CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGG
C9 CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C10 CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
C11 CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
****** ******************************** **********
C1 CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
C2 CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
C3 CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
C4 CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
C5 CGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGC
C6 CGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGC
C7 CGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGC
C8 CGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGC
C9 CGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
C10 CGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGC
C11 CGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGC
***********.*.***** ** ** ************************
C1 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGC
C2 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGC
C3 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
C4 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
C5 GAAAAGAAAAGGACTTCCATTGCGGCACCCGAAAAGCGTTCTTTGGAAGC
C6 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGCTCCCTGGAAGC
C7 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
C8 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
C9 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
C10 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
C11 GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
***************************** ******** ** *******
C1 CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
C2 CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
C3 CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
C4 CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
C5 CTACTTTGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
C6 CTACTTCGCCGTCCAGCCGAGGCCGTCCGGTGAGAAAATCGCTGCCATTG
C7 CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG
C8 CTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
C9 CTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG
C10 CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG
C11 CTACTTTGCCGTGCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG
****** ***** ***********.*****************:** ****
C1 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C2 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C3 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C4 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C5 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C6 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C7 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C8 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C9 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C10 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
C11 CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
**************************************************
C1 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC
C2 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC
C3 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC
C4 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
C5 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
C6 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
C7 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
C8 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC
C9 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
C10 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
C11 CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
*****************************************.********
C1 TGGCCACGGTTCGGCGGGATTTGGATAC
C2 TGGCCACGGTTCGGCGGGATTTGGATAC
C3 TGGCCACGGTTCGGCGGGATTTGGATAC
C4 TGGCCACGGTTCGGCGGGATTTGGATAC
C5 TGGCCACGGTTCGGCGGGATTTGGATAC
C6 TGGCCACGGTTCGGCGGGATTTGGATAC
C7 TGGCCACGGTTCGGCGGGATTTGGATAC
C8 TGGCCACGGTTCAGCGGGATTTGGATAC
C9 TGGCCACGGTTCGGCGGGATTTGGATAC
C10 TGGCCACGGTTCGGCGGGATTTGGATAC
C11 TGGCCACGGTTCGGCGGGATTTGGATAC
************.***************
>C1
ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATT
AAGCACGACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCG
TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA
CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTAACGCCC
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCATACGGGGGGACATCATGGAC
ACTCGGCGGTACATCATCCTGTTATCACGGCGGCAGTGGCTGCCGCTGGC
CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT
CGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGC
CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C2
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCG
TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA
CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC
ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC
CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAATATGAT
CGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGC
CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C3
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCG
TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA
CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC
ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC
CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT
CGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C4
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCG
TCCGTTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAA
CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC
ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC
CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT
CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C5
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
TCCACTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA
CGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC
ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTAGCTGCCGCTGGC
CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAG
AGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCCGAAAAGCGTTCTTTGGAAGC
CTACTTTGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C6
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
TCCTCTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA
CGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGAC
ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC
CTGCATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
AGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGCTCCCTGGAAGC
CTACTTCGCCGTCCAGCCGAGGCCGTCCGGTGAGAAAATCGCTGCCATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C7
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
TCCACTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGA
CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGAC
ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC
CTGCATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG
AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCGCACAACAACATGAT
CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C8
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
TGCGTCGCTGTATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACA
TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACG
TCCATTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAA
CGGGCTCAATGACCACGTTGGCGCCCATATCGGAGTCGCCTCTAACGCCA
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGCCACCATGGAC
ACTCAGCGGTACATCATCCTGTTATCACAGCGGCAGTGGCAGCCGCTGGC
CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTACGCAGGCGGACGTGG
GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCACAG
AGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGG
CGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
CTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC
TGGCCACGGTTCAGCGGGATTTGGATAC
>C9
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA
TGCGCCGCTGCATGCCAAATCCGTCGAGTCGTTTGTTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACA
TCCAGAAGCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATC
AAGCACGACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCG
TCCCCTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA
CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC
ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC
ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC
CTGCATCCCGACACAGACACCGATCCCCGCGAGCTGGAGGCCTTCGCGGA
GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAG
AGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
CTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C10
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
TCCATTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA
CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCCCCACTGACGCCC
ACACACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC
ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC
CTGCATCCCGACACCGACACCGATCCCCGCGAGCTGGAGGCGTTTGCGGA
GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAG
AGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C11
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC
CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG
CATCAACGATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA
TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC
AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG
TCCATTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGA
CGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGTCCCCTCTGACGCCC
ACACACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG
CCACCACCATCCGGGCACGCTAAGTGGCCACACGGGGGGACACCATGGAC
ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC
CTGCATCCCGACACCGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA
GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG
GCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCACTGTCGCAG
AGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT
CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG
CGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGC
GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC
CTACTTTGCCGTGCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG
CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT
CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC
TGGCCACGGTTCGGCGGGATTTGGATAC
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
QRQKQKRIVSSVTPSMTGHGSAGFGY
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 1128 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479805860
Setting output file names to "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1857066335
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 5769907107
Seed = 1603597846
Swapseed = 1479805860
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 66 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -4132.317681 -- -24.640631
Chain 2 -- -4162.297110 -- -24.640631
Chain 3 -- -4178.366427 -- -24.640631
Chain 4 -- -4148.120533 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -4180.972748 -- -24.640631
Chain 2 -- -4131.070943 -- -24.640631
Chain 3 -- -4143.465430 -- -24.640631
Chain 4 -- -4106.285290 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-4132.318] (-4162.297) (-4178.366) (-4148.121) * [-4180.973] (-4131.071) (-4143.465) (-4106.285)
500 -- (-2473.206) (-2481.788) [-2465.149] (-2458.312) * (-2472.344) (-2456.058) [-2451.356] (-2467.284) -- 0:00:00
1000 -- (-2451.171) [-2406.942] (-2428.837) (-2418.484) * (-2438.885) (-2414.486) [-2411.140] (-2401.644) -- 0:00:00
1500 -- (-2420.790) [-2378.062] (-2375.513) (-2401.569) * (-2414.991) (-2384.305) (-2396.942) [-2376.668] -- 0:11:05
2000 -- (-2395.579) [-2352.818] (-2358.266) (-2377.243) * (-2399.691) (-2352.009) (-2383.534) [-2351.533] -- 0:08:19
2500 -- (-2372.779) (-2337.505) [-2332.907] (-2348.889) * (-2373.968) [-2326.683] (-2387.118) (-2323.614) -- 0:06:39
3000 -- (-2365.323) (-2327.022) [-2328.053] (-2342.523) * (-2381.896) (-2314.307) (-2371.037) [-2304.317] -- 0:05:32
3500 -- (-2360.062) (-2318.631) [-2312.278] (-2330.479) * (-2369.111) (-2319.226) (-2358.856) [-2305.022] -- 0:04:44
4000 -- (-2350.208) [-2316.008] (-2312.445) (-2337.199) * (-2359.339) (-2319.787) (-2333.976) [-2306.946] -- 0:04:09
4500 -- (-2319.260) (-2310.113) [-2311.397] (-2315.303) * (-2346.774) (-2316.730) (-2321.137) [-2298.680] -- 0:07:22
5000 -- [-2314.760] (-2311.072) (-2335.054) (-2317.188) * (-2326.361) (-2319.950) (-2312.368) [-2302.533] -- 0:06:38
Average standard deviation of split frequencies: 0.082703
5500 -- (-2311.395) [-2306.637] (-2311.589) (-2299.832) * (-2320.232) (-2317.929) (-2310.182) [-2300.049] -- 0:06:01
6000 -- (-2303.892) (-2317.394) (-2312.544) [-2315.804] * (-2322.979) (-2309.239) (-2311.206) [-2298.983] -- 0:05:31
6500 -- (-2305.801) [-2304.598] (-2319.090) (-2303.554) * (-2308.510) [-2300.437] (-2308.031) (-2299.533) -- 0:05:05
7000 -- [-2295.702] (-2312.686) (-2310.228) (-2305.508) * (-2306.962) [-2311.681] (-2305.858) (-2307.589) -- 0:07:05
7500 -- (-2302.781) (-2307.230) (-2309.771) [-2307.296] * (-2311.978) (-2315.426) [-2307.123] (-2316.878) -- 0:06:37
8000 -- (-2303.607) [-2309.792] (-2310.124) (-2314.530) * [-2301.432] (-2312.764) (-2300.095) (-2313.690) -- 0:06:12
8500 -- [-2308.201] (-2309.425) (-2327.411) (-2311.464) * (-2308.359) [-2313.800] (-2307.841) (-2307.296) -- 0:05:49
9000 -- (-2308.648) (-2312.310) [-2307.691] (-2307.769) * (-2308.355) (-2315.175) (-2300.190) [-2304.218] -- 0:05:30
9500 -- (-2311.599) [-2306.918] (-2302.441) (-2306.157) * (-2312.945) (-2309.991) (-2304.484) [-2310.078] -- 0:05:12
10000 -- (-2318.343) (-2325.546) [-2305.092] (-2301.318) * (-2310.740) (-2315.284) (-2306.862) [-2318.305] -- 0:04:57
Average standard deviation of split frequencies: 0.056470
10500 -- (-2306.295) (-2332.593) (-2308.509) [-2301.703] * (-2313.903) (-2313.903) [-2307.209] (-2301.268) -- 0:06:16
11000 -- [-2303.130] (-2312.876) (-2320.940) (-2299.690) * (-2305.724) [-2301.417] (-2302.003) (-2313.074) -- 0:05:59
11500 -- (-2305.343) (-2314.490) (-2303.038) [-2307.074] * (-2311.029) (-2309.586) (-2313.069) [-2305.216] -- 0:05:43
12000 -- [-2304.099] (-2322.567) (-2315.883) (-2308.230) * (-2305.198) (-2307.860) (-2305.341) [-2306.897] -- 0:05:29
12500 -- [-2305.265] (-2311.277) (-2306.563) (-2303.541) * (-2310.577) [-2299.006] (-2302.626) (-2313.512) -- 0:05:16
13000 -- (-2306.425) [-2298.263] (-2312.796) (-2308.392) * (-2299.224) [-2300.747] (-2306.348) (-2316.611) -- 0:06:19
13500 -- (-2303.574) (-2309.769) (-2312.226) [-2298.541] * (-2306.572) [-2305.269] (-2313.370) (-2308.089) -- 0:06:05
14000 -- (-2307.428) [-2299.390] (-2310.207) (-2322.618) * [-2309.881] (-2314.748) (-2305.562) (-2303.418) -- 0:05:52
14500 -- (-2314.936) (-2310.646) (-2315.415) [-2313.534] * [-2312.509] (-2320.039) (-2321.578) (-2302.240) -- 0:05:39
15000 -- (-2303.098) [-2297.266] (-2305.068) (-2309.096) * (-2317.108) (-2308.990) [-2312.230] (-2307.236) -- 0:05:28
Average standard deviation of split frequencies: 0.049105
15500 -- (-2301.827) [-2303.073] (-2320.197) (-2301.694) * (-2314.692) (-2299.745) (-2310.114) [-2302.837] -- 0:05:17
16000 -- (-2301.605) (-2310.279) (-2321.684) [-2299.723] * (-2315.641) [-2303.653] (-2300.915) (-2309.986) -- 0:06:09
16500 -- (-2300.162) (-2300.789) (-2313.313) [-2310.498] * [-2301.507] (-2313.820) (-2310.473) (-2303.196) -- 0:05:57
17000 -- (-2313.597) (-2299.305) (-2315.142) [-2303.321] * (-2301.570) (-2303.554) (-2306.654) [-2306.290] -- 0:05:46
17500 -- (-2304.888) [-2300.128] (-2317.937) (-2300.802) * (-2314.117) (-2307.220) (-2316.430) [-2298.240] -- 0:05:36
18000 -- (-2311.173) [-2310.159] (-2320.784) (-2312.582) * (-2305.970) [-2306.001] (-2308.331) (-2304.806) -- 0:05:27
18500 -- [-2301.869] (-2311.570) (-2305.877) (-2306.401) * (-2304.720) [-2308.945] (-2308.038) (-2306.854) -- 0:05:18
19000 -- (-2309.032) (-2305.011) (-2302.040) [-2309.354] * [-2309.859] (-2296.526) (-2311.544) (-2306.634) -- 0:06:01
19500 -- (-2305.474) [-2312.872] (-2309.471) (-2300.374) * (-2313.627) [-2301.183] (-2305.053) (-2320.549) -- 0:05:51
20000 -- (-2299.985) [-2306.540] (-2308.533) (-2312.074) * (-2306.111) (-2321.547) (-2317.243) [-2309.806] -- 0:05:43
Average standard deviation of split frequencies: 0.063542
20500 -- [-2304.933] (-2317.054) (-2306.110) (-2306.445) * (-2312.178) (-2309.971) (-2308.256) [-2299.834] -- 0:05:34
21000 -- (-2310.648) (-2304.946) [-2298.775] (-2309.959) * (-2303.368) (-2313.019) (-2318.591) [-2306.355] -- 0:05:26
21500 -- (-2309.456) (-2309.668) [-2297.529] (-2314.436) * (-2323.464) (-2318.724) [-2298.027] (-2308.011) -- 0:06:04
22000 -- [-2302.580] (-2303.875) (-2313.682) (-2316.660) * (-2310.727) (-2303.855) [-2299.849] (-2311.721) -- 0:05:55
22500 -- [-2298.688] (-2318.296) (-2322.851) (-2312.248) * (-2305.367) [-2298.392] (-2308.201) (-2306.706) -- 0:05:47
23000 -- (-2314.892) (-2312.083) [-2304.345] (-2309.117) * (-2311.854) (-2305.790) [-2300.701] (-2312.551) -- 0:05:39
23500 -- (-2308.144) (-2308.919) [-2296.891] (-2310.478) * (-2300.890) (-2300.854) [-2300.243] (-2319.467) -- 0:05:32
24000 -- (-2313.915) (-2310.992) [-2301.779] (-2308.048) * (-2305.942) (-2308.167) [-2297.620] (-2323.871) -- 0:05:25
24500 -- (-2302.434) (-2301.005) (-2302.283) [-2312.300] * (-2301.305) [-2304.371] (-2302.651) (-2316.176) -- 0:05:58
25000 -- (-2303.249) [-2307.136] (-2314.453) (-2323.082) * [-2302.397] (-2310.015) (-2308.924) (-2302.716) -- 0:05:51
Average standard deviation of split frequencies: 0.061645
25500 -- [-2297.956] (-2303.838) (-2300.439) (-2322.345) * (-2304.811) [-2299.490] (-2310.390) (-2309.451) -- 0:05:43
26000 -- (-2298.289) (-2324.679) (-2306.481) [-2303.618] * (-2309.036) [-2298.560] (-2305.836) (-2316.888) -- 0:05:37
26500 -- (-2302.985) (-2305.649) (-2301.960) [-2308.438] * [-2315.470] (-2309.658) (-2303.616) (-2319.131) -- 0:05:30
27000 -- (-2316.808) (-2312.499) (-2312.290) [-2298.789] * (-2311.684) (-2309.538) (-2321.900) [-2310.873] -- 0:06:00
27500 -- (-2315.855) (-2306.099) (-2305.163) [-2306.377] * [-2316.418] (-2314.380) (-2304.837) (-2308.978) -- 0:05:53
28000 -- [-2310.202] (-2306.443) (-2315.244) (-2310.619) * (-2322.406) (-2310.800) (-2304.126) [-2315.587] -- 0:05:47
28500 -- [-2302.711] (-2308.322) (-2302.090) (-2304.869) * (-2306.608) (-2312.174) (-2303.828) [-2307.288] -- 0:05:40
29000 -- (-2316.143) [-2304.239] (-2303.411) (-2329.314) * (-2309.435) [-2304.835] (-2309.017) (-2309.199) -- 0:05:34
29500 -- (-2317.279) [-2299.549] (-2312.590) (-2322.387) * [-2306.996] (-2303.506) (-2303.377) (-2309.216) -- 0:05:28
30000 -- (-2294.374) (-2315.698) [-2312.243] (-2327.428) * [-2311.365] (-2312.828) (-2306.355) (-2299.802) -- 0:05:23
Average standard deviation of split frequencies: 0.055723
30500 -- [-2301.351] (-2305.610) (-2312.500) (-2303.381) * (-2311.073) (-2313.333) (-2311.150) [-2296.536] -- 0:05:49
31000 -- (-2309.239) [-2313.054] (-2318.938) (-2313.945) * (-2316.063) (-2307.332) [-2305.767] (-2311.742) -- 0:05:43
31500 -- (-2311.828) [-2315.468] (-2308.455) (-2317.690) * (-2302.695) (-2314.399) (-2308.636) [-2310.670] -- 0:05:38
32000 -- (-2310.517) [-2313.183] (-2308.414) (-2308.577) * (-2316.098) (-2310.402) (-2305.662) [-2304.669] -- 0:05:32
32500 -- (-2313.195) (-2310.152) (-2301.347) [-2303.158] * (-2311.306) (-2317.239) (-2308.852) [-2306.623] -- 0:05:27
33000 -- [-2313.800] (-2319.799) (-2313.703) (-2303.946) * (-2326.798) (-2306.365) [-2299.748] (-2308.240) -- 0:05:22
33500 -- (-2315.745) (-2329.699) [-2311.070] (-2305.801) * [-2295.502] (-2303.411) (-2299.742) (-2311.156) -- 0:05:46
34000 -- (-2318.840) (-2303.971) (-2303.307) [-2307.387] * (-2300.951) [-2297.143] (-2301.482) (-2304.365) -- 0:05:40
34500 -- (-2301.083) (-2303.412) [-2297.790] (-2308.021) * (-2297.919) (-2322.199) (-2309.960) [-2302.770] -- 0:05:35
35000 -- [-2298.673] (-2310.773) (-2315.906) (-2312.638) * [-2306.807] (-2312.742) (-2311.445) (-2307.914) -- 0:05:30
Average standard deviation of split frequencies: 0.049759
35500 -- [-2312.084] (-2311.258) (-2303.643) (-2312.301) * (-2304.877) [-2312.340] (-2308.174) (-2305.006) -- 0:05:26
36000 -- (-2313.094) (-2316.171) (-2302.470) [-2313.315] * (-2315.265) [-2309.600] (-2312.553) (-2299.740) -- 0:05:21
36500 -- (-2308.914) (-2307.749) (-2311.497) [-2297.917] * (-2323.480) [-2299.454] (-2305.985) (-2305.562) -- 0:05:43
37000 -- (-2308.618) (-2307.324) [-2302.936] (-2305.460) * (-2320.346) (-2302.545) (-2325.566) [-2311.625] -- 0:05:38
37500 -- (-2303.742) [-2310.678] (-2309.461) (-2302.668) * (-2307.370) (-2306.660) (-2313.082) [-2307.297] -- 0:05:33
38000 -- (-2303.451) [-2305.622] (-2309.354) (-2311.960) * (-2303.130) (-2294.891) [-2307.342] (-2305.781) -- 0:05:29
38500 -- (-2300.818) [-2306.250] (-2305.169) (-2309.178) * [-2298.524] (-2303.834) (-2297.725) (-2314.725) -- 0:05:24
39000 -- (-2305.478) (-2308.579) [-2303.112] (-2297.324) * [-2302.371] (-2309.955) (-2314.111) (-2308.690) -- 0:05:20
39500 -- (-2307.880) (-2309.023) [-2297.972] (-2305.992) * (-2308.265) (-2308.971) [-2305.813] (-2313.017) -- 0:05:16
40000 -- [-2301.428] (-2307.966) (-2310.026) (-2313.048) * (-2306.530) [-2306.929] (-2327.046) (-2307.497) -- 0:05:36
Average standard deviation of split frequencies: 0.040185
40500 -- [-2303.334] (-2305.500) (-2314.913) (-2318.251) * (-2311.566) [-2305.004] (-2322.587) (-2307.112) -- 0:05:31
41000 -- (-2311.884) (-2302.730) [-2302.766] (-2323.652) * (-2303.046) [-2306.528] (-2316.035) (-2304.168) -- 0:05:27
41500 -- [-2315.541] (-2310.630) (-2297.529) (-2312.007) * [-2301.837] (-2307.646) (-2314.710) (-2298.567) -- 0:05:23
42000 -- (-2308.203) (-2309.616) [-2305.017] (-2308.929) * (-2304.749) (-2310.485) (-2317.479) [-2307.172] -- 0:05:19
42500 -- (-2307.637) [-2311.988] (-2296.564) (-2302.217) * [-2304.876] (-2307.702) (-2316.272) (-2303.889) -- 0:05:15
43000 -- (-2316.253) (-2309.809) [-2301.544] (-2300.514) * (-2309.878) (-2309.914) (-2306.610) [-2305.193] -- 0:05:11
43500 -- (-2304.495) (-2307.023) [-2312.207] (-2298.928) * (-2304.350) (-2304.797) (-2308.397) [-2303.609] -- 0:05:29
44000 -- (-2306.273) [-2306.284] (-2313.915) (-2308.221) * (-2313.247) (-2307.477) [-2310.446] (-2308.069) -- 0:05:25
44500 -- (-2313.911) (-2305.828) (-2311.366) [-2319.507] * (-2319.043) (-2316.046) (-2308.366) [-2312.491] -- 0:05:22
45000 -- (-2308.374) [-2300.585] (-2301.683) (-2317.940) * (-2306.682) (-2312.455) [-2301.712] (-2318.586) -- 0:05:18
Average standard deviation of split frequencies: 0.047824
45500 -- (-2306.917) (-2294.771) [-2309.867] (-2312.737) * (-2307.528) (-2306.376) (-2315.053) [-2308.810] -- 0:05:14
46000 -- [-2301.047] (-2298.294) (-2310.296) (-2320.269) * (-2316.624) [-2304.373] (-2305.983) (-2314.886) -- 0:05:11
46500 -- (-2316.679) [-2298.046] (-2303.314) (-2314.173) * [-2305.904] (-2304.177) (-2309.150) (-2306.030) -- 0:05:07
47000 -- [-2315.121] (-2309.373) (-2297.994) (-2307.173) * (-2309.353) [-2301.816] (-2304.469) (-2316.707) -- 0:05:24
47500 -- (-2304.677) (-2305.791) (-2305.442) [-2313.211] * (-2317.436) [-2299.156] (-2305.360) (-2326.347) -- 0:05:20
48000 -- (-2306.362) [-2301.895] (-2302.108) (-2303.923) * [-2304.935] (-2300.622) (-2317.445) (-2320.438) -- 0:05:17
48500 -- (-2312.182) (-2313.019) [-2294.127] (-2305.422) * [-2303.430] (-2311.575) (-2300.713) (-2313.791) -- 0:05:13
49000 -- (-2315.922) (-2320.855) [-2304.301] (-2311.815) * [-2304.990] (-2309.125) (-2296.380) (-2316.578) -- 0:05:10
49500 -- [-2300.689] (-2304.453) (-2310.732) (-2299.234) * [-2305.703] (-2312.554) (-2306.956) (-2312.802) -- 0:05:07
50000 -- (-2303.869) (-2310.865) (-2328.590) [-2305.654] * [-2302.326] (-2303.967) (-2302.940) (-2315.708) -- 0:05:04
Average standard deviation of split frequencies: 0.038457
50500 -- [-2300.971] (-2318.917) (-2303.603) (-2316.290) * [-2302.360] (-2308.923) (-2311.762) (-2305.234) -- 0:05:19
51000 -- (-2310.170) (-2310.115) (-2316.468) [-2305.705] * (-2311.611) (-2307.668) (-2312.097) [-2302.905] -- 0:05:16
51500 -- (-2315.163) (-2311.900) (-2310.374) [-2299.998] * (-2314.984) (-2301.129) (-2308.382) [-2309.345] -- 0:05:13
52000 -- (-2311.483) (-2317.299) [-2298.876] (-2298.715) * (-2306.272) [-2303.376] (-2304.748) (-2312.643) -- 0:05:09
52500 -- (-2306.228) (-2306.084) (-2313.616) [-2300.439] * (-2310.534) (-2305.395) (-2305.221) [-2306.355] -- 0:05:06
53000 -- (-2305.006) (-2307.456) [-2299.055] (-2312.950) * [-2304.977] (-2300.644) (-2304.659) (-2294.071) -- 0:05:21
53500 -- [-2308.598] (-2307.249) (-2311.906) (-2304.592) * (-2320.008) (-2304.955) (-2310.617) [-2305.027] -- 0:05:18
54000 -- [-2300.242] (-2308.365) (-2304.783) (-2306.716) * [-2302.185] (-2297.180) (-2308.893) (-2303.516) -- 0:05:15
54500 -- [-2301.136] (-2314.419) (-2301.499) (-2306.661) * (-2305.698) [-2301.418] (-2303.550) (-2303.369) -- 0:05:12
55000 -- (-2308.163) (-2299.735) (-2307.891) [-2309.265] * [-2305.595] (-2306.326) (-2301.044) (-2314.728) -- 0:05:09
Average standard deviation of split frequencies: 0.043212
55500 -- (-2316.075) (-2299.664) (-2305.223) [-2299.144] * (-2312.699) [-2308.198] (-2305.394) (-2305.059) -- 0:05:06
56000 -- [-2305.028] (-2313.000) (-2311.668) (-2321.358) * (-2298.575) (-2309.592) (-2309.665) [-2308.643] -- 0:05:03
56500 -- [-2300.806] (-2306.930) (-2315.098) (-2317.258) * [-2304.665] (-2309.767) (-2310.512) (-2301.672) -- 0:05:17
57000 -- [-2300.590] (-2302.089) (-2309.847) (-2311.079) * [-2302.732] (-2306.573) (-2307.434) (-2318.151) -- 0:05:14
57500 -- (-2301.370) (-2316.969) (-2320.925) [-2308.717] * (-2306.104) (-2303.119) (-2327.596) [-2316.693] -- 0:05:11
58000 -- (-2308.385) [-2305.344] (-2319.989) (-2313.793) * [-2295.024] (-2308.435) (-2304.412) (-2310.808) -- 0:05:08
58500 -- (-2304.516) (-2305.981) [-2309.042] (-2318.282) * (-2302.982) (-2310.550) (-2303.152) [-2299.910] -- 0:05:05
59000 -- (-2301.627) (-2313.780) [-2305.959] (-2321.940) * (-2309.208) (-2313.545) (-2305.052) [-2311.363] -- 0:05:03
59500 -- (-2309.415) (-2312.519) [-2304.786] (-2314.057) * (-2311.068) [-2301.106] (-2310.751) (-2327.325) -- 0:05:16
60000 -- (-2299.265) (-2310.872) [-2300.773] (-2320.597) * (-2310.725) [-2302.470] (-2307.400) (-2330.768) -- 0:05:13
Average standard deviation of split frequencies: 0.047658
60500 -- (-2309.583) (-2316.547) (-2302.441) [-2305.038] * (-2315.760) [-2295.116] (-2298.072) (-2313.551) -- 0:05:10
61000 -- (-2310.672) (-2309.850) [-2316.667] (-2308.521) * (-2306.369) (-2310.673) (-2299.874) [-2307.030] -- 0:05:07
61500 -- (-2318.283) [-2303.105] (-2306.050) (-2306.720) * (-2303.380) (-2312.055) (-2313.055) [-2304.902] -- 0:05:05
62000 -- (-2310.921) (-2314.234) (-2314.001) [-2313.580] * [-2309.161] (-2313.910) (-2303.612) (-2304.345) -- 0:05:02
62500 -- [-2298.826] (-2321.166) (-2313.517) (-2325.186) * (-2305.522) (-2318.282) (-2324.097) [-2304.041] -- 0:05:15
63000 -- [-2296.876] (-2338.605) (-2306.582) (-2310.634) * (-2303.817) [-2305.827] (-2311.263) (-2307.094) -- 0:05:12
63500 -- (-2306.265) (-2329.509) (-2315.383) [-2304.067] * (-2301.726) (-2302.895) (-2313.179) [-2306.987] -- 0:05:09
64000 -- (-2305.546) (-2317.520) (-2309.082) [-2299.757] * (-2309.084) (-2315.155) (-2310.894) [-2311.765] -- 0:05:07
64500 -- [-2304.554] (-2321.212) (-2304.406) (-2319.988) * (-2303.903) [-2305.925] (-2312.442) (-2310.027) -- 0:05:04
65000 -- [-2305.900] (-2307.942) (-2315.567) (-2314.359) * [-2308.574] (-2304.854) (-2315.373) (-2306.895) -- 0:05:02
Average standard deviation of split frequencies: 0.043748
65500 -- (-2309.134) [-2310.171] (-2303.947) (-2309.798) * (-2320.630) [-2305.625] (-2301.086) (-2304.496) -- 0:05:13
66000 -- [-2302.531] (-2315.229) (-2301.050) (-2311.016) * (-2305.686) (-2306.330) (-2314.709) [-2301.374] -- 0:05:11
66500 -- (-2305.263) (-2306.533) (-2306.683) [-2303.987] * (-2315.282) [-2305.939] (-2301.119) (-2301.293) -- 0:05:08
67000 -- (-2306.709) (-2302.484) (-2310.260) [-2302.965] * (-2316.948) (-2308.122) [-2302.692] (-2309.724) -- 0:05:06
67500 -- (-2305.665) [-2303.034] (-2307.998) (-2302.963) * (-2312.478) (-2303.627) (-2312.555) [-2304.112] -- 0:05:17
68000 -- (-2310.508) (-2304.096) (-2309.987) [-2303.981] * [-2305.721] (-2310.917) (-2305.316) (-2312.140) -- 0:05:15
68500 -- (-2311.240) [-2308.515] (-2324.138) (-2318.909) * [-2310.681] (-2303.522) (-2313.654) (-2311.012) -- 0:05:12
69000 -- (-2318.220) [-2304.511] (-2311.320) (-2306.573) * (-2316.488) [-2306.854] (-2311.075) (-2301.365) -- 0:05:10
69500 -- (-2312.644) (-2309.630) (-2305.803) [-2301.513] * (-2301.960) [-2300.212] (-2308.987) (-2310.427) -- 0:05:07
70000 -- [-2306.173] (-2312.996) (-2308.856) (-2318.910) * (-2298.890) (-2307.400) (-2308.591) [-2299.924] -- 0:05:18
Average standard deviation of split frequencies: 0.043360
70500 -- [-2301.726] (-2298.998) (-2313.154) (-2310.594) * [-2312.095] (-2316.526) (-2309.555) (-2297.686) -- 0:05:16
71000 -- [-2297.934] (-2308.812) (-2306.633) (-2307.936) * [-2309.538] (-2303.706) (-2314.295) (-2311.703) -- 0:05:14
71500 -- [-2306.409] (-2310.481) (-2309.299) (-2325.971) * (-2323.745) [-2304.340] (-2307.834) (-2299.242) -- 0:05:11
72000 -- (-2308.043) (-2323.169) [-2315.402] (-2312.337) * [-2299.913] (-2316.540) (-2309.243) (-2303.227) -- 0:05:09
72500 -- [-2317.994] (-2322.168) (-2300.535) (-2304.374) * [-2317.200] (-2311.065) (-2302.165) (-2308.835) -- 0:05:07
73000 -- (-2306.659) (-2312.112) (-2301.291) [-2298.102] * [-2305.191] (-2302.801) (-2309.941) (-2304.080) -- 0:05:17
73500 -- (-2315.144) (-2311.727) [-2305.780] (-2299.706) * (-2317.316) (-2312.279) (-2310.492) [-2307.768] -- 0:05:15
74000 -- [-2300.629] (-2316.890) (-2304.411) (-2311.652) * (-2317.851) (-2305.690) [-2307.180] (-2303.701) -- 0:05:12
74500 -- [-2301.620] (-2318.734) (-2303.738) (-2304.887) * (-2305.480) (-2308.059) [-2305.925] (-2302.792) -- 0:05:10
75000 -- (-2309.272) (-2318.494) [-2307.210] (-2302.186) * (-2323.390) (-2320.909) (-2301.029) [-2307.617] -- 0:05:08
Average standard deviation of split frequencies: 0.051560
75500 -- (-2301.791) (-2313.834) (-2304.856) [-2297.886] * (-2321.079) (-2314.582) [-2309.303] (-2309.202) -- 0:05:06
76000 -- (-2322.340) (-2308.232) [-2303.084] (-2309.059) * [-2313.687] (-2305.067) (-2306.782) (-2321.232) -- 0:05:16
76500 -- (-2307.455) (-2308.178) [-2314.866] (-2306.807) * (-2308.219) (-2312.608) (-2304.608) [-2306.339] -- 0:05:13
77000 -- (-2309.484) [-2302.626] (-2314.207) (-2298.751) * [-2300.950] (-2315.957) (-2308.507) (-2316.554) -- 0:05:11
77500 -- (-2319.965) [-2301.511] (-2312.032) (-2305.875) * [-2302.108] (-2318.310) (-2309.694) (-2303.415) -- 0:05:09
78000 -- (-2306.111) (-2317.466) (-2316.437) [-2301.575] * (-2300.992) (-2323.260) [-2305.658] (-2313.263) -- 0:05:07
78500 -- (-2299.491) (-2314.232) (-2311.482) [-2309.675] * [-2312.289] (-2313.319) (-2307.982) (-2298.089) -- 0:05:05
79000 -- [-2300.820] (-2315.713) (-2322.766) (-2304.367) * (-2311.443) [-2303.303] (-2308.993) (-2312.784) -- 0:05:14
79500 -- (-2311.935) (-2315.327) [-2311.395] (-2300.710) * (-2303.236) (-2315.905) [-2304.167] (-2303.506) -- 0:05:12
80000 -- (-2318.275) [-2312.909] (-2308.745) (-2306.467) * (-2300.598) (-2317.249) (-2302.929) [-2314.267] -- 0:05:10
Average standard deviation of split frequencies: 0.046020
80500 -- (-2317.905) (-2307.376) (-2308.581) [-2306.485] * (-2314.375) (-2318.272) [-2304.470] (-2306.146) -- 0:05:08
81000 -- (-2317.179) (-2320.333) [-2296.827] (-2322.855) * [-2296.989] (-2309.581) (-2314.851) (-2311.127) -- 0:05:06
81500 -- (-2318.204) (-2307.359) (-2305.439) [-2318.979] * (-2308.226) [-2300.027] (-2308.000) (-2312.860) -- 0:05:04
82000 -- [-2296.614] (-2302.178) (-2308.591) (-2316.430) * [-2306.202] (-2316.568) (-2304.644) (-2308.238) -- 0:05:13
82500 -- (-2304.631) (-2302.716) (-2305.047) [-2296.494] * [-2299.610] (-2311.109) (-2314.346) (-2301.432) -- 0:05:11
83000 -- [-2295.101] (-2301.180) (-2302.518) (-2308.077) * [-2296.374] (-2303.008) (-2324.622) (-2313.151) -- 0:05:09
83500 -- (-2304.851) [-2300.681] (-2312.896) (-2304.561) * (-2314.648) (-2300.307) (-2308.911) [-2310.107] -- 0:05:07
84000 -- [-2303.529] (-2308.082) (-2306.810) (-2302.843) * (-2306.094) [-2309.448] (-2315.497) (-2308.447) -- 0:05:05
84500 -- (-2304.106) (-2305.388) [-2294.187] (-2304.333) * [-2302.136] (-2299.645) (-2313.046) (-2305.194) -- 0:05:03
85000 -- (-2303.350) [-2301.843] (-2300.039) (-2307.694) * (-2306.005) [-2302.978] (-2300.488) (-2326.654) -- 0:05:01
Average standard deviation of split frequencies: 0.040768
85500 -- [-2310.416] (-2317.386) (-2311.682) (-2307.320) * [-2305.529] (-2314.096) (-2309.766) (-2322.009) -- 0:05:10
86000 -- (-2314.890) (-2305.729) (-2310.507) [-2310.803] * (-2307.341) (-2309.876) (-2315.776) [-2319.751] -- 0:05:08
86500 -- (-2316.741) [-2303.349] (-2314.994) (-2312.977) * [-2315.520] (-2319.325) (-2313.660) (-2305.676) -- 0:05:06
87000 -- (-2310.074) [-2304.690] (-2313.737) (-2316.151) * (-2309.532) (-2311.027) (-2315.683) [-2303.941] -- 0:05:04
87500 -- [-2296.071] (-2298.239) (-2297.744) (-2309.325) * (-2312.719) (-2307.750) (-2301.738) [-2310.899] -- 0:05:02
88000 -- [-2300.503] (-2307.372) (-2311.519) (-2313.118) * (-2304.802) [-2297.253] (-2311.299) (-2309.361) -- 0:05:10
88500 -- [-2297.333] (-2323.952) (-2311.029) (-2308.590) * (-2304.366) [-2302.474] (-2301.908) (-2309.227) -- 0:05:08
89000 -- [-2298.844] (-2302.838) (-2313.407) (-2299.994) * (-2312.544) [-2301.895] (-2305.326) (-2306.304) -- 0:05:07
89500 -- (-2318.442) (-2307.760) [-2305.591] (-2303.643) * [-2302.706] (-2305.985) (-2306.205) (-2316.220) -- 0:05:05
90000 -- (-2306.982) [-2306.234] (-2310.234) (-2309.212) * [-2296.102] (-2299.996) (-2307.024) (-2306.441) -- 0:05:03
Average standard deviation of split frequencies: 0.035420
90500 -- (-2303.761) (-2306.332) (-2302.675) [-2314.323] * (-2303.685) [-2313.694] (-2303.427) (-2308.902) -- 0:05:01
91000 -- (-2313.152) (-2315.036) [-2298.440] (-2314.892) * (-2306.748) (-2313.461) (-2310.435) [-2304.970] -- 0:05:09
91500 -- (-2314.518) [-2310.776] (-2319.945) (-2302.794) * (-2309.706) (-2304.005) (-2309.999) [-2312.853] -- 0:05:07
92000 -- (-2316.077) (-2304.209) [-2305.034] (-2304.351) * (-2303.322) (-2305.446) [-2298.481] (-2306.957) -- 0:05:05
92500 -- [-2300.089] (-2307.983) (-2303.367) (-2307.966) * (-2319.183) (-2310.075) [-2308.153] (-2316.150) -- 0:05:04
93000 -- [-2307.094] (-2294.569) (-2314.560) (-2315.812) * (-2305.896) [-2309.299] (-2298.282) (-2317.432) -- 0:05:02
93500 -- (-2309.420) (-2300.367) [-2297.930] (-2310.473) * (-2323.219) (-2304.836) (-2300.429) [-2297.255] -- 0:05:00
94000 -- (-2313.619) (-2300.358) [-2301.959] (-2314.229) * [-2303.396] (-2305.757) (-2297.303) (-2318.346) -- 0:05:08
94500 -- (-2303.702) (-2312.502) [-2304.599] (-2314.925) * [-2305.714] (-2310.846) (-2316.911) (-2310.774) -- 0:05:06
95000 -- (-2319.521) (-2318.387) (-2305.677) [-2314.597] * [-2295.029] (-2305.455) (-2312.056) (-2310.748) -- 0:05:04
Average standard deviation of split frequencies: 0.035355
95500 -- (-2309.028) [-2302.104] (-2314.896) (-2312.114) * [-2301.876] (-2301.096) (-2306.024) (-2303.918) -- 0:05:03
96000 -- [-2304.840] (-2304.193) (-2308.376) (-2310.373) * (-2304.613) (-2312.220) (-2304.284) [-2304.631] -- 0:05:01
96500 -- [-2300.815] (-2315.461) (-2310.819) (-2320.809) * (-2309.447) [-2307.804] (-2307.189) (-2308.699) -- 0:04:59
97000 -- (-2308.306) (-2312.590) [-2299.120] (-2325.402) * (-2311.438) (-2302.489) (-2307.733) [-2308.752] -- 0:04:57
97500 -- [-2305.485] (-2319.499) (-2307.425) (-2321.821) * (-2299.174) (-2308.904) (-2315.179) [-2295.511] -- 0:04:56
98000 -- (-2307.466) (-2309.054) [-2308.205] (-2320.915) * (-2312.869) (-2306.995) (-2300.684) [-2301.318] -- 0:05:03
98500 -- (-2310.809) (-2311.021) (-2308.567) [-2313.051] * [-2304.195] (-2296.105) (-2308.906) (-2301.355) -- 0:05:02
99000 -- (-2314.011) (-2307.790) (-2310.779) [-2304.663] * (-2308.309) (-2301.087) (-2304.968) [-2311.633] -- 0:05:00
99500 -- [-2313.276] (-2301.066) (-2300.389) (-2332.698) * (-2311.954) (-2301.828) [-2307.016] (-2310.351) -- 0:04:58
100000 -- (-2304.998) [-2302.882] (-2312.424) (-2311.127) * (-2300.398) (-2306.443) (-2320.310) [-2302.691] -- 0:05:06
Average standard deviation of split frequencies: 0.028766
100500 -- (-2304.336) (-2309.538) [-2309.847] (-2309.375) * (-2306.438) [-2306.061] (-2326.253) (-2297.785) -- 0:05:04
101000 -- (-2304.597) (-2301.830) (-2302.779) [-2301.974] * [-2308.228] (-2318.886) (-2320.557) (-2311.761) -- 0:05:02
101500 -- (-2322.916) (-2306.293) (-2306.551) [-2300.392] * (-2305.458) (-2317.256) (-2321.060) [-2300.298] -- 0:05:00
102000 -- (-2309.046) (-2304.201) [-2306.652] (-2302.078) * [-2304.278] (-2311.148) (-2318.101) (-2302.684) -- 0:04:59
102500 -- [-2301.454] (-2309.635) (-2315.132) (-2304.131) * (-2318.774) (-2304.769) (-2312.746) [-2308.723] -- 0:04:57
103000 -- (-2306.927) (-2312.761) (-2306.268) [-2295.057] * (-2316.479) (-2313.726) [-2303.666] (-2305.900) -- 0:05:04
103500 -- (-2306.595) (-2319.388) (-2301.503) [-2304.349] * (-2320.233) (-2321.119) (-2314.661) [-2305.079] -- 0:05:03
104000 -- [-2309.032] (-2308.829) (-2311.123) (-2315.596) * [-2307.453] (-2310.980) (-2308.712) (-2299.479) -- 0:05:01
104500 -- [-2306.240] (-2318.608) (-2305.347) (-2302.102) * (-2307.911) [-2311.028] (-2323.939) (-2306.144) -- 0:04:59
105000 -- (-2311.938) (-2304.367) (-2310.167) [-2309.188] * (-2313.597) [-2309.183] (-2316.590) (-2300.067) -- 0:04:58
Average standard deviation of split frequencies: 0.029225
105500 -- (-2314.924) (-2311.183) [-2300.572] (-2305.262) * [-2317.663] (-2311.002) (-2324.569) (-2303.123) -- 0:04:56
106000 -- (-2316.676) [-2302.874] (-2312.565) (-2318.694) * (-2303.318) (-2309.312) (-2326.551) [-2301.741] -- 0:04:55
106500 -- [-2306.487] (-2310.619) (-2311.068) (-2319.861) * (-2307.434) [-2304.952] (-2311.769) (-2298.111) -- 0:05:02
107000 -- (-2307.008) (-2301.282) (-2303.690) [-2304.428] * [-2298.546] (-2311.830) (-2303.052) (-2302.274) -- 0:05:00
107500 -- (-2298.883) (-2307.896) (-2323.877) [-2300.396] * (-2307.979) (-2302.895) (-2315.044) [-2305.888] -- 0:04:58
108000 -- (-2313.781) [-2305.368] (-2312.003) (-2301.445) * (-2308.781) [-2304.664] (-2317.723) (-2316.142) -- 0:04:57
108500 -- (-2307.889) (-2305.475) (-2311.905) [-2317.652] * (-2309.565) (-2304.292) [-2316.754] (-2306.915) -- 0:04:55
109000 -- (-2315.349) (-2321.960) (-2307.314) [-2305.612] * (-2309.178) (-2316.565) (-2301.958) [-2305.764] -- 0:05:02
109500 -- (-2299.986) (-2309.485) (-2307.645) [-2306.163] * (-2303.626) (-2311.583) (-2318.053) [-2306.335] -- 0:05:00
110000 -- (-2306.435) (-2316.789) (-2314.224) [-2303.137] * (-2315.960) [-2310.788] (-2303.998) (-2327.624) -- 0:04:59
Average standard deviation of split frequencies: 0.029209
110500 -- (-2302.845) [-2312.593] (-2303.062) (-2320.619) * [-2306.883] (-2310.534) (-2307.936) (-2315.122) -- 0:04:57
111000 -- (-2305.341) (-2301.247) [-2296.920] (-2299.673) * (-2317.112) [-2315.342] (-2297.998) (-2304.950) -- 0:04:56
111500 -- [-2304.344] (-2304.455) (-2306.967) (-2303.411) * (-2301.962) (-2308.723) (-2301.046) [-2307.795] -- 0:05:02
112000 -- (-2308.222) [-2298.839] (-2305.180) (-2302.079) * (-2307.988) [-2308.720] (-2318.094) (-2301.987) -- 0:05:01
112500 -- (-2301.964) (-2307.294) (-2311.797) [-2301.594] * (-2307.791) [-2304.805] (-2314.983) (-2307.265) -- 0:04:59
113000 -- (-2314.782) (-2316.865) [-2306.736] (-2302.742) * (-2302.752) (-2305.391) (-2305.752) [-2302.666] -- 0:04:58
113500 -- (-2313.103) (-2306.655) [-2303.981] (-2306.699) * (-2310.575) [-2307.060] (-2307.967) (-2315.117) -- 0:04:56
114000 -- (-2304.166) [-2298.660] (-2304.031) (-2305.408) * (-2301.962) (-2313.591) [-2307.934] (-2302.741) -- 0:04:55
114500 -- (-2312.922) (-2304.101) [-2301.673] (-2307.746) * (-2305.186) (-2304.697) [-2301.005] (-2298.217) -- 0:05:01
115000 -- (-2332.501) (-2314.257) (-2308.768) [-2303.720] * (-2302.649) (-2310.634) [-2303.206] (-2311.529) -- 0:05:00
Average standard deviation of split frequencies: 0.025544
115500 -- (-2309.423) (-2316.014) [-2308.547] (-2303.654) * [-2302.883] (-2310.751) (-2314.203) (-2305.788) -- 0:04:58
116000 -- [-2312.216] (-2299.693) (-2303.928) (-2300.930) * (-2302.951) (-2304.962) [-2298.701] (-2313.891) -- 0:04:57
116500 -- (-2314.948) [-2302.848] (-2299.430) (-2304.484) * [-2293.753] (-2323.154) (-2314.645) (-2315.134) -- 0:04:55
117000 -- (-2308.553) (-2311.372) (-2313.078) [-2305.549] * (-2301.711) (-2309.295) (-2303.725) [-2302.105] -- 0:04:54
117500 -- (-2312.580) (-2304.081) (-2317.314) [-2299.858] * (-2307.438) (-2303.484) [-2301.036] (-2301.425) -- 0:05:00
118000 -- (-2315.861) [-2298.567] (-2326.661) (-2311.635) * [-2301.926] (-2312.628) (-2318.239) (-2307.139) -- 0:04:58
118500 -- (-2308.507) (-2312.183) (-2329.503) [-2303.685] * (-2301.779) (-2309.935) (-2306.310) [-2302.117] -- 0:04:57
119000 -- (-2310.917) (-2318.963) (-2313.009) [-2300.851] * (-2308.500) [-2304.280] (-2314.107) (-2311.957) -- 0:04:56
119500 -- [-2306.827] (-2311.668) (-2305.454) (-2297.669) * (-2311.536) (-2312.996) [-2300.423] (-2309.548) -- 0:04:54
120000 -- [-2295.088] (-2316.314) (-2300.799) (-2311.508) * [-2298.646] (-2310.979) (-2310.212) (-2322.459) -- 0:05:00
Average standard deviation of split frequencies: 0.018417
120500 -- (-2298.361) [-2301.100] (-2309.476) (-2311.968) * (-2293.906) (-2316.180) [-2304.797] (-2329.295) -- 0:04:59
121000 -- (-2311.339) [-2314.546] (-2310.921) (-2317.347) * [-2312.297] (-2305.863) (-2327.377) (-2306.501) -- 0:04:57
121500 -- (-2315.413) (-2301.898) (-2309.657) [-2300.930] * (-2322.148) (-2317.225) [-2305.397] (-2323.239) -- 0:04:56
122000 -- (-2308.105) [-2316.268] (-2319.090) (-2299.028) * (-2317.129) [-2319.707] (-2304.562) (-2318.551) -- 0:04:55
122500 -- [-2300.387] (-2308.220) (-2313.731) (-2311.453) * (-2313.356) [-2304.658] (-2320.085) (-2304.993) -- 0:04:53
123000 -- (-2310.299) (-2307.373) [-2306.417] (-2299.423) * (-2305.941) (-2305.787) [-2312.412] (-2306.503) -- 0:04:59
123500 -- (-2320.300) (-2305.827) (-2307.903) [-2305.286] * [-2306.201] (-2305.728) (-2315.419) (-2310.057) -- 0:04:58
124000 -- (-2318.667) (-2311.090) [-2303.840] (-2304.767) * [-2303.614] (-2308.019) (-2309.527) (-2322.710) -- 0:04:56
124500 -- [-2302.457] (-2309.649) (-2307.076) (-2325.502) * (-2303.230) (-2301.230) (-2304.673) [-2304.075] -- 0:04:55
125000 -- (-2308.202) (-2308.300) (-2306.719) [-2307.699] * (-2310.053) [-2299.334] (-2307.363) (-2302.882) -- 0:04:54
Average standard deviation of split frequencies: 0.017370
125500 -- (-2300.919) (-2315.433) (-2307.048) [-2313.026] * (-2306.387) [-2302.686] (-2305.184) (-2310.017) -- 0:04:52
126000 -- (-2304.011) [-2303.176] (-2305.858) (-2304.682) * (-2314.739) (-2306.533) [-2306.438] (-2304.476) -- 0:04:58
126500 -- [-2300.355] (-2318.889) (-2316.835) (-2309.441) * (-2310.413) (-2305.546) (-2323.554) [-2297.533] -- 0:04:56
127000 -- (-2324.938) (-2313.227) (-2310.726) [-2316.806] * (-2316.563) (-2303.046) (-2302.670) [-2305.893] -- 0:04:55
127500 -- (-2316.099) [-2304.769] (-2306.481) (-2305.403) * [-2308.235] (-2312.637) (-2306.537) (-2301.599) -- 0:04:54
128000 -- [-2298.080] (-2328.049) (-2305.983) (-2317.107) * (-2305.442) (-2311.284) [-2311.378] (-2302.621) -- 0:04:52
128500 -- [-2304.660] (-2311.703) (-2311.239) (-2312.504) * (-2317.013) (-2309.741) (-2309.882) [-2301.451] -- 0:04:58
129000 -- (-2315.583) [-2311.093] (-2308.842) (-2306.116) * (-2305.194) (-2303.200) (-2308.061) [-2304.338] -- 0:04:57
129500 -- (-2312.730) (-2303.295) [-2319.066] (-2314.219) * (-2305.303) (-2307.170) [-2307.219] (-2307.106) -- 0:04:55
130000 -- (-2314.979) [-2306.683] (-2307.178) (-2307.272) * (-2312.406) (-2305.800) [-2306.230] (-2323.389) -- 0:04:54
Average standard deviation of split frequencies: 0.017008
130500 -- (-2315.023) (-2299.921) (-2302.968) [-2307.856] * [-2314.375] (-2314.638) (-2301.905) (-2324.241) -- 0:04:53
131000 -- (-2323.869) [-2301.471] (-2311.178) (-2312.234) * (-2307.491) (-2314.680) (-2313.079) [-2312.583] -- 0:04:51
131500 -- (-2309.068) [-2303.342] (-2317.840) (-2309.484) * (-2310.828) (-2297.782) [-2304.559] (-2318.045) -- 0:04:50
132000 -- (-2315.579) (-2320.610) [-2305.530] (-2309.971) * [-2304.233] (-2296.708) (-2313.125) (-2303.916) -- 0:04:55
132500 -- [-2309.100] (-2303.986) (-2311.174) (-2303.075) * (-2305.200) [-2304.287] (-2313.587) (-2306.154) -- 0:04:54
133000 -- (-2315.818) [-2308.574] (-2308.249) (-2311.724) * [-2300.101] (-2303.415) (-2305.585) (-2309.125) -- 0:04:53
133500 -- (-2308.110) (-2315.896) [-2309.290] (-2304.306) * (-2309.311) (-2315.144) (-2312.263) [-2308.334] -- 0:04:52
134000 -- [-2303.617] (-2322.363) (-2309.876) (-2302.916) * (-2317.699) [-2302.592] (-2303.519) (-2305.482) -- 0:04:50
134500 -- (-2301.170) [-2305.941] (-2314.741) (-2318.760) * (-2315.044) [-2296.686] (-2306.421) (-2310.617) -- 0:04:49
135000 -- [-2305.584] (-2301.793) (-2302.090) (-2331.517) * (-2315.708) [-2306.550] (-2304.898) (-2311.590) -- 0:04:48
Average standard deviation of split frequencies: 0.019064
135500 -- (-2318.520) [-2308.692] (-2311.900) (-2315.864) * (-2319.344) [-2308.286] (-2305.255) (-2315.333) -- 0:04:53
136000 -- (-2299.091) [-2314.415] (-2311.103) (-2311.271) * [-2301.424] (-2305.589) (-2310.488) (-2312.657) -- 0:04:52
136500 -- [-2298.442] (-2315.407) (-2304.913) (-2305.610) * (-2324.257) [-2314.713] (-2311.777) (-2312.790) -- 0:04:50
137000 -- (-2308.609) (-2311.763) (-2307.829) [-2307.556] * [-2312.217] (-2303.875) (-2315.604) (-2313.526) -- 0:04:49
137500 -- (-2305.536) (-2307.932) (-2302.725) [-2305.487] * (-2324.458) (-2310.145) (-2311.919) [-2296.275] -- 0:04:48
138000 -- (-2306.586) (-2311.175) (-2312.021) [-2304.178] * (-2321.887) (-2302.804) (-2321.846) [-2304.368] -- 0:04:47
138500 -- (-2312.967) [-2307.520] (-2301.865) (-2308.558) * (-2322.449) (-2319.862) [-2315.063] (-2303.704) -- 0:04:52
139000 -- (-2307.233) (-2311.832) (-2306.035) [-2304.382] * (-2327.208) [-2299.549] (-2304.161) (-2301.171) -- 0:04:51
139500 -- (-2314.036) (-2306.655) [-2302.136] (-2301.604) * (-2314.779) (-2315.517) (-2305.934) [-2297.727] -- 0:04:49
140000 -- (-2313.618) [-2303.819] (-2314.334) (-2303.861) * (-2312.348) (-2322.637) [-2305.977] (-2304.652) -- 0:04:48
Average standard deviation of split frequencies: 0.020586
140500 -- (-2303.217) (-2308.321) [-2305.460] (-2299.715) * (-2303.652) (-2312.787) [-2300.778] (-2309.180) -- 0:04:47
141000 -- [-2299.856] (-2308.067) (-2313.174) (-2307.395) * (-2313.868) [-2310.340] (-2301.557) (-2301.180) -- 0:04:46
141500 -- [-2303.937] (-2308.657) (-2303.405) (-2308.291) * [-2309.515] (-2307.225) (-2313.390) (-2302.093) -- 0:04:51
142000 -- (-2297.097) [-2297.688] (-2322.044) (-2308.056) * [-2304.308] (-2313.744) (-2312.337) (-2314.763) -- 0:04:50
142500 -- [-2296.787] (-2307.817) (-2309.818) (-2306.248) * (-2301.128) (-2305.290) (-2315.783) [-2311.311] -- 0:04:48
143000 -- (-2308.637) (-2322.439) (-2312.050) [-2300.841] * (-2303.191) [-2297.630] (-2307.811) (-2306.620) -- 0:04:47
143500 -- (-2316.286) [-2312.915] (-2319.104) (-2301.231) * (-2299.601) [-2303.233] (-2304.087) (-2309.988) -- 0:04:46
144000 -- (-2306.173) (-2312.183) (-2325.698) [-2305.547] * (-2312.168) (-2298.683) [-2306.381] (-2299.723) -- 0:04:45
144500 -- (-2307.702) (-2309.897) [-2304.780] (-2298.935) * [-2302.942] (-2303.561) (-2311.868) (-2312.781) -- 0:04:44
145000 -- (-2314.445) [-2310.008] (-2313.845) (-2303.634) * (-2302.301) (-2317.856) (-2318.485) [-2300.790] -- 0:04:48
Average standard deviation of split frequencies: 0.016836
145500 -- (-2304.821) (-2320.768) [-2306.896] (-2310.603) * [-2298.621] (-2309.445) (-2323.464) (-2308.304) -- 0:04:47
146000 -- (-2301.659) [-2305.403] (-2306.994) (-2308.803) * (-2298.834) [-2303.610] (-2318.568) (-2305.283) -- 0:04:46
146500 -- (-2302.317) (-2299.862) (-2316.458) [-2305.094] * (-2304.476) (-2306.766) (-2309.125) [-2302.035] -- 0:04:45
147000 -- (-2299.560) (-2308.231) (-2314.487) [-2305.773] * (-2309.394) (-2300.666) (-2309.781) [-2300.150] -- 0:04:44
147500 -- (-2304.676) [-2309.394] (-2303.362) (-2308.486) * (-2304.767) (-2302.301) (-2309.302) [-2302.766] -- 0:04:48
148000 -- (-2305.405) (-2315.875) [-2302.089] (-2320.661) * [-2302.087] (-2303.911) (-2309.640) (-2309.469) -- 0:04:47
148500 -- (-2301.002) [-2304.784] (-2312.787) (-2317.442) * (-2310.956) (-2305.531) [-2302.888] (-2299.900) -- 0:04:46
149000 -- (-2311.583) (-2307.672) (-2309.475) [-2306.535] * (-2333.719) [-2311.014] (-2310.657) (-2310.237) -- 0:04:45
149500 -- (-2305.621) (-2300.445) [-2301.376] (-2306.752) * (-2319.378) (-2303.065) [-2305.994] (-2316.230) -- 0:04:44
150000 -- (-2302.634) [-2299.336] (-2301.894) (-2316.914) * (-2321.646) (-2322.104) [-2305.500] (-2307.462) -- 0:04:49
Average standard deviation of split frequencies: 0.015644
150500 -- (-2307.518) [-2300.650] (-2309.122) (-2308.606) * [-2311.471] (-2316.899) (-2311.505) (-2304.871) -- 0:04:47
151000 -- [-2308.076] (-2307.992) (-2304.311) (-2306.914) * (-2304.288) (-2311.602) [-2306.443] (-2306.887) -- 0:04:46
151500 -- (-2308.657) (-2312.352) (-2304.129) [-2305.324] * [-2312.140] (-2311.310) (-2314.274) (-2319.911) -- 0:04:45
152000 -- (-2307.129) (-2324.953) (-2310.328) [-2321.168] * [-2302.727] (-2315.882) (-2326.331) (-2320.958) -- 0:04:44
152500 -- (-2310.402) (-2311.088) (-2303.495) [-2312.862] * (-2315.993) (-2316.638) [-2300.421] (-2308.974) -- 0:04:43
153000 -- (-2317.378) (-2309.893) (-2314.815) [-2307.778] * (-2316.255) (-2303.275) [-2299.922] (-2307.885) -- 0:04:47
153500 -- [-2312.844] (-2308.133) (-2316.232) (-2318.160) * (-2313.673) (-2301.284) (-2309.352) [-2303.103] -- 0:04:46
154000 -- (-2311.456) (-2318.949) [-2305.143] (-2317.280) * [-2301.775] (-2308.936) (-2310.758) (-2307.465) -- 0:04:45
154500 -- (-2308.114) [-2310.812] (-2305.503) (-2311.640) * [-2311.507] (-2301.677) (-2317.057) (-2313.695) -- 0:04:44
155000 -- (-2305.564) [-2304.289] (-2306.482) (-2308.666) * [-2301.069] (-2310.785) (-2309.420) (-2307.888) -- 0:04:43
Average standard deviation of split frequencies: 0.014908
155500 -- (-2315.671) (-2317.104) (-2300.748) [-2301.137] * [-2303.011] (-2301.028) (-2311.720) (-2321.165) -- 0:04:47
156000 -- (-2302.686) (-2311.181) (-2308.792) [-2302.063] * (-2312.655) [-2299.911] (-2317.265) (-2318.085) -- 0:04:46
156500 -- (-2310.736) (-2303.485) [-2302.085] (-2313.450) * [-2306.341] (-2308.673) (-2305.807) (-2305.953) -- 0:04:45
157000 -- (-2311.453) (-2315.871) [-2309.678] (-2317.386) * (-2306.526) (-2307.235) [-2298.738] (-2307.908) -- 0:04:44
157500 -- (-2299.587) [-2310.518] (-2312.047) (-2315.276) * [-2304.145] (-2327.940) (-2301.510) (-2301.918) -- 0:04:43
158000 -- [-2308.642] (-2311.910) (-2315.180) (-2311.845) * (-2301.491) (-2320.908) [-2297.035] (-2304.323) -- 0:04:42
158500 -- [-2303.677] (-2311.950) (-2317.707) (-2315.473) * [-2300.608] (-2305.947) (-2310.136) (-2297.948) -- 0:04:46
159000 -- [-2304.312] (-2317.699) (-2317.707) (-2314.842) * [-2308.439] (-2311.431) (-2299.298) (-2302.425) -- 0:04:45
159500 -- (-2310.023) (-2316.844) (-2306.076) [-2309.766] * [-2301.666] (-2301.571) (-2302.447) (-2322.794) -- 0:04:44
160000 -- (-2307.379) (-2315.183) (-2310.872) [-2303.004] * (-2301.731) (-2327.314) (-2306.961) [-2310.257] -- 0:04:43
Average standard deviation of split frequencies: 0.013888
160500 -- [-2299.737] (-2319.206) (-2319.861) (-2300.134) * (-2314.052) (-2303.366) (-2301.199) [-2303.400] -- 0:04:42
161000 -- (-2315.445) (-2316.655) (-2309.590) [-2305.834] * (-2313.053) (-2308.854) [-2299.049] (-2300.214) -- 0:04:41
161500 -- (-2304.109) (-2305.320) [-2296.528] (-2304.655) * [-2300.695] (-2306.156) (-2301.576) (-2307.387) -- 0:04:40
162000 -- (-2305.275) [-2308.280] (-2311.641) (-2307.078) * (-2308.654) (-2306.441) [-2302.728] (-2312.875) -- 0:04:44
162500 -- [-2311.914] (-2308.108) (-2323.519) (-2304.471) * (-2308.441) (-2299.897) (-2318.339) [-2297.370] -- 0:04:43
163000 -- (-2319.827) (-2306.406) [-2297.072] (-2305.653) * (-2306.161) (-2307.320) [-2305.858] (-2324.014) -- 0:04:42
163500 -- (-2311.315) (-2320.872) [-2301.133] (-2317.940) * [-2306.843] (-2310.834) (-2305.754) (-2309.514) -- 0:04:41
164000 -- (-2299.774) (-2314.015) (-2298.872) [-2303.508] * [-2313.754] (-2299.581) (-2303.165) (-2295.826) -- 0:04:40
164500 -- (-2299.487) (-2312.802) (-2302.887) [-2308.272] * (-2310.120) (-2304.400) [-2307.896] (-2300.194) -- 0:04:39
165000 -- (-2330.235) [-2306.831] (-2307.993) (-2302.758) * (-2315.359) [-2311.683] (-2310.295) (-2296.707) -- 0:04:38
Average standard deviation of split frequencies: 0.012495
165500 -- (-2308.423) (-2293.230) [-2311.692] (-2300.396) * (-2309.178) [-2297.058] (-2308.772) (-2302.512) -- 0:04:42
166000 -- (-2312.927) (-2322.248) (-2311.546) [-2297.711] * [-2303.273] (-2302.112) (-2313.028) (-2305.204) -- 0:04:41
166500 -- (-2306.317) (-2313.192) [-2298.112] (-2308.328) * (-2306.504) (-2306.381) [-2299.428] (-2315.562) -- 0:04:40
167000 -- (-2299.988) (-2309.506) (-2333.588) [-2310.722] * (-2307.626) (-2307.162) (-2319.741) [-2308.437] -- 0:04:39
167500 -- (-2322.465) (-2316.401) [-2303.209] (-2313.682) * [-2300.154] (-2301.572) (-2332.566) (-2310.230) -- 0:04:38
168000 -- [-2315.982] (-2308.176) (-2310.563) (-2306.631) * [-2299.459] (-2327.662) (-2321.529) (-2304.079) -- 0:04:37
168500 -- (-2302.181) (-2312.596) (-2306.792) [-2305.501] * [-2304.946] (-2310.627) (-2304.303) (-2305.142) -- 0:04:36
169000 -- [-2307.610] (-2317.372) (-2307.408) (-2312.537) * (-2313.265) (-2323.733) [-2304.679] (-2312.171) -- 0:04:40
169500 -- [-2305.337] (-2322.560) (-2310.559) (-2311.567) * [-2298.977] (-2313.499) (-2306.805) (-2303.646) -- 0:04:39
170000 -- (-2311.425) (-2306.528) (-2305.800) [-2308.221] * (-2316.922) [-2302.037] (-2307.924) (-2308.438) -- 0:04:38
Average standard deviation of split frequencies: 0.012153
170500 -- (-2318.395) (-2315.128) [-2303.038] (-2318.762) * (-2312.986) (-2301.953) [-2303.928] (-2307.112) -- 0:04:37
171000 -- [-2312.603] (-2328.973) (-2303.205) (-2309.790) * (-2305.243) (-2302.237) (-2310.633) [-2300.289] -- 0:04:36
171500 -- (-2307.251) (-2301.503) (-2304.677) [-2307.272] * (-2300.732) (-2316.501) [-2303.813] (-2298.569) -- 0:04:35
172000 -- (-2313.208) (-2310.426) (-2299.003) [-2316.376] * (-2310.677) (-2308.303) [-2305.677] (-2301.584) -- 0:04:34
172500 -- (-2318.411) (-2315.252) (-2302.026) [-2303.568] * (-2316.958) [-2301.009] (-2307.433) (-2312.084) -- 0:04:33
173000 -- (-2304.122) (-2309.921) [-2300.952] (-2310.958) * (-2309.214) (-2305.286) [-2303.088] (-2311.573) -- 0:04:37
173500 -- (-2306.573) (-2314.420) (-2309.473) [-2314.705] * (-2308.332) (-2302.842) [-2301.988] (-2307.074) -- 0:04:36
174000 -- (-2300.426) (-2314.603) [-2306.406] (-2307.268) * (-2316.640) [-2303.763] (-2318.680) (-2304.963) -- 0:04:35
174500 -- [-2303.542] (-2318.572) (-2321.838) (-2300.862) * (-2305.800) [-2309.641] (-2321.414) (-2308.521) -- 0:04:34
175000 -- (-2305.897) (-2306.722) (-2310.755) [-2300.646] * (-2305.169) [-2314.245] (-2317.409) (-2313.236) -- 0:04:33
Average standard deviation of split frequencies: 0.012142
175500 -- (-2312.517) (-2299.239) [-2303.789] (-2309.842) * [-2303.281] (-2311.581) (-2313.902) (-2304.106) -- 0:04:32
176000 -- (-2311.595) (-2302.180) [-2307.323] (-2310.483) * [-2301.157] (-2306.220) (-2311.955) (-2321.612) -- 0:04:31
176500 -- (-2312.492) (-2316.505) [-2300.986] (-2298.224) * (-2312.414) [-2310.434] (-2314.291) (-2311.504) -- 0:04:35
177000 -- (-2313.844) [-2301.965] (-2311.485) (-2328.460) * (-2313.622) (-2309.225) [-2309.561] (-2319.100) -- 0:04:34
177500 -- (-2305.949) (-2312.276) [-2302.033] (-2309.640) * (-2306.476) (-2310.548) [-2303.357] (-2328.682) -- 0:04:33
178000 -- (-2305.811) (-2305.501) (-2312.032) [-2305.201] * (-2303.346) (-2322.398) [-2309.073] (-2326.862) -- 0:04:32
178500 -- [-2296.174] (-2300.375) (-2305.814) (-2315.774) * [-2306.952] (-2310.557) (-2304.719) (-2319.973) -- 0:04:31
179000 -- [-2306.788] (-2315.785) (-2314.281) (-2305.081) * (-2308.217) [-2300.094] (-2314.266) (-2317.338) -- 0:04:35
179500 -- [-2314.186] (-2300.419) (-2307.468) (-2304.158) * [-2305.284] (-2312.038) (-2308.839) (-2312.288) -- 0:04:34
180000 -- (-2330.102) (-2299.506) (-2305.947) [-2308.716] * (-2310.624) (-2313.239) [-2303.329] (-2306.778) -- 0:04:33
Average standard deviation of split frequencies: 0.011133
180500 -- [-2304.731] (-2306.117) (-2312.248) (-2324.117) * (-2303.160) (-2309.759) (-2311.319) [-2294.907] -- 0:04:32
181000 -- (-2318.566) (-2297.801) (-2316.812) [-2309.029] * (-2307.210) [-2298.933] (-2302.833) (-2306.233) -- 0:04:31
181500 -- [-2308.257] (-2305.463) (-2312.373) (-2312.498) * (-2305.835) [-2305.625] (-2306.988) (-2315.344) -- 0:04:35
182000 -- (-2313.966) (-2309.649) [-2305.781] (-2318.601) * [-2305.099] (-2317.912) (-2307.485) (-2312.677) -- 0:04:34
182500 -- [-2311.204] (-2318.210) (-2319.411) (-2302.875) * (-2302.771) (-2319.883) [-2302.751] (-2305.477) -- 0:04:33
183000 -- (-2305.480) (-2302.438) [-2303.391] (-2324.740) * (-2309.918) (-2320.426) (-2309.396) [-2302.376] -- 0:04:32
183500 -- (-2306.737) (-2311.742) (-2309.724) [-2307.271] * (-2307.594) (-2306.973) [-2303.521] (-2308.434) -- 0:04:31
184000 -- (-2304.649) [-2302.953] (-2303.031) (-2306.616) * (-2305.238) (-2298.669) (-2315.707) [-2303.325] -- 0:04:34
184500 -- (-2303.718) (-2302.940) (-2312.454) [-2307.688] * (-2319.461) (-2307.087) (-2309.882) [-2307.442] -- 0:04:34
185000 -- (-2304.549) (-2304.942) (-2313.427) [-2298.612] * (-2316.519) (-2308.723) (-2308.610) [-2306.462] -- 0:04:33
Average standard deviation of split frequencies: 0.010307
185500 -- (-2320.472) (-2307.969) (-2312.208) [-2304.882] * [-2301.191] (-2306.553) (-2306.682) (-2309.102) -- 0:04:32
186000 -- (-2315.148) [-2300.921] (-2304.720) (-2309.144) * (-2307.103) [-2304.448] (-2309.914) (-2305.268) -- 0:04:31
186500 -- (-2312.107) (-2309.455) (-2300.921) [-2303.337] * [-2300.894] (-2322.726) (-2309.994) (-2305.099) -- 0:04:34
187000 -- (-2311.078) [-2309.034] (-2305.121) (-2304.634) * (-2294.272) (-2317.213) (-2321.170) [-2306.753] -- 0:04:33
187500 -- (-2312.747) (-2323.198) [-2295.315] (-2305.550) * [-2299.357] (-2305.766) (-2309.058) (-2309.417) -- 0:04:33
188000 -- [-2298.178] (-2312.435) (-2304.466) (-2302.581) * (-2312.226) (-2320.135) (-2307.587) [-2306.601] -- 0:04:32
188500 -- (-2300.895) [-2301.755] (-2308.603) (-2306.876) * (-2318.679) (-2303.217) (-2309.608) [-2300.262] -- 0:04:31
189000 -- (-2312.289) (-2305.566) (-2307.809) [-2301.430] * (-2299.646) (-2302.443) [-2308.050] (-2302.187) -- 0:04:30
189500 -- (-2307.736) (-2309.736) (-2310.774) [-2304.446] * (-2306.472) (-2312.572) (-2309.471) [-2309.829] -- 0:04:29
190000 -- (-2307.377) (-2301.168) (-2324.166) [-2303.649] * (-2313.508) (-2306.075) (-2307.394) [-2308.025] -- 0:04:32
Average standard deviation of split frequencies: 0.011373
190500 -- [-2306.454] (-2305.318) (-2321.019) (-2310.868) * (-2317.012) [-2309.928] (-2305.599) (-2308.627) -- 0:04:31
191000 -- [-2301.484] (-2308.564) (-2322.653) (-2323.809) * [-2307.391] (-2322.923) (-2299.786) (-2302.341) -- 0:04:31
191500 -- [-2305.339] (-2305.941) (-2327.763) (-2307.202) * (-2316.133) (-2313.202) (-2306.293) [-2305.361] -- 0:04:30
192000 -- (-2307.170) (-2305.444) (-2308.986) [-2305.792] * (-2305.450) (-2314.109) [-2300.409] (-2312.565) -- 0:04:29
192500 -- (-2304.419) (-2310.992) (-2311.844) [-2296.697] * (-2310.841) (-2307.536) (-2307.062) [-2305.872] -- 0:04:28
193000 -- (-2310.945) (-2311.433) (-2303.983) [-2305.250] * [-2299.219] (-2306.303) (-2306.220) (-2302.741) -- 0:04:27
193500 -- [-2301.489] (-2309.375) (-2306.963) (-2312.575) * [-2307.433] (-2307.879) (-2308.567) (-2308.427) -- 0:04:30
194000 -- (-2308.609) (-2311.389) (-2308.451) [-2300.967] * [-2296.721] (-2303.070) (-2303.590) (-2299.519) -- 0:04:30
194500 -- (-2310.083) [-2308.512] (-2301.977) (-2297.363) * (-2305.766) [-2301.235] (-2300.497) (-2307.252) -- 0:04:29
195000 -- (-2312.221) (-2316.162) [-2317.109] (-2302.191) * (-2313.141) (-2300.657) [-2300.326] (-2306.870) -- 0:04:28
Average standard deviation of split frequencies: 0.011865
195500 -- (-2310.036) (-2310.586) (-2318.324) [-2297.680] * [-2302.151] (-2298.635) (-2319.458) (-2311.750) -- 0:04:27
196000 -- (-2311.179) (-2303.418) (-2319.366) [-2302.185] * (-2316.001) (-2306.774) (-2307.394) [-2302.221] -- 0:04:26
196500 -- (-2309.181) (-2310.248) [-2299.638] (-2314.414) * (-2303.162) [-2304.492] (-2306.864) (-2304.220) -- 0:04:25
197000 -- (-2312.197) [-2306.717] (-2308.682) (-2303.896) * (-2310.907) (-2322.633) (-2310.018) [-2306.971] -- 0:04:24
197500 -- (-2309.741) [-2306.920] (-2309.635) (-2302.273) * (-2311.847) [-2306.881] (-2310.891) (-2309.306) -- 0:04:28
198000 -- (-2299.758) (-2302.904) [-2304.423] (-2299.232) * [-2303.300] (-2306.234) (-2306.696) (-2302.485) -- 0:04:27
198500 -- [-2303.212] (-2304.892) (-2296.069) (-2300.408) * [-2300.921] (-2306.573) (-2312.862) (-2310.690) -- 0:04:26
199000 -- [-2308.366] (-2305.193) (-2306.251) (-2303.754) * (-2315.260) [-2296.306] (-2309.190) (-2308.072) -- 0:04:25
199500 -- (-2306.108) [-2295.251] (-2307.075) (-2314.348) * (-2306.826) [-2308.294] (-2320.668) (-2324.510) -- 0:04:24
200000 -- (-2314.035) [-2313.471] (-2318.433) (-2305.207) * (-2317.797) (-2298.598) [-2296.641] (-2309.243) -- 0:04:24
Average standard deviation of split frequencies: 0.011276
200500 -- (-2304.680) [-2296.991] (-2302.344) (-2319.171) * (-2321.016) (-2310.607) [-2296.922] (-2315.022) -- 0:04:23
201000 -- (-2306.492) [-2303.939] (-2330.710) (-2310.707) * (-2312.282) [-2305.368] (-2312.541) (-2305.499) -- 0:04:26
201500 -- (-2314.420) [-2303.912] (-2313.583) (-2316.011) * (-2302.582) (-2301.695) (-2314.351) [-2303.651] -- 0:04:25
202000 -- (-2310.989) [-2300.901] (-2303.602) (-2304.073) * [-2304.612] (-2312.410) (-2301.062) (-2307.866) -- 0:04:24
202500 -- [-2310.974] (-2305.541) (-2306.538) (-2301.120) * (-2310.503) (-2313.081) [-2310.173] (-2306.651) -- 0:04:23
203000 -- (-2321.179) [-2298.970] (-2311.930) (-2314.224) * [-2305.065] (-2307.779) (-2314.247) (-2311.190) -- 0:04:23
203500 -- (-2305.422) [-2303.638] (-2314.284) (-2319.371) * (-2310.228) (-2309.690) [-2301.652] (-2311.970) -- 0:04:26
204000 -- (-2309.777) [-2300.097] (-2320.404) (-2310.040) * (-2310.913) [-2318.020] (-2306.596) (-2310.382) -- 0:04:25
204500 -- [-2305.333] (-2314.978) (-2327.087) (-2313.199) * [-2304.243] (-2308.533) (-2311.999) (-2323.770) -- 0:04:24
205000 -- (-2304.213) [-2300.843] (-2309.387) (-2314.603) * (-2309.176) (-2314.171) [-2302.812] (-2314.671) -- 0:04:23
Average standard deviation of split frequencies: 0.011442
205500 -- [-2307.461] (-2323.111) (-2311.531) (-2312.040) * (-2325.023) [-2300.157] (-2306.061) (-2310.261) -- 0:04:22
206000 -- (-2300.743) [-2304.666] (-2318.061) (-2303.388) * (-2314.556) (-2319.928) [-2314.422] (-2308.731) -- 0:04:22
206500 -- (-2317.330) (-2308.629) [-2298.943] (-2307.967) * (-2303.050) (-2309.972) [-2301.810] (-2315.701) -- 0:04:21
207000 -- (-2309.708) (-2311.611) [-2297.999] (-2315.402) * [-2305.858] (-2299.328) (-2300.308) (-2309.005) -- 0:04:24
207500 -- (-2312.047) (-2321.120) (-2306.157) [-2308.191] * (-2318.378) (-2295.225) (-2301.361) [-2300.984] -- 0:04:23
208000 -- (-2313.123) [-2318.690] (-2316.402) (-2322.388) * (-2311.432) (-2316.339) (-2304.859) [-2301.395] -- 0:04:22
208500 -- (-2317.980) (-2306.608) [-2310.180] (-2328.238) * (-2316.962) (-2314.453) (-2312.647) [-2301.426] -- 0:04:21
209000 -- [-2314.051] (-2297.981) (-2310.031) (-2308.083) * (-2306.099) (-2309.058) (-2307.596) [-2301.263] -- 0:04:21
209500 -- (-2319.604) (-2304.031) (-2308.142) [-2306.010] * (-2307.653) [-2305.660] (-2304.153) (-2302.217) -- 0:04:24
210000 -- (-2323.446) [-2303.313] (-2307.287) (-2308.104) * [-2312.527] (-2314.833) (-2301.716) (-2300.579) -- 0:04:23
Average standard deviation of split frequencies: 0.010443
210500 -- (-2312.722) (-2308.179) [-2302.509] (-2301.449) * (-2322.651) [-2305.863] (-2306.039) (-2304.162) -- 0:04:22
211000 -- (-2305.590) [-2312.991] (-2299.234) (-2305.195) * (-2326.363) (-2309.675) (-2306.765) [-2298.534] -- 0:04:21
211500 -- (-2318.747) (-2301.825) [-2312.761] (-2305.278) * (-2313.815) (-2310.076) [-2301.408] (-2312.615) -- 0:04:20
212000 -- (-2311.110) [-2305.175] (-2300.540) (-2316.346) * (-2323.674) (-2309.905) (-2316.231) [-2304.053] -- 0:04:20
212500 -- [-2300.457] (-2315.375) (-2304.335) (-2314.546) * (-2324.782) (-2321.934) (-2310.882) [-2307.161] -- 0:04:19
213000 -- (-2309.020) (-2302.066) (-2308.942) [-2316.114] * (-2310.964) (-2304.980) [-2304.761] (-2314.391) -- 0:04:22
213500 -- (-2304.683) [-2303.251] (-2309.076) (-2320.823) * [-2309.347] (-2302.908) (-2305.894) (-2314.727) -- 0:04:21
214000 -- (-2310.609) (-2309.003) (-2310.498) [-2305.108] * (-2315.452) (-2298.154) [-2300.392] (-2301.192) -- 0:04:20
214500 -- [-2311.741] (-2309.912) (-2318.098) (-2306.602) * [-2305.101] (-2305.977) (-2317.437) (-2322.839) -- 0:04:20
215000 -- (-2307.268) (-2310.004) (-2303.533) [-2305.780] * [-2301.704] (-2316.929) (-2313.804) (-2318.547) -- 0:04:19
Average standard deviation of split frequencies: 0.010767
215500 -- (-2316.321) (-2306.436) [-2320.312] (-2314.371) * (-2320.203) (-2307.373) [-2301.335] (-2309.900) -- 0:04:18
216000 -- (-2309.603) [-2300.332] (-2311.834) (-2322.283) * [-2312.807] (-2303.415) (-2307.461) (-2312.314) -- 0:04:17
216500 -- [-2310.731] (-2307.065) (-2295.996) (-2317.572) * (-2301.448) (-2310.254) [-2302.018] (-2317.943) -- 0:04:20
217000 -- (-2306.157) (-2317.742) [-2301.677] (-2314.766) * (-2312.156) (-2315.783) (-2310.953) [-2303.780] -- 0:04:19
217500 -- (-2321.834) (-2315.127) [-2305.595] (-2316.942) * (-2313.650) [-2300.717] (-2301.428) (-2305.233) -- 0:04:19
218000 -- (-2316.712) (-2305.399) (-2315.347) [-2298.659] * (-2306.261) (-2300.559) (-2326.333) [-2303.483] -- 0:04:18
218500 -- (-2310.622) (-2315.110) (-2297.840) [-2302.804] * (-2302.774) [-2307.002] (-2315.072) (-2307.121) -- 0:04:17
219000 -- (-2320.743) (-2301.641) [-2304.800] (-2300.350) * (-2305.886) (-2300.474) (-2318.225) [-2311.584] -- 0:04:16
219500 -- (-2305.130) (-2303.561) (-2315.014) [-2298.661] * [-2307.788] (-2306.360) (-2310.236) (-2313.593) -- 0:04:16
220000 -- [-2303.657] (-2311.835) (-2300.961) (-2300.754) * (-2299.057) [-2301.701] (-2310.433) (-2309.105) -- 0:04:18
Average standard deviation of split frequencies: 0.011678
220500 -- (-2306.162) (-2316.737) [-2305.109] (-2312.801) * (-2317.382) (-2295.846) (-2300.238) [-2303.926] -- 0:04:18
221000 -- (-2302.960) (-2315.619) [-2303.366] (-2305.430) * [-2307.674] (-2316.543) (-2308.861) (-2311.592) -- 0:04:17
221500 -- (-2314.590) (-2308.595) (-2308.284) [-2301.235] * (-2298.420) [-2301.190] (-2303.975) (-2306.584) -- 0:04:16
222000 -- (-2310.471) (-2305.282) [-2308.060] (-2312.206) * (-2300.641) (-2308.846) (-2305.026) [-2308.152] -- 0:04:15
222500 -- (-2320.498) (-2313.231) (-2309.909) [-2296.200] * (-2299.519) [-2303.123] (-2300.020) (-2306.888) -- 0:04:15
223000 -- (-2307.479) (-2311.460) (-2305.890) [-2296.185] * [-2299.776] (-2305.527) (-2308.147) (-2319.605) -- 0:04:14
223500 -- (-2316.250) [-2307.961] (-2321.554) (-2303.864) * (-2302.480) (-2308.919) (-2314.526) [-2312.989] -- 0:04:17
224000 -- (-2307.412) (-2308.460) (-2310.494) [-2308.725] * [-2301.997] (-2304.469) (-2320.144) (-2301.743) -- 0:04:16
224500 -- (-2307.338) (-2323.005) [-2302.669] (-2312.700) * (-2302.657) (-2311.452) (-2307.901) [-2302.929] -- 0:04:15
225000 -- (-2315.727) (-2305.712) [-2308.089] (-2310.463) * [-2306.273] (-2306.801) (-2314.138) (-2316.559) -- 0:04:14
Average standard deviation of split frequencies: 0.010707
225500 -- [-2298.915] (-2303.708) (-2300.399) (-2317.458) * [-2304.548] (-2310.527) (-2308.041) (-2312.208) -- 0:04:14
226000 -- [-2302.946] (-2325.500) (-2311.595) (-2307.394) * [-2307.433] (-2315.285) (-2311.536) (-2312.790) -- 0:04:13
226500 -- [-2307.402] (-2317.854) (-2322.961) (-2315.055) * [-2307.779] (-2311.514) (-2305.561) (-2305.410) -- 0:04:12
227000 -- [-2308.372] (-2301.007) (-2318.750) (-2320.349) * (-2313.994) (-2311.572) [-2306.411] (-2312.386) -- 0:04:15
227500 -- (-2315.207) [-2299.541] (-2314.426) (-2305.441) * (-2295.461) [-2313.892] (-2308.287) (-2317.890) -- 0:04:14
228000 -- [-2308.050] (-2306.291) (-2317.095) (-2308.335) * (-2320.824) (-2310.622) (-2310.934) [-2305.639] -- 0:04:13
228500 -- (-2318.751) (-2305.514) (-2306.646) [-2313.919] * (-2315.439) (-2302.809) (-2307.512) [-2295.533] -- 0:04:13
229000 -- (-2301.010) [-2300.701] (-2307.480) (-2307.471) * (-2308.046) (-2312.003) (-2300.657) [-2303.609] -- 0:04:12
229500 -- (-2304.129) (-2301.717) [-2296.743] (-2298.657) * (-2313.581) (-2315.013) [-2302.475] (-2309.603) -- 0:04:11
230000 -- [-2297.715] (-2306.604) (-2303.750) (-2305.341) * [-2307.000] (-2308.557) (-2318.240) (-2302.444) -- 0:04:11
Average standard deviation of split frequencies: 0.011717
230500 -- [-2302.995] (-2306.349) (-2305.367) (-2312.673) * [-2312.654] (-2319.037) (-2315.674) (-2303.470) -- 0:04:13
231000 -- (-2304.926) [-2311.794] (-2298.227) (-2310.826) * (-2301.584) (-2302.304) (-2302.167) [-2311.791] -- 0:04:13
231500 -- (-2323.411) (-2305.088) [-2299.347] (-2302.555) * (-2300.712) [-2305.231] (-2305.619) (-2313.891) -- 0:04:12
232000 -- [-2310.590] (-2304.949) (-2311.518) (-2309.018) * (-2315.409) [-2301.215] (-2304.539) (-2315.501) -- 0:04:11
232500 -- (-2313.845) (-2313.789) (-2305.043) [-2305.969] * (-2309.454) (-2306.058) [-2309.974] (-2309.440) -- 0:04:10
233000 -- (-2322.509) (-2309.446) [-2301.744] (-2320.850) * [-2301.474] (-2311.057) (-2302.659) (-2309.362) -- 0:04:10
233500 -- (-2311.922) [-2314.587] (-2310.173) (-2319.193) * (-2309.138) [-2304.494] (-2319.645) (-2313.705) -- 0:04:09
234000 -- (-2308.112) (-2306.526) (-2308.156) [-2300.332] * [-2305.721] (-2308.973) (-2311.170) (-2298.903) -- 0:04:12
234500 -- (-2307.045) (-2320.396) (-2305.874) [-2297.142] * (-2315.661) (-2313.262) [-2298.827] (-2307.664) -- 0:04:11
235000 -- (-2311.076) [-2303.873] (-2305.447) (-2301.148) * [-2308.288] (-2312.699) (-2302.094) (-2304.737) -- 0:04:10
Average standard deviation of split frequencies: 0.012651
235500 -- (-2308.357) (-2302.723) [-2302.562] (-2305.652) * (-2314.182) [-2299.803] (-2315.019) (-2305.098) -- 0:04:09
236000 -- [-2306.606] (-2313.407) (-2311.627) (-2311.035) * (-2300.986) [-2299.573] (-2300.605) (-2320.153) -- 0:04:09
236500 -- [-2306.780] (-2299.190) (-2314.727) (-2307.465) * (-2303.068) [-2302.985] (-2316.844) (-2323.875) -- 0:04:08
237000 -- [-2308.337] (-2301.770) (-2306.105) (-2300.251) * [-2305.431] (-2322.784) (-2307.397) (-2310.551) -- 0:04:07
237500 -- [-2305.063] (-2310.709) (-2304.544) (-2306.302) * (-2297.468) (-2304.605) [-2305.829] (-2309.634) -- 0:04:10
238000 -- (-2307.589) (-2309.356) [-2309.597] (-2309.252) * (-2306.657) (-2308.888) (-2306.261) [-2303.122] -- 0:04:09
238500 -- (-2307.957) [-2297.261] (-2308.127) (-2324.233) * (-2302.683) (-2308.455) (-2311.298) [-2305.840] -- 0:04:09
239000 -- (-2311.277) [-2308.076] (-2310.138) (-2325.434) * [-2299.786] (-2303.839) (-2311.988) (-2304.811) -- 0:04:08
239500 -- (-2313.567) (-2306.517) [-2309.677] (-2302.125) * [-2302.463] (-2306.782) (-2309.059) (-2312.092) -- 0:04:07
240000 -- (-2301.093) (-2301.568) (-2318.011) [-2307.259] * (-2300.194) [-2303.486] (-2308.594) (-2315.342) -- 0:04:07
Average standard deviation of split frequencies: 0.012667
240500 -- (-2319.307) (-2306.177) (-2313.922) [-2308.481] * (-2300.010) (-2301.711) (-2322.002) [-2304.725] -- 0:04:06
241000 -- (-2308.284) [-2305.585] (-2317.554) (-2306.534) * (-2307.616) [-2301.083] (-2311.257) (-2306.474) -- 0:04:08
241500 -- (-2306.192) (-2303.941) (-2296.299) [-2311.561] * (-2310.437) (-2306.792) (-2303.433) [-2301.247] -- 0:04:08
242000 -- (-2304.515) [-2293.941] (-2304.802) (-2320.573) * (-2309.715) (-2305.716) [-2309.952] (-2303.005) -- 0:04:07
242500 -- (-2305.378) (-2304.314) [-2305.530] (-2320.379) * (-2308.170) (-2317.808) (-2309.367) [-2305.766] -- 0:04:06
243000 -- (-2300.414) (-2303.359) (-2310.992) [-2301.146] * [-2298.982] (-2316.642) (-2318.247) (-2296.825) -- 0:04:06
243500 -- (-2294.257) [-2305.789] (-2319.312) (-2307.472) * (-2309.011) (-2297.513) (-2306.405) [-2303.121] -- 0:04:05
244000 -- (-2306.425) (-2308.574) (-2312.448) [-2312.566] * (-2308.606) (-2307.499) (-2315.531) [-2303.223] -- 0:04:04
244500 -- (-2306.666) [-2305.805] (-2315.822) (-2306.655) * [-2315.361] (-2305.426) (-2314.987) (-2310.173) -- 0:04:07
245000 -- [-2301.967] (-2313.174) (-2321.924) (-2299.964) * (-2318.162) (-2317.414) (-2315.987) [-2300.799] -- 0:04:06
Average standard deviation of split frequencies: 0.012775
245500 -- (-2313.889) [-2302.259] (-2305.305) (-2305.071) * (-2309.935) (-2325.547) [-2301.856] (-2306.858) -- 0:04:05
246000 -- (-2316.440) [-2307.009] (-2301.136) (-2303.509) * (-2316.762) (-2308.922) (-2308.082) [-2297.041] -- 0:04:05
246500 -- (-2321.643) (-2300.038) (-2313.082) [-2304.714] * (-2317.045) [-2302.791] (-2313.134) (-2311.794) -- 0:04:04
247000 -- (-2310.011) [-2306.604] (-2312.277) (-2307.351) * (-2323.442) [-2298.713] (-2296.915) (-2309.412) -- 0:04:03
247500 -- (-2326.044) [-2310.621] (-2317.929) (-2315.180) * (-2314.054) [-2304.465] (-2310.200) (-2314.251) -- 0:04:03
248000 -- (-2309.389) (-2305.582) [-2301.782] (-2303.764) * [-2305.743] (-2311.994) (-2308.242) (-2312.425) -- 0:04:05
248500 -- (-2312.125) [-2308.589] (-2310.891) (-2312.905) * (-2312.180) (-2312.617) [-2295.563] (-2306.154) -- 0:04:04
249000 -- (-2308.770) [-2306.838] (-2309.716) (-2316.723) * (-2316.873) (-2320.163) [-2296.836] (-2317.514) -- 0:04:04
249500 -- (-2314.989) (-2306.579) [-2301.658] (-2310.998) * (-2308.485) (-2313.958) (-2300.899) [-2309.015] -- 0:04:03
250000 -- [-2300.203] (-2301.448) (-2317.466) (-2316.894) * (-2304.790) (-2306.296) (-2309.563) [-2302.414] -- 0:04:03
Average standard deviation of split frequencies: 0.013164
250500 -- (-2314.778) (-2299.966) [-2303.487] (-2323.161) * [-2302.386] (-2302.434) (-2307.683) (-2313.545) -- 0:04:02
251000 -- (-2314.862) [-2301.410] (-2313.495) (-2315.156) * (-2313.388) [-2313.829] (-2312.736) (-2308.434) -- 0:04:01
251500 -- (-2322.061) [-2306.530] (-2313.633) (-2312.392) * (-2309.636) [-2302.741] (-2317.033) (-2306.987) -- 0:04:04
252000 -- [-2307.832] (-2318.211) (-2307.050) (-2314.153) * (-2307.478) (-2312.001) [-2298.282] (-2308.983) -- 0:04:03
252500 -- (-2302.839) (-2306.171) [-2311.063] (-2312.270) * (-2311.322) (-2322.723) (-2317.622) [-2302.496] -- 0:04:02
253000 -- [-2300.451] (-2313.415) (-2306.150) (-2301.625) * (-2304.416) (-2312.701) [-2302.096] (-2316.337) -- 0:04:02
253500 -- [-2307.018] (-2305.011) (-2313.734) (-2310.767) * (-2321.837) [-2295.931] (-2317.770) (-2318.731) -- 0:04:01
254000 -- (-2309.654) (-2324.232) [-2305.359] (-2325.121) * (-2314.535) (-2310.458) (-2305.755) [-2310.461] -- 0:04:00
254500 -- (-2296.700) (-2311.177) [-2304.864] (-2311.470) * (-2311.656) (-2302.284) (-2308.051) [-2298.985] -- 0:04:00
255000 -- [-2303.743] (-2301.104) (-2321.404) (-2307.675) * (-2308.012) (-2300.541) [-2301.981] (-2303.922) -- 0:03:59
Average standard deviation of split frequencies: 0.014118
255500 -- (-2301.384) (-2302.009) (-2306.656) [-2306.644] * (-2316.389) [-2311.050] (-2317.352) (-2305.366) -- 0:04:01
256000 -- (-2310.002) (-2307.978) [-2307.119] (-2316.648) * (-2322.081) (-2320.012) (-2310.320) [-2306.701] -- 0:04:01
256500 -- (-2313.578) (-2299.036) (-2303.462) [-2304.342] * (-2314.454) (-2301.530) (-2305.479) [-2301.332] -- 0:04:00
257000 -- [-2305.160] (-2309.279) (-2309.937) (-2304.849) * [-2307.998] (-2309.058) (-2310.579) (-2308.084) -- 0:03:59
257500 -- (-2317.491) (-2302.162) [-2312.639] (-2311.347) * (-2308.046) (-2313.364) [-2304.029] (-2302.962) -- 0:03:59
258000 -- (-2314.310) [-2309.534] (-2310.316) (-2317.373) * (-2304.731) (-2315.455) (-2309.529) [-2315.554] -- 0:03:58
258500 -- (-2314.454) [-2303.898] (-2308.534) (-2325.922) * (-2302.412) (-2308.880) (-2309.941) [-2299.243] -- 0:04:00
259000 -- (-2303.269) (-2304.727) (-2301.721) [-2311.668] * (-2303.281) [-2306.240] (-2306.683) (-2301.894) -- 0:04:00
259500 -- [-2305.325] (-2305.354) (-2306.982) (-2307.055) * [-2308.802] (-2317.672) (-2309.520) (-2314.859) -- 0:03:59
260000 -- [-2308.616] (-2323.134) (-2302.850) (-2309.641) * (-2313.304) (-2314.340) (-2313.655) [-2303.303] -- 0:03:59
Average standard deviation of split frequencies: 0.013021
260500 -- (-2311.901) (-2307.334) (-2312.655) [-2303.285] * (-2307.956) (-2314.316) (-2310.732) [-2299.313] -- 0:03:58
261000 -- [-2309.152] (-2306.419) (-2306.382) (-2313.949) * (-2306.260) [-2301.826] (-2317.266) (-2322.971) -- 0:03:57
261500 -- (-2309.069) (-2301.968) [-2303.047] (-2309.121) * [-2296.327] (-2302.062) (-2310.701) (-2313.065) -- 0:03:57
262000 -- (-2306.992) (-2311.193) [-2310.953] (-2319.647) * [-2305.432] (-2313.494) (-2306.779) (-2307.476) -- 0:03:56
262500 -- (-2306.897) (-2318.262) [-2298.364] (-2315.329) * (-2308.961) (-2313.115) [-2305.110] (-2312.738) -- 0:03:58
263000 -- [-2299.902] (-2302.907) (-2307.814) (-2307.553) * (-2310.039) [-2303.391] (-2306.267) (-2301.804) -- 0:03:58
263500 -- (-2301.763) (-2313.152) (-2309.180) [-2299.864] * [-2306.355] (-2314.084) (-2317.743) (-2316.077) -- 0:03:57
264000 -- [-2305.814] (-2307.709) (-2309.981) (-2307.258) * (-2312.065) (-2314.660) (-2304.975) [-2296.528] -- 0:03:56
264500 -- (-2313.916) (-2305.385) [-2314.272] (-2318.776) * [-2300.812] (-2301.094) (-2302.467) (-2311.942) -- 0:03:56
265000 -- [-2303.189] (-2313.680) (-2319.737) (-2309.514) * (-2311.912) [-2308.452] (-2310.513) (-2298.468) -- 0:03:55
Average standard deviation of split frequencies: 0.014532
265500 -- (-2310.330) [-2307.480] (-2311.114) (-2308.816) * (-2305.508) [-2302.693] (-2312.386) (-2305.524) -- 0:03:55
266000 -- [-2305.850] (-2305.692) (-2309.321) (-2305.600) * (-2316.021) (-2300.167) (-2312.505) [-2298.708] -- 0:03:57
266500 -- [-2300.791] (-2315.002) (-2310.259) (-2300.821) * (-2300.531) (-2309.422) [-2310.430] (-2309.340) -- 0:03:56
267000 -- [-2305.022] (-2316.346) (-2308.025) (-2298.917) * (-2308.074) (-2309.283) (-2308.818) [-2310.368] -- 0:03:56
267500 -- (-2315.892) (-2325.732) [-2303.252] (-2305.241) * [-2303.920] (-2313.587) (-2309.967) (-2309.700) -- 0:03:55
268000 -- [-2300.246] (-2316.077) (-2310.429) (-2305.059) * (-2300.590) (-2306.998) [-2298.376] (-2305.604) -- 0:03:54
268500 -- [-2312.869] (-2301.939) (-2308.423) (-2316.092) * (-2315.254) (-2308.077) [-2309.080] (-2306.304) -- 0:03:54
269000 -- (-2314.868) [-2311.183] (-2315.932) (-2301.048) * (-2310.204) (-2315.683) (-2313.276) [-2310.443] -- 0:03:53
269500 -- (-2310.301) (-2306.146) [-2310.858] (-2310.576) * [-2300.670] (-2311.640) (-2302.038) (-2316.050) -- 0:03:55
270000 -- (-2300.797) [-2312.534] (-2311.269) (-2302.947) * [-2304.222] (-2307.169) (-2303.412) (-2324.309) -- 0:03:55
Average standard deviation of split frequencies: 0.015791
270500 -- (-2302.571) (-2304.655) (-2312.543) [-2309.028] * (-2305.404) (-2317.053) (-2318.298) [-2306.342] -- 0:03:54
271000 -- (-2307.331) (-2302.326) [-2299.533] (-2309.258) * (-2300.568) (-2316.395) [-2304.646] (-2302.118) -- 0:03:54
271500 -- (-2298.290) (-2303.374) (-2314.048) [-2306.326] * (-2302.762) [-2299.600] (-2315.005) (-2306.911) -- 0:03:53
272000 -- (-2306.506) (-2301.618) (-2320.356) [-2302.435] * (-2306.454) (-2303.290) [-2315.852] (-2325.517) -- 0:03:52
272500 -- [-2300.935] (-2307.995) (-2312.883) (-2308.046) * (-2313.323) [-2304.415] (-2310.032) (-2306.499) -- 0:03:52
273000 -- (-2311.229) [-2304.419] (-2309.006) (-2298.843) * (-2314.167) (-2304.631) (-2310.432) [-2309.019] -- 0:03:54
273500 -- (-2306.174) (-2314.612) [-2299.986] (-2310.360) * (-2310.758) (-2311.084) (-2310.532) [-2322.089] -- 0:03:53
274000 -- (-2302.069) (-2313.365) (-2319.159) [-2297.993] * [-2307.329] (-2313.822) (-2309.497) (-2321.759) -- 0:03:53
274500 -- (-2302.508) [-2309.391] (-2317.918) (-2311.615) * [-2313.314] (-2312.306) (-2312.892) (-2316.976) -- 0:03:52
275000 -- (-2321.534) (-2305.182) (-2322.199) [-2306.725] * [-2297.180] (-2313.862) (-2314.896) (-2300.318) -- 0:03:52
Average standard deviation of split frequencies: 0.016511
275500 -- (-2304.129) (-2301.939) (-2304.483) [-2297.775] * (-2310.540) (-2306.290) (-2308.864) [-2308.420] -- 0:03:51
276000 -- (-2304.441) [-2303.538] (-2310.812) (-2310.245) * (-2306.668) (-2299.340) (-2313.833) [-2301.295] -- 0:03:50
276500 -- (-2310.211) [-2304.727] (-2309.296) (-2306.099) * (-2308.460) [-2301.556] (-2306.855) (-2317.517) -- 0:03:52
277000 -- [-2304.101] (-2308.152) (-2305.922) (-2302.245) * (-2324.993) (-2310.491) [-2305.237] (-2308.304) -- 0:03:52
277500 -- (-2301.842) [-2313.775] (-2311.310) (-2307.249) * (-2312.484) [-2313.394] (-2306.986) (-2310.715) -- 0:03:51
278000 -- (-2312.588) (-2316.437) (-2313.279) [-2301.825] * [-2315.795] (-2308.798) (-2313.316) (-2308.490) -- 0:03:51
278500 -- (-2307.600) (-2309.146) (-2323.080) [-2301.101] * (-2305.875) (-2316.048) [-2305.924] (-2309.127) -- 0:03:50
279000 -- (-2304.111) (-2303.655) [-2299.943] (-2310.613) * (-2310.417) (-2327.801) (-2307.970) [-2303.743] -- 0:03:49
279500 -- (-2312.848) (-2321.603) (-2313.862) [-2302.857] * (-2313.407) [-2299.665] (-2311.362) (-2304.063) -- 0:03:49
280000 -- [-2314.336] (-2314.728) (-2303.747) (-2318.726) * (-2316.668) (-2305.719) [-2308.240] (-2315.837) -- 0:03:51
Average standard deviation of split frequencies: 0.014780
280500 -- (-2319.779) [-2308.394] (-2316.064) (-2304.410) * [-2306.079] (-2304.741) (-2311.714) (-2315.930) -- 0:03:50
281000 -- (-2319.080) (-2303.798) [-2313.193] (-2304.728) * (-2307.443) [-2300.206] (-2312.007) (-2311.150) -- 0:03:50
281500 -- (-2317.505) [-2305.107] (-2307.952) (-2313.204) * (-2302.247) (-2312.773) [-2308.566] (-2310.853) -- 0:03:49
282000 -- (-2304.219) (-2310.903) [-2306.155] (-2315.407) * (-2314.975) (-2304.334) (-2317.547) [-2300.966] -- 0:03:49
282500 -- [-2311.042] (-2318.099) (-2320.239) (-2305.038) * (-2301.677) (-2317.034) [-2312.943] (-2311.381) -- 0:03:48
283000 -- (-2308.594) (-2304.000) (-2323.181) [-2297.680] * (-2313.976) [-2304.989] (-2306.174) (-2309.881) -- 0:03:48
283500 -- [-2303.128] (-2308.099) (-2318.413) (-2305.632) * [-2308.979] (-2317.219) (-2307.887) (-2304.730) -- 0:03:49
284000 -- (-2313.199) (-2313.755) (-2318.658) [-2301.902] * (-2307.090) (-2305.443) (-2316.543) [-2306.061] -- 0:03:49
284500 -- [-2312.142] (-2317.980) (-2318.885) (-2308.321) * [-2301.263] (-2318.206) (-2320.823) (-2318.781) -- 0:03:48
285000 -- (-2307.353) [-2309.942] (-2320.116) (-2311.858) * (-2306.982) (-2306.890) [-2306.011] (-2307.981) -- 0:03:48
Average standard deviation of split frequencies: 0.015384
285500 -- (-2310.228) (-2300.816) (-2317.942) [-2304.027] * (-2307.798) [-2306.624] (-2305.493) (-2310.857) -- 0:03:47
286000 -- [-2309.968] (-2310.431) (-2314.437) (-2324.671) * (-2311.706) (-2310.990) (-2312.334) [-2311.276] -- 0:03:47
286500 -- [-2306.136] (-2310.530) (-2312.293) (-2317.598) * (-2320.939) (-2314.130) (-2301.475) [-2301.322] -- 0:03:49
287000 -- [-2299.244] (-2306.605) (-2307.578) (-2307.505) * (-2318.668) (-2298.787) (-2310.229) [-2304.383] -- 0:03:48
287500 -- (-2308.624) (-2311.188) (-2309.103) [-2302.800] * [-2311.334] (-2309.592) (-2308.037) (-2316.109) -- 0:03:48
288000 -- (-2306.379) [-2305.935] (-2325.180) (-2309.909) * (-2310.682) (-2318.215) [-2307.811] (-2308.500) -- 0:03:47
288500 -- (-2300.394) [-2296.879] (-2311.959) (-2303.732) * (-2313.206) [-2309.725] (-2313.722) (-2321.932) -- 0:03:46
289000 -- (-2311.938) (-2308.049) (-2315.904) [-2298.042] * [-2306.267] (-2318.639) (-2306.267) (-2313.808) -- 0:03:48
289500 -- [-2294.581] (-2308.239) (-2313.039) (-2310.768) * (-2305.320) (-2305.314) [-2310.323] (-2306.508) -- 0:03:48
290000 -- [-2297.943] (-2317.456) (-2312.266) (-2303.794) * (-2306.710) [-2310.452] (-2310.077) (-2314.390) -- 0:03:47
Average standard deviation of split frequencies: 0.014272
290500 -- [-2300.139] (-2306.839) (-2318.238) (-2304.525) * (-2306.996) (-2302.825) (-2310.110) [-2304.129] -- 0:03:47
291000 -- (-2310.347) [-2305.435] (-2324.247) (-2305.225) * [-2308.500] (-2325.002) (-2306.276) (-2302.492) -- 0:03:46
291500 -- [-2307.559] (-2312.779) (-2310.724) (-2317.683) * (-2310.228) [-2320.103] (-2309.842) (-2305.910) -- 0:03:46
292000 -- [-2300.827] (-2322.999) (-2301.519) (-2309.800) * (-2306.584) [-2308.942] (-2303.498) (-2304.974) -- 0:03:45
292500 -- [-2306.226] (-2314.362) (-2313.911) (-2307.904) * (-2311.693) [-2297.812] (-2309.397) (-2307.477) -- 0:03:47
293000 -- (-2305.210) [-2299.833] (-2320.987) (-2314.825) * (-2310.672) (-2305.380) (-2309.120) [-2304.248] -- 0:03:46
293500 -- [-2307.899] (-2318.482) (-2310.967) (-2308.047) * (-2314.256) (-2322.227) [-2310.448] (-2309.414) -- 0:03:46
294000 -- (-2321.860) (-2313.466) (-2315.782) [-2312.631] * (-2308.435) (-2333.927) [-2308.840] (-2316.939) -- 0:03:45
294500 -- (-2318.599) (-2304.569) [-2302.426] (-2301.708) * (-2311.262) (-2325.474) [-2300.770] (-2309.110) -- 0:03:45
295000 -- (-2317.237) (-2303.937) (-2314.992) [-2302.850] * [-2312.844] (-2315.894) (-2306.617) (-2302.152) -- 0:03:44
Average standard deviation of split frequencies: 0.013378
295500 -- (-2311.438) (-2302.503) [-2301.790] (-2298.333) * (-2307.060) (-2313.852) [-2305.329] (-2315.428) -- 0:03:44
296000 -- [-2302.316] (-2309.350) (-2310.741) (-2312.976) * (-2320.434) (-2319.970) [-2303.084] (-2315.649) -- 0:03:43
296500 -- (-2304.746) [-2304.779] (-2307.091) (-2306.746) * (-2305.270) [-2307.957] (-2309.976) (-2302.778) -- 0:03:45
297000 -- (-2308.545) (-2317.232) [-2297.771] (-2306.550) * (-2309.060) (-2298.915) (-2305.972) [-2298.468] -- 0:03:44
297500 -- [-2300.250] (-2308.097) (-2322.255) (-2311.540) * (-2308.733) [-2311.500] (-2315.724) (-2308.070) -- 0:03:44
298000 -- [-2305.512] (-2312.033) (-2301.811) (-2327.022) * (-2320.783) [-2303.913] (-2309.069) (-2293.585) -- 0:03:43
298500 -- (-2309.596) (-2308.237) (-2317.883) [-2317.042] * (-2315.870) (-2305.077) [-2302.268] (-2298.664) -- 0:03:43
299000 -- [-2305.213] (-2304.108) (-2303.328) (-2312.512) * (-2318.760) [-2301.897] (-2322.447) (-2306.045) -- 0:03:42
299500 -- [-2307.986] (-2307.149) (-2311.943) (-2311.117) * (-2315.622) [-2306.708] (-2304.429) (-2308.037) -- 0:03:42
300000 -- (-2305.786) [-2298.537] (-2308.186) (-2328.966) * (-2309.911) (-2304.416) [-2305.443] (-2300.905) -- 0:03:44
Average standard deviation of split frequencies: 0.011498
300500 -- (-2311.645) (-2312.599) (-2318.706) [-2304.705] * (-2310.384) (-2300.278) (-2317.336) [-2305.996] -- 0:03:43
301000 -- (-2298.623) [-2295.135] (-2309.817) (-2320.866) * (-2299.487) (-2309.180) [-2304.402] (-2311.980) -- 0:03:42
301500 -- (-2303.793) (-2311.834) (-2308.978) [-2312.263] * (-2298.848) (-2307.497) [-2304.936] (-2314.508) -- 0:03:42
302000 -- (-2308.622) [-2305.662] (-2306.545) (-2297.717) * (-2304.278) [-2305.705] (-2314.107) (-2304.973) -- 0:03:41
302500 -- (-2305.388) (-2312.389) [-2308.035] (-2303.960) * (-2315.024) [-2298.940] (-2313.049) (-2318.969) -- 0:03:41
303000 -- (-2308.956) (-2314.589) (-2315.108) [-2297.539] * (-2319.494) (-2299.880) (-2314.602) [-2301.939] -- 0:03:40
303500 -- [-2307.666] (-2308.616) (-2305.810) (-2297.191) * (-2318.222) (-2312.472) (-2319.549) [-2298.445] -- 0:03:42
304000 -- (-2313.843) (-2307.433) (-2318.189) [-2304.320] * [-2312.475] (-2308.336) (-2311.096) (-2320.519) -- 0:03:42
304500 -- (-2318.994) (-2313.291) (-2330.891) [-2307.347] * (-2310.629) (-2304.053) (-2310.492) [-2304.994] -- 0:03:41
305000 -- (-2310.670) (-2314.262) (-2307.037) [-2301.976] * [-2303.502] (-2302.460) (-2306.106) (-2303.921) -- 0:03:41
Average standard deviation of split frequencies: 0.011503
305500 -- [-2311.294] (-2314.105) (-2322.023) (-2301.205) * [-2306.013] (-2314.045) (-2311.267) (-2304.154) -- 0:03:40
306000 -- [-2306.614] (-2311.360) (-2310.691) (-2303.884) * (-2309.575) (-2318.024) (-2306.789) [-2301.266] -- 0:03:39
306500 -- [-2308.929] (-2319.337) (-2310.289) (-2300.363) * [-2307.799] (-2316.038) (-2308.808) (-2312.476) -- 0:03:39
307000 -- (-2309.225) (-2316.920) (-2303.799) [-2306.241] * (-2308.789) [-2304.716] (-2306.552) (-2311.940) -- 0:03:41
307500 -- (-2310.727) (-2307.014) (-2309.222) [-2301.924] * (-2313.761) (-2317.860) [-2312.624] (-2310.809) -- 0:03:40
308000 -- (-2317.170) [-2303.311] (-2323.171) (-2313.489) * (-2326.031) [-2302.008] (-2313.878) (-2300.019) -- 0:03:40
308500 -- (-2309.858) (-2304.476) [-2317.835] (-2301.239) * (-2313.147) [-2298.922] (-2316.923) (-2299.416) -- 0:03:39
309000 -- (-2307.265) (-2310.300) [-2300.410] (-2307.420) * (-2308.878) (-2312.514) (-2306.623) [-2302.084] -- 0:03:39
309500 -- (-2313.216) (-2309.580) [-2299.264] (-2302.542) * (-2300.285) [-2305.921] (-2312.779) (-2313.078) -- 0:03:38
310000 -- (-2312.316) (-2313.214) [-2307.906] (-2323.051) * (-2304.396) (-2316.109) (-2304.976) [-2305.336] -- 0:03:38
Average standard deviation of split frequencies: 0.013151
310500 -- (-2310.400) (-2310.435) (-2306.229) [-2307.840] * [-2302.308] (-2302.473) (-2305.437) (-2310.529) -- 0:03:39
311000 -- (-2314.777) (-2316.560) [-2303.136] (-2319.720) * [-2296.633] (-2308.879) (-2305.495) (-2317.946) -- 0:03:39
311500 -- (-2306.610) (-2308.828) [-2306.300] (-2315.999) * (-2306.006) (-2307.589) (-2313.587) [-2305.703] -- 0:03:38
312000 -- (-2299.971) (-2318.757) (-2299.500) [-2300.094] * [-2301.558] (-2305.659) (-2305.261) (-2311.383) -- 0:03:38
312500 -- [-2312.597] (-2310.896) (-2307.711) (-2305.515) * (-2311.274) [-2303.865] (-2307.579) (-2309.051) -- 0:03:37
313000 -- (-2310.541) (-2315.955) [-2309.492] (-2306.585) * [-2305.979] (-2311.928) (-2312.132) (-2301.124) -- 0:03:37
313500 -- (-2302.739) (-2306.122) [-2318.004] (-2311.160) * (-2313.262) (-2315.409) (-2330.479) [-2296.953] -- 0:03:36
314000 -- (-2309.003) (-2309.799) [-2303.277] (-2310.252) * (-2303.116) [-2309.543] (-2300.345) (-2315.216) -- 0:03:38
314500 -- [-2305.365] (-2311.141) (-2307.056) (-2314.681) * (-2310.432) [-2309.573] (-2307.193) (-2296.809) -- 0:03:37
315000 -- [-2310.014] (-2321.932) (-2304.742) (-2321.372) * (-2305.628) (-2296.888) [-2301.949] (-2315.285) -- 0:03:37
Average standard deviation of split frequencies: 0.011934
315500 -- (-2316.556) [-2304.676] (-2304.627) (-2314.548) * (-2304.683) [-2304.018] (-2303.891) (-2308.371) -- 0:03:36
316000 -- (-2303.907) (-2304.782) (-2319.719) [-2309.805] * (-2315.229) [-2317.798] (-2298.193) (-2299.802) -- 0:03:36
316500 -- (-2309.274) (-2301.117) (-2313.209) [-2312.438] * (-2309.594) [-2306.376] (-2298.063) (-2311.519) -- 0:03:35
317000 -- (-2306.952) (-2315.299) (-2311.114) [-2299.276] * (-2302.976) (-2311.398) (-2303.825) [-2300.140] -- 0:03:35
317500 -- (-2307.554) [-2306.715] (-2314.301) (-2310.075) * (-2306.631) (-2312.127) (-2304.273) [-2307.834] -- 0:03:34
318000 -- (-2319.546) [-2304.792] (-2306.494) (-2310.079) * (-2307.687) (-2301.979) [-2300.708] (-2303.909) -- 0:03:36
318500 -- (-2314.413) [-2299.538] (-2307.407) (-2308.138) * (-2314.786) [-2309.010] (-2308.080) (-2308.860) -- 0:03:36
319000 -- [-2313.222] (-2313.005) (-2318.092) (-2302.473) * (-2307.381) (-2306.150) (-2297.072) [-2298.163] -- 0:03:35
319500 -- (-2314.964) (-2314.444) (-2320.336) [-2303.276] * (-2336.827) (-2309.859) [-2305.308] (-2311.812) -- 0:03:35
320000 -- (-2303.832) (-2316.559) (-2303.735) [-2311.423] * (-2314.250) (-2314.078) [-2305.308] (-2303.285) -- 0:03:34
Average standard deviation of split frequencies: 0.012153
320500 -- [-2300.742] (-2304.692) (-2307.159) (-2318.454) * [-2305.262] (-2305.321) (-2310.956) (-2298.305) -- 0:03:34
321000 -- (-2304.665) [-2298.736] (-2320.020) (-2300.910) * (-2304.991) (-2304.440) [-2312.426] (-2325.104) -- 0:03:35
321500 -- [-2305.031] (-2306.434) (-2301.183) (-2317.341) * [-2315.015] (-2312.387) (-2317.919) (-2310.000) -- 0:03:35
322000 -- (-2312.762) (-2297.044) [-2302.128] (-2319.014) * (-2311.108) (-2308.294) [-2313.700] (-2307.546) -- 0:03:34
322500 -- (-2312.723) (-2303.535) [-2300.507] (-2322.069) * (-2312.849) (-2326.685) (-2309.321) [-2300.716] -- 0:03:34
323000 -- (-2309.188) [-2308.917] (-2309.342) (-2308.276) * [-2307.283] (-2313.680) (-2319.910) (-2312.196) -- 0:03:33
323500 -- (-2316.184) (-2305.212) (-2305.494) [-2303.826] * (-2300.397) [-2302.097] (-2307.711) (-2315.973) -- 0:03:35
324000 -- (-2323.577) [-2302.116] (-2312.568) (-2304.044) * (-2305.449) (-2303.494) [-2302.140] (-2300.556) -- 0:03:34
324500 -- (-2317.708) [-2305.093] (-2308.274) (-2306.637) * (-2305.943) (-2310.295) (-2310.207) [-2312.354] -- 0:03:34
325000 -- (-2311.643) (-2307.197) [-2305.524] (-2305.070) * [-2310.100] (-2303.145) (-2307.928) (-2303.735) -- 0:03:33
Average standard deviation of split frequencies: 0.011954
325500 -- [-2311.373] (-2297.256) (-2318.845) (-2314.007) * [-2301.193] (-2302.000) (-2313.656) (-2308.214) -- 0:03:33
326000 -- (-2309.215) [-2302.194] (-2312.082) (-2307.954) * (-2303.427) (-2300.624) (-2305.312) [-2311.565] -- 0:03:32
326500 -- (-2315.455) [-2306.086] (-2315.496) (-2312.278) * [-2303.397] (-2303.628) (-2305.561) (-2306.507) -- 0:03:34
327000 -- (-2313.877) [-2303.103] (-2298.806) (-2303.377) * (-2313.595) [-2306.145] (-2306.326) (-2307.674) -- 0:03:34
327500 -- (-2306.525) [-2313.490] (-2309.050) (-2318.435) * (-2302.105) (-2312.653) [-2311.430] (-2318.106) -- 0:03:33
328000 -- [-2299.489] (-2322.271) (-2301.891) (-2303.039) * (-2318.484) [-2311.184] (-2304.576) (-2307.253) -- 0:03:33
328500 -- [-2301.843] (-2307.419) (-2321.295) (-2303.434) * [-2304.547] (-2309.451) (-2310.287) (-2305.108) -- 0:03:32
329000 -- (-2304.160) [-2305.301] (-2322.161) (-2312.841) * (-2319.815) (-2308.093) (-2306.728) [-2308.930] -- 0:03:34
329500 -- [-2318.422] (-2309.054) (-2316.179) (-2308.887) * (-2319.425) [-2310.941] (-2307.043) (-2307.449) -- 0:03:33
330000 -- (-2315.246) (-2306.639) [-2311.545] (-2314.480) * (-2316.295) (-2310.600) (-2309.746) [-2307.715] -- 0:03:33
Average standard deviation of split frequencies: 0.012640
330500 -- [-2304.002] (-2301.226) (-2314.247) (-2302.599) * (-2313.048) (-2309.660) (-2303.276) [-2306.070] -- 0:03:32
331000 -- (-2314.249) [-2303.358] (-2318.209) (-2307.098) * (-2306.369) [-2297.181] (-2312.053) (-2302.374) -- 0:03:32
331500 -- [-2317.833] (-2304.310) (-2319.512) (-2310.060) * (-2306.437) [-2307.881] (-2306.133) (-2304.058) -- 0:03:31
332000 -- (-2312.962) (-2308.908) (-2310.799) [-2300.710] * (-2307.157) (-2311.697) (-2315.740) [-2306.467] -- 0:03:33
332500 -- [-2309.063] (-2299.254) (-2310.213) (-2307.087) * (-2317.185) (-2307.299) (-2318.608) [-2297.604] -- 0:03:32
333000 -- [-2302.530] (-2307.876) (-2304.526) (-2309.291) * (-2313.424) (-2312.307) [-2301.291] (-2313.032) -- 0:03:32
333500 -- (-2303.926) (-2310.569) [-2309.413] (-2301.831) * [-2299.817] (-2315.545) (-2311.303) (-2315.282) -- 0:03:31
334000 -- (-2299.136) [-2307.688] (-2305.916) (-2309.031) * (-2306.104) (-2311.020) [-2306.168] (-2327.696) -- 0:03:31
334500 -- (-2308.812) [-2296.693] (-2303.259) (-2313.658) * [-2303.959] (-2324.360) (-2315.755) (-2315.793) -- 0:03:30
335000 -- (-2308.982) (-2307.492) (-2306.188) [-2310.379] * (-2318.050) [-2308.892] (-2314.179) (-2302.789) -- 0:03:32
Average standard deviation of split frequencies: 0.011505
335500 -- [-2307.970] (-2311.585) (-2314.127) (-2300.805) * (-2317.673) [-2302.724] (-2305.230) (-2313.561) -- 0:03:31
336000 -- (-2303.549) (-2303.869) (-2313.102) [-2312.079] * [-2311.962] (-2305.757) (-2317.359) (-2316.879) -- 0:03:31
336500 -- (-2306.922) [-2298.897] (-2305.317) (-2309.744) * (-2298.405) (-2322.260) [-2304.370] (-2309.347) -- 0:03:30
337000 -- (-2312.544) [-2298.988] (-2307.789) (-2312.002) * (-2308.200) [-2315.048] (-2308.419) (-2308.992) -- 0:03:30
337500 -- (-2305.265) [-2309.607] (-2327.771) (-2307.724) * (-2314.877) [-2305.360] (-2302.868) (-2322.703) -- 0:03:30
338000 -- (-2307.240) [-2312.937] (-2312.445) (-2305.638) * [-2311.786] (-2306.692) (-2308.061) (-2312.031) -- 0:03:31
338500 -- (-2306.845) [-2304.368] (-2308.543) (-2311.645) * [-2310.277] (-2297.135) (-2310.061) (-2311.400) -- 0:03:31
339000 -- [-2299.531] (-2301.347) (-2311.047) (-2305.121) * [-2314.089] (-2313.901) (-2310.407) (-2311.891) -- 0:03:30
339500 -- [-2299.016] (-2312.770) (-2317.805) (-2301.654) * [-2305.128] (-2311.589) (-2311.880) (-2305.656) -- 0:03:30
340000 -- (-2301.220) (-2322.015) (-2297.509) [-2305.639] * (-2314.211) (-2316.709) [-2300.422] (-2304.639) -- 0:03:29
Average standard deviation of split frequencies: 0.010793
340500 -- (-2310.870) (-2305.802) (-2312.481) [-2304.389] * (-2312.922) (-2311.302) [-2300.961] (-2319.251) -- 0:03:31
341000 -- (-2318.460) [-2314.202] (-2307.834) (-2317.329) * (-2325.794) (-2318.118) [-2300.747] (-2313.675) -- 0:03:30
341500 -- (-2300.232) (-2317.012) (-2302.863) [-2299.910] * (-2312.749) (-2308.005) (-2306.009) [-2303.843] -- 0:03:30
342000 -- (-2298.292) [-2304.453] (-2306.699) (-2306.171) * (-2322.949) [-2308.756] (-2311.552) (-2311.019) -- 0:03:29
342500 -- [-2307.423] (-2297.071) (-2306.608) (-2309.269) * (-2314.334) (-2313.835) [-2316.063] (-2307.100) -- 0:03:29
343000 -- (-2301.038) (-2305.133) (-2297.830) [-2303.966] * (-2316.929) (-2302.834) [-2302.792] (-2322.887) -- 0:03:28
343500 -- [-2314.291] (-2299.330) (-2300.598) (-2315.315) * [-2310.548] (-2313.803) (-2313.898) (-2305.146) -- 0:03:30
344000 -- (-2312.679) [-2302.234] (-2307.186) (-2314.912) * (-2308.591) [-2299.013] (-2302.316) (-2303.857) -- 0:03:29
344500 -- (-2306.308) (-2300.831) (-2313.980) [-2312.571] * (-2305.234) (-2308.102) [-2309.719] (-2320.410) -- 0:03:29
345000 -- [-2314.120] (-2316.666) (-2319.276) (-2311.182) * (-2318.838) [-2306.945] (-2313.928) (-2320.991) -- 0:03:28
Average standard deviation of split frequencies: 0.010173
345500 -- (-2309.352) (-2303.701) [-2305.353] (-2305.627) * (-2316.114) (-2313.754) [-2303.225] (-2305.170) -- 0:03:28
346000 -- (-2314.426) (-2307.740) [-2300.393] (-2300.326) * (-2316.626) [-2307.851] (-2314.074) (-2303.019) -- 0:03:27
346500 -- (-2310.903) (-2320.514) (-2304.986) [-2315.077] * (-2310.344) (-2306.190) (-2306.644) [-2305.285] -- 0:03:27
347000 -- (-2307.822) (-2299.046) [-2303.348] (-2305.240) * (-2319.808) (-2311.202) [-2307.022] (-2307.441) -- 0:03:28
347500 -- (-2307.646) [-2304.297] (-2309.594) (-2309.327) * (-2316.624) [-2307.007] (-2313.994) (-2306.077) -- 0:03:28
348000 -- (-2304.838) [-2305.324] (-2303.923) (-2301.081) * [-2302.190] (-2311.228) (-2308.232) (-2303.033) -- 0:03:27
348500 -- (-2326.783) (-2311.894) (-2315.124) [-2302.930] * (-2322.927) (-2311.029) [-2304.655] (-2304.780) -- 0:03:27
349000 -- [-2307.399] (-2313.638) (-2303.043) (-2303.503) * (-2315.738) (-2305.028) [-2298.649] (-2320.767) -- 0:03:27
349500 -- (-2308.831) [-2312.428] (-2306.324) (-2310.933) * [-2312.448] (-2307.466) (-2307.614) (-2315.365) -- 0:03:26
350000 -- (-2308.325) [-2297.408] (-2319.537) (-2304.856) * (-2307.365) (-2308.262) [-2306.278] (-2303.438) -- 0:03:26
Average standard deviation of split frequencies: 0.009500
350500 -- [-2305.630] (-2317.563) (-2319.519) (-2305.068) * (-2317.133) (-2311.423) [-2302.078] (-2298.921) -- 0:03:27
351000 -- [-2299.829] (-2302.811) (-2319.191) (-2300.725) * (-2300.656) (-2306.196) [-2307.198] (-2305.199) -- 0:03:27
351500 -- (-2305.428) (-2315.040) (-2311.827) [-2293.199] * (-2310.879) (-2315.234) [-2309.164] (-2305.467) -- 0:03:26
352000 -- (-2310.830) (-2305.382) [-2309.872] (-2309.437) * (-2311.760) (-2312.068) [-2305.736] (-2302.753) -- 0:03:26
352500 -- [-2307.637] (-2317.938) (-2303.041) (-2301.283) * (-2302.907) (-2314.202) [-2309.574] (-2306.575) -- 0:03:25
353000 -- (-2308.200) (-2310.433) [-2306.581] (-2306.213) * (-2304.524) [-2309.374] (-2313.885) (-2307.346) -- 0:03:25
353500 -- [-2311.528] (-2321.367) (-2305.352) (-2301.321) * (-2302.234) [-2316.913] (-2308.379) (-2312.868) -- 0:03:24
354000 -- [-2307.932] (-2319.230) (-2307.070) (-2311.340) * [-2309.080] (-2316.973) (-2309.711) (-2304.740) -- 0:03:26
354500 -- (-2313.789) (-2325.813) (-2318.280) [-2323.696] * (-2310.931) [-2307.796] (-2308.677) (-2306.070) -- 0:03:25
355000 -- (-2326.380) [-2317.401] (-2303.219) (-2313.909) * [-2309.280] (-2310.949) (-2315.367) (-2299.745) -- 0:03:25
Average standard deviation of split frequencies: 0.009711
355500 -- (-2303.025) (-2322.334) [-2302.123] (-2310.317) * (-2306.694) [-2309.497] (-2320.823) (-2308.853) -- 0:03:24
356000 -- (-2312.303) (-2308.704) [-2304.851] (-2305.871) * (-2298.460) (-2304.949) [-2305.261] (-2303.129) -- 0:03:24
356500 -- [-2311.205] (-2310.879) (-2338.046) (-2302.240) * (-2305.379) [-2308.774] (-2317.713) (-2312.504) -- 0:03:23
357000 -- [-2299.741] (-2309.812) (-2315.051) (-2309.105) * (-2295.910) (-2311.731) [-2307.943] (-2312.084) -- 0:03:23
357500 -- (-2311.564) (-2304.137) [-2301.296] (-2308.168) * (-2304.027) (-2307.538) [-2298.948] (-2302.816) -- 0:03:24
358000 -- (-2311.001) (-2312.308) (-2317.410) [-2302.785] * (-2307.552) [-2308.826] (-2307.396) (-2305.087) -- 0:03:24
358500 -- (-2315.670) (-2315.457) (-2314.728) [-2302.827] * (-2303.559) (-2302.849) [-2304.666] (-2310.164) -- 0:03:23
359000 -- (-2302.672) [-2299.577] (-2305.385) (-2316.128) * (-2306.476) [-2306.037] (-2316.394) (-2312.778) -- 0:03:23
359500 -- (-2307.043) [-2302.489] (-2303.453) (-2313.376) * (-2309.095) [-2299.608] (-2297.032) (-2308.723) -- 0:03:23
360000 -- (-2311.330) (-2308.854) (-2307.899) [-2308.272] * (-2300.675) (-2306.401) [-2312.875] (-2309.108) -- 0:03:22
Average standard deviation of split frequencies: 0.010282
360500 -- [-2307.347] (-2301.319) (-2317.622) (-2316.690) * (-2310.332) [-2302.288] (-2313.836) (-2307.590) -- 0:03:22
361000 -- (-2313.160) [-2306.257] (-2300.982) (-2316.009) * (-2313.641) [-2301.048] (-2306.115) (-2303.443) -- 0:03:23
361500 -- [-2302.342] (-2306.785) (-2309.132) (-2304.537) * (-2329.350) (-2309.041) (-2306.324) [-2303.171] -- 0:03:23
362000 -- (-2310.936) (-2302.590) [-2300.989] (-2320.578) * (-2320.069) [-2310.511] (-2304.096) (-2312.243) -- 0:03:22
362500 -- (-2310.823) [-2299.977] (-2295.738) (-2308.632) * (-2308.947) (-2317.018) [-2302.481] (-2304.512) -- 0:03:22
363000 -- (-2309.849) (-2319.004) [-2305.440] (-2313.016) * (-2325.361) (-2298.614) (-2320.490) [-2297.081] -- 0:03:21
363500 -- (-2305.863) (-2310.294) (-2308.169) [-2296.240] * [-2300.226] (-2317.829) (-2304.273) (-2309.125) -- 0:03:21
364000 -- (-2299.296) (-2311.555) [-2309.723] (-2298.804) * (-2312.799) (-2314.736) (-2310.695) [-2303.580] -- 0:03:22
364500 -- (-2311.741) (-2306.877) (-2321.064) [-2298.743] * (-2303.370) (-2312.124) (-2317.538) [-2302.304] -- 0:03:22
365000 -- (-2306.340) [-2299.764] (-2305.721) (-2306.989) * (-2314.668) (-2311.182) (-2319.360) [-2303.713] -- 0:03:21
Average standard deviation of split frequencies: 0.010132
365500 -- (-2319.893) (-2313.684) (-2313.184) [-2299.653] * (-2315.923) [-2313.207] (-2307.165) (-2323.447) -- 0:03:21
366000 -- [-2300.446] (-2318.364) (-2304.628) (-2309.088) * [-2299.056] (-2321.632) (-2305.355) (-2316.229) -- 0:03:20
366500 -- (-2297.938) [-2302.992] (-2307.922) (-2300.886) * (-2314.217) (-2303.849) [-2315.069] (-2301.644) -- 0:03:22
367000 -- (-2302.542) (-2303.364) [-2300.230] (-2302.787) * (-2307.491) (-2312.907) (-2305.526) [-2300.223] -- 0:03:21
367500 -- (-2308.505) [-2298.829] (-2313.501) (-2298.041) * [-2297.818] (-2302.935) (-2305.307) (-2313.019) -- 0:03:21
368000 -- (-2319.808) [-2303.846] (-2315.563) (-2312.897) * [-2304.856] (-2303.868) (-2314.220) (-2303.136) -- 0:03:20
368500 -- (-2321.192) (-2311.084) (-2309.894) [-2303.927] * (-2306.078) (-2307.236) [-2304.484] (-2299.573) -- 0:03:20
369000 -- (-2318.646) (-2316.099) (-2309.449) [-2303.836] * (-2312.238) (-2305.739) [-2296.411] (-2311.006) -- 0:03:20
369500 -- [-2308.868] (-2316.935) (-2304.678) (-2313.606) * [-2305.433] (-2316.660) (-2314.438) (-2308.817) -- 0:03:19
370000 -- [-2298.446] (-2310.367) (-2301.720) (-2329.559) * (-2311.455) [-2298.252] (-2309.546) (-2314.597) -- 0:03:20
Average standard deviation of split frequencies: 0.010174
370500 -- (-2312.589) [-2304.894] (-2307.353) (-2305.297) * (-2316.908) [-2301.622] (-2304.429) (-2312.138) -- 0:03:20
371000 -- (-2326.642) (-2310.681) (-2317.359) [-2299.911] * (-2320.420) (-2308.550) [-2300.912] (-2306.554) -- 0:03:20
371500 -- (-2307.867) [-2300.772] (-2307.032) (-2305.777) * (-2316.884) (-2304.123) (-2308.435) [-2310.018] -- 0:03:19
372000 -- (-2301.232) [-2299.698] (-2309.821) (-2320.514) * (-2320.607) (-2306.369) (-2305.925) [-2306.102] -- 0:03:19
372500 -- [-2306.386] (-2308.911) (-2299.814) (-2320.092) * (-2316.733) (-2307.037) (-2314.279) [-2305.504] -- 0:03:18
373000 -- [-2321.894] (-2304.004) (-2297.452) (-2312.216) * (-2327.213) [-2294.620] (-2310.042) (-2306.060) -- 0:03:18
373500 -- (-2316.798) [-2306.524] (-2308.402) (-2319.784) * (-2323.681) (-2308.708) [-2306.228] (-2307.725) -- 0:03:19
374000 -- (-2299.945) [-2307.194] (-2306.136) (-2306.487) * (-2313.307) [-2307.124] (-2305.496) (-2304.443) -- 0:03:19
374500 -- [-2304.384] (-2308.552) (-2310.509) (-2318.060) * (-2316.118) [-2310.168] (-2319.272) (-2313.521) -- 0:03:18
375000 -- (-2315.159) [-2303.602] (-2320.084) (-2318.434) * (-2309.003) (-2302.899) (-2312.641) [-2308.203] -- 0:03:18
Average standard deviation of split frequencies: 0.009445
375500 -- [-2297.467] (-2312.084) (-2309.929) (-2321.035) * (-2319.947) [-2309.987] (-2314.187) (-2309.312) -- 0:03:17
376000 -- [-2301.280] (-2303.259) (-2312.126) (-2307.704) * (-2305.917) (-2316.743) [-2307.111] (-2315.539) -- 0:03:17
376500 -- (-2322.229) [-2302.322] (-2321.405) (-2302.257) * (-2320.326) (-2312.325) (-2305.177) [-2308.758] -- 0:03:17
377000 -- (-2304.165) (-2312.660) [-2306.486] (-2310.286) * [-2301.705] (-2314.325) (-2316.103) (-2318.501) -- 0:03:18
377500 -- (-2305.233) [-2305.948] (-2311.000) (-2301.028) * (-2314.558) (-2314.750) (-2310.071) [-2307.385] -- 0:03:17
378000 -- (-2307.451) (-2312.940) (-2310.178) [-2304.911] * (-2299.031) [-2317.324] (-2313.132) (-2322.050) -- 0:03:17
378500 -- [-2307.892] (-2312.747) (-2308.184) (-2307.210) * (-2304.044) (-2305.182) [-2311.291] (-2314.334) -- 0:03:17
379000 -- (-2308.884) (-2313.781) (-2316.448) [-2319.629] * (-2317.313) (-2309.750) (-2320.308) [-2316.362] -- 0:03:16
379500 -- (-2310.687) [-2302.661] (-2316.514) (-2314.889) * (-2312.260) (-2308.287) (-2307.966) [-2309.044] -- 0:03:16
380000 -- (-2307.756) [-2302.924] (-2320.862) (-2312.300) * (-2301.749) [-2312.834] (-2307.593) (-2310.013) -- 0:03:15
Average standard deviation of split frequencies: 0.008256
380500 -- [-2307.627] (-2302.422) (-2310.882) (-2317.525) * [-2298.364] (-2303.306) (-2303.653) (-2311.811) -- 0:03:17
381000 -- [-2313.035] (-2303.077) (-2301.405) (-2302.168) * [-2299.476] (-2307.209) (-2316.510) (-2305.387) -- 0:03:16
381500 -- (-2300.733) [-2299.734] (-2305.626) (-2315.113) * (-2314.409) [-2302.146] (-2302.915) (-2307.357) -- 0:03:16
382000 -- (-2301.515) (-2300.721) [-2297.885] (-2318.216) * (-2324.441) (-2299.245) (-2310.638) [-2307.918] -- 0:03:15
382500 -- (-2307.138) (-2302.159) [-2304.666] (-2310.226) * (-2312.292) [-2299.906] (-2310.976) (-2312.489) -- 0:03:15
383000 -- (-2318.823) (-2310.028) [-2301.704] (-2314.431) * (-2312.323) (-2304.139) [-2300.498] (-2316.370) -- 0:03:16
383500 -- (-2321.864) (-2313.098) [-2303.777] (-2298.285) * [-2297.326] (-2300.704) (-2303.772) (-2311.938) -- 0:03:16
384000 -- [-2313.391] (-2307.964) (-2309.777) (-2305.450) * (-2307.843) (-2300.042) [-2301.241] (-2308.395) -- 0:03:15
384500 -- [-2299.579] (-2307.936) (-2299.400) (-2308.767) * (-2317.297) [-2305.014] (-2303.006) (-2305.417) -- 0:03:15
385000 -- (-2300.269) (-2302.965) [-2302.737] (-2319.486) * (-2299.345) (-2310.881) [-2305.108] (-2302.352) -- 0:03:14
Average standard deviation of split frequencies: 0.007572
385500 -- (-2311.370) [-2306.852] (-2305.242) (-2319.707) * [-2303.662] (-2313.775) (-2315.441) (-2307.747) -- 0:03:16
386000 -- (-2301.349) (-2306.364) [-2306.320] (-2308.059) * (-2303.880) (-2308.088) (-2316.967) [-2308.710] -- 0:03:15
386500 -- (-2315.381) (-2301.536) [-2302.224] (-2308.831) * (-2302.280) (-2308.826) (-2301.608) [-2307.639] -- 0:03:15
387000 -- (-2312.668) (-2309.444) [-2300.750] (-2304.533) * (-2305.926) [-2311.563] (-2313.748) (-2322.196) -- 0:03:14
387500 -- (-2315.088) [-2297.640] (-2299.789) (-2309.034) * (-2305.263) [-2302.825] (-2308.206) (-2319.394) -- 0:03:14
388000 -- (-2317.265) [-2295.240] (-2302.273) (-2313.711) * (-2300.642) (-2306.206) (-2315.182) [-2312.969] -- 0:03:14
388500 -- (-2304.440) [-2302.167] (-2311.706) (-2303.573) * (-2302.746) [-2305.795] (-2308.286) (-2312.783) -- 0:03:13
389000 -- [-2300.854] (-2309.152) (-2300.929) (-2311.323) * (-2301.251) (-2300.957) (-2326.499) [-2308.049] -- 0:03:14
389500 -- (-2304.363) (-2313.115) [-2301.316] (-2306.768) * (-2308.258) (-2298.334) [-2306.649] (-2310.311) -- 0:03:14
390000 -- (-2311.186) (-2305.127) [-2299.078] (-2302.614) * (-2314.309) [-2300.360] (-2300.208) (-2308.350) -- 0:03:13
Average standard deviation of split frequencies: 0.007562
390500 -- (-2312.884) (-2314.186) (-2313.729) [-2310.225] * (-2304.800) (-2306.176) [-2299.079] (-2302.750) -- 0:03:13
391000 -- (-2313.592) [-2299.264] (-2313.289) (-2304.027) * [-2313.277] (-2313.929) (-2312.297) (-2305.652) -- 0:03:13
391500 -- (-2315.948) (-2304.368) [-2299.232] (-2312.594) * [-2304.268] (-2314.268) (-2315.092) (-2310.131) -- 0:03:12
392000 -- (-2311.459) (-2305.528) [-2295.313] (-2320.348) * (-2304.270) (-2311.939) (-2311.372) [-2300.732] -- 0:03:12
392500 -- (-2313.976) (-2303.487) (-2303.929) [-2309.338] * [-2307.640] (-2311.638) (-2313.237) (-2310.667) -- 0:03:13
393000 -- (-2316.358) (-2307.749) (-2298.393) [-2306.638] * (-2314.982) (-2305.835) [-2302.968] (-2310.453) -- 0:03:13
393500 -- (-2301.877) (-2302.293) (-2310.661) [-2304.903] * (-2309.868) (-2309.402) (-2307.109) [-2306.320] -- 0:03:12
394000 -- (-2304.409) (-2313.529) (-2307.926) [-2313.964] * (-2303.231) [-2302.230] (-2313.315) (-2312.862) -- 0:03:12
394500 -- (-2313.242) (-2320.957) (-2311.864) [-2302.944] * (-2312.016) [-2296.270] (-2309.763) (-2307.935) -- 0:03:11
395000 -- (-2306.003) [-2310.563] (-2302.238) (-2314.447) * (-2306.634) [-2307.364] (-2306.871) (-2302.201) -- 0:03:11
Average standard deviation of split frequencies: 0.008492
395500 -- (-2312.889) (-2303.720) [-2306.592] (-2316.669) * (-2304.770) (-2318.265) (-2312.607) [-2300.519] -- 0:03:11
396000 -- (-2310.528) [-2306.866] (-2300.807) (-2315.299) * (-2321.102) [-2300.854] (-2308.201) (-2301.441) -- 0:03:12
396500 -- (-2316.917) (-2310.207) [-2299.859] (-2301.423) * (-2309.185) (-2297.496) (-2320.868) [-2304.047] -- 0:03:11
397000 -- (-2311.717) [-2302.983] (-2308.482) (-2314.171) * [-2306.130] (-2307.725) (-2304.660) (-2314.052) -- 0:03:11
397500 -- (-2314.964) (-2308.252) [-2300.056] (-2315.992) * (-2316.955) [-2307.090] (-2310.166) (-2301.580) -- 0:03:10
398000 -- [-2309.913] (-2308.727) (-2304.413) (-2320.838) * (-2302.980) [-2301.969] (-2306.568) (-2303.484) -- 0:03:10
398500 -- (-2316.602) [-2303.401] (-2325.873) (-2306.946) * (-2304.415) [-2304.407] (-2311.891) (-2308.567) -- 0:03:10
399000 -- [-2309.775] (-2308.748) (-2313.547) (-2309.646) * [-2301.841] (-2311.828) (-2307.440) (-2310.050) -- 0:03:11
399500 -- [-2304.616] (-2316.790) (-2306.323) (-2314.887) * (-2302.845) (-2305.955) (-2307.076) [-2303.706] -- 0:03:10
400000 -- (-2313.505) (-2314.220) (-2298.449) [-2319.137] * (-2316.186) [-2304.086] (-2313.705) (-2297.172) -- 0:03:10
Average standard deviation of split frequencies: 0.007922
400500 -- (-2316.012) (-2311.372) (-2301.137) [-2310.134] * (-2308.049) (-2309.104) [-2301.151] (-2310.920) -- 0:03:10
401000 -- (-2310.075) (-2308.470) [-2299.828] (-2313.488) * (-2309.569) [-2300.998] (-2307.595) (-2307.048) -- 0:03:09
401500 -- (-2315.993) [-2308.291] (-2306.607) (-2310.613) * (-2306.352) (-2305.453) [-2302.536] (-2304.360) -- 0:03:09
402000 -- (-2317.278) [-2302.747] (-2299.627) (-2308.197) * (-2307.363) (-2306.955) (-2313.973) [-2319.417] -- 0:03:10
402500 -- (-2302.737) [-2307.179] (-2312.625) (-2307.569) * [-2307.036] (-2313.293) (-2321.230) (-2313.657) -- 0:03:10
403000 -- (-2312.481) (-2309.659) [-2317.161] (-2313.285) * (-2306.170) [-2299.029] (-2315.489) (-2324.552) -- 0:03:09
403500 -- (-2309.452) [-2304.328] (-2303.726) (-2322.241) * (-2310.673) [-2298.904] (-2312.792) (-2308.606) -- 0:03:09
404000 -- (-2317.403) (-2306.805) (-2313.022) [-2300.066] * [-2299.801] (-2307.211) (-2302.979) (-2317.739) -- 0:03:08
404500 -- (-2305.271) (-2294.448) (-2310.589) [-2305.428] * (-2308.350) (-2315.380) (-2314.036) [-2304.208] -- 0:03:08
405000 -- (-2306.300) (-2303.221) (-2309.605) [-2307.130] * (-2304.673) (-2302.914) (-2300.421) [-2305.277] -- 0:03:09
Average standard deviation of split frequencies: 0.007741
405500 -- (-2311.914) [-2305.930] (-2312.221) (-2301.513) * [-2301.084] (-2295.353) (-2310.157) (-2319.081) -- 0:03:09
406000 -- (-2307.320) (-2306.275) [-2304.561] (-2301.493) * [-2295.196] (-2306.455) (-2310.771) (-2306.430) -- 0:03:08
406500 -- (-2303.960) (-2322.407) [-2299.249] (-2311.165) * (-2300.017) (-2315.195) (-2314.491) [-2306.113] -- 0:03:08
407000 -- (-2315.276) [-2305.141] (-2301.855) (-2315.786) * (-2308.864) (-2305.467) (-2315.394) [-2311.497] -- 0:03:07
407500 -- (-2308.406) (-2313.837) (-2309.762) [-2311.178] * (-2299.358) (-2329.803) [-2297.235] (-2323.719) -- 0:03:07
408000 -- [-2302.831] (-2302.893) (-2308.231) (-2320.566) * (-2304.451) [-2298.527] (-2301.556) (-2315.774) -- 0:03:07
408500 -- (-2309.256) (-2299.019) [-2304.902] (-2322.287) * [-2297.382] (-2308.434) (-2300.663) (-2309.596) -- 0:03:08
409000 -- (-2311.353) (-2310.194) [-2301.555] (-2311.232) * [-2308.861] (-2307.354) (-2310.249) (-2308.647) -- 0:03:07
409500 -- (-2310.068) (-2300.125) [-2300.630] (-2306.689) * [-2305.042] (-2299.859) (-2307.998) (-2305.474) -- 0:03:07
410000 -- (-2299.919) (-2313.746) [-2307.756] (-2310.998) * (-2308.317) (-2296.381) [-2305.762] (-2317.675) -- 0:03:07
Average standard deviation of split frequencies: 0.007500
410500 -- (-2318.636) (-2311.782) (-2299.196) [-2299.120] * (-2305.529) (-2307.166) [-2304.692] (-2312.927) -- 0:03:06
411000 -- (-2313.953) (-2311.506) (-2307.942) [-2308.027] * (-2295.930) [-2302.802] (-2301.311) (-2318.646) -- 0:03:06
411500 -- [-2301.188] (-2315.555) (-2303.043) (-2316.913) * [-2294.731] (-2302.902) (-2305.538) (-2309.009) -- 0:03:05
412000 -- (-2312.677) (-2306.691) [-2299.081] (-2305.814) * (-2305.800) [-2297.213] (-2313.136) (-2317.769) -- 0:03:06
412500 -- (-2304.493) [-2302.247] (-2318.733) (-2306.289) * (-2309.951) (-2307.157) (-2308.926) [-2301.708] -- 0:03:06
413000 -- (-2298.727) (-2310.361) (-2307.799) [-2299.485] * [-2305.886] (-2316.913) (-2310.695) (-2314.793) -- 0:03:06
413500 -- [-2305.309] (-2315.193) (-2312.214) (-2309.289) * (-2313.659) (-2307.547) (-2313.424) [-2299.211] -- 0:03:05
414000 -- [-2302.574] (-2311.886) (-2315.875) (-2307.649) * [-2306.509] (-2308.262) (-2307.819) (-2323.888) -- 0:03:05
414500 -- [-2299.813] (-2309.449) (-2309.492) (-2318.604) * (-2319.055) (-2316.108) (-2318.422) [-2309.075] -- 0:03:05
415000 -- [-2305.948] (-2303.375) (-2308.516) (-2312.895) * [-2310.380] (-2314.642) (-2317.231) (-2302.632) -- 0:03:04
Average standard deviation of split frequencies: 0.006950
415500 -- (-2302.292) (-2307.564) (-2322.064) [-2314.653] * (-2302.409) (-2311.337) (-2314.515) [-2310.812] -- 0:03:05
416000 -- (-2304.394) [-2307.261] (-2310.032) (-2315.724) * (-2305.853) (-2309.049) (-2308.406) [-2304.313] -- 0:03:05
416500 -- (-2314.446) (-2305.519) [-2305.680] (-2317.544) * (-2304.186) (-2308.660) (-2318.162) [-2300.397] -- 0:03:04
417000 -- (-2312.858) (-2307.595) [-2301.482] (-2310.752) * (-2300.305) [-2301.841] (-2311.749) (-2306.939) -- 0:03:04
417500 -- (-2320.443) (-2301.100) [-2309.223] (-2313.758) * (-2303.400) (-2304.650) (-2308.190) [-2309.984] -- 0:03:04
418000 -- (-2323.470) [-2307.465] (-2303.247) (-2309.523) * (-2311.845) (-2318.303) [-2300.972] (-2312.402) -- 0:03:05
418500 -- (-2299.562) (-2308.403) (-2313.762) [-2306.379] * (-2300.876) [-2306.971] (-2308.797) (-2308.578) -- 0:03:04
419000 -- [-2305.807] (-2306.842) (-2308.353) (-2303.244) * (-2311.776) (-2321.627) (-2310.188) [-2303.360] -- 0:03:04
419500 -- (-2304.680) (-2303.542) [-2297.978] (-2307.413) * (-2310.871) (-2308.744) [-2308.116] (-2317.452) -- 0:03:04
420000 -- (-2313.249) (-2308.577) (-2298.221) [-2315.313] * (-2315.232) (-2306.087) [-2304.319] (-2306.327) -- 0:03:03
Average standard deviation of split frequencies: 0.006425
420500 -- (-2304.657) (-2306.396) (-2310.065) [-2302.672] * (-2320.847) [-2304.053] (-2297.772) (-2302.883) -- 0:03:03
421000 -- (-2301.954) (-2308.554) [-2312.817] (-2313.235) * [-2302.012] (-2308.634) (-2306.778) (-2309.071) -- 0:03:04
421500 -- (-2299.108) [-2301.619] (-2305.821) (-2301.467) * (-2304.906) [-2301.304] (-2308.055) (-2301.762) -- 0:03:03
422000 -- (-2319.613) (-2319.300) (-2313.549) [-2305.760] * (-2308.631) (-2309.360) (-2313.340) [-2305.364] -- 0:03:03
422500 -- (-2308.177) [-2300.868] (-2300.127) (-2320.841) * (-2304.470) (-2309.324) (-2307.240) [-2297.162] -- 0:03:03
423000 -- (-2306.344) [-2301.682] (-2320.189) (-2306.836) * [-2301.998] (-2311.054) (-2314.579) (-2321.766) -- 0:03:02
423500 -- (-2308.340) (-2314.655) (-2299.792) [-2305.369] * (-2319.363) (-2307.521) [-2309.745] (-2299.322) -- 0:03:02
424000 -- (-2308.881) (-2304.269) [-2297.354] (-2308.447) * (-2309.476) [-2307.860] (-2305.995) (-2303.299) -- 0:03:03
424500 -- (-2303.819) [-2309.243] (-2308.837) (-2311.479) * (-2312.298) (-2308.459) (-2300.568) [-2300.256] -- 0:03:03
425000 -- (-2308.631) (-2311.426) [-2302.922] (-2314.763) * [-2300.182] (-2314.418) (-2308.657) (-2311.867) -- 0:03:02
Average standard deviation of split frequencies: 0.006344
425500 -- (-2318.463) (-2326.289) (-2305.899) [-2305.388] * (-2313.791) (-2309.555) (-2299.174) [-2308.706] -- 0:03:02
426000 -- (-2312.208) (-2314.941) (-2307.635) [-2304.359] * (-2307.450) (-2306.257) (-2302.866) [-2308.378] -- 0:03:01
426500 -- (-2307.242) (-2312.137) [-2302.350] (-2311.791) * [-2308.833] (-2320.050) (-2316.968) (-2316.347) -- 0:03:01
427000 -- [-2304.126] (-2315.191) (-2313.882) (-2299.349) * (-2308.021) (-2317.567) [-2298.202] (-2307.427) -- 0:03:02
427500 -- [-2314.445] (-2318.242) (-2310.589) (-2300.517) * [-2301.851] (-2310.811) (-2319.167) (-2303.663) -- 0:03:02
428000 -- [-2301.194] (-2316.091) (-2314.404) (-2310.250) * (-2309.837) [-2306.614] (-2309.608) (-2327.337) -- 0:03:01
428500 -- [-2311.621] (-2306.947) (-2307.058) (-2308.312) * (-2312.963) (-2299.405) [-2304.037] (-2305.897) -- 0:03:01
429000 -- [-2302.368] (-2319.361) (-2305.566) (-2299.380) * (-2316.113) (-2302.742) [-2304.887] (-2321.301) -- 0:03:02
429500 -- [-2310.656] (-2314.918) (-2306.224) (-2308.452) * (-2316.524) (-2308.696) (-2324.053) [-2311.220] -- 0:03:01
430000 -- (-2303.673) [-2309.747] (-2304.821) (-2300.172) * (-2321.239) [-2305.990] (-2317.217) (-2308.409) -- 0:03:01
Average standard deviation of split frequencies: 0.007005
430500 -- [-2297.950] (-2297.766) (-2319.429) (-2314.153) * (-2302.416) (-2306.008) (-2316.501) [-2309.375] -- 0:03:01
431000 -- (-2306.998) (-2308.204) (-2308.022) [-2306.352] * [-2311.729] (-2306.527) (-2311.515) (-2306.953) -- 0:03:00
431500 -- (-2299.732) [-2304.239] (-2307.130) (-2322.213) * (-2303.494) (-2319.628) (-2318.543) [-2306.922] -- 0:03:00
432000 -- (-2302.933) (-2303.539) [-2309.621] (-2312.684) * [-2297.136] (-2315.863) (-2311.089) (-2302.084) -- 0:03:00
432500 -- [-2306.923] (-2323.457) (-2296.498) (-2309.683) * [-2303.366] (-2298.308) (-2316.259) (-2309.694) -- 0:03:01
433000 -- (-2301.750) (-2331.722) [-2294.467] (-2306.293) * (-2303.280) (-2307.004) [-2310.011] (-2314.615) -- 0:03:00
433500 -- (-2301.256) (-2307.646) [-2308.475] (-2321.600) * (-2299.014) (-2325.458) [-2315.841] (-2307.257) -- 0:03:00
434000 -- [-2296.971] (-2306.928) (-2308.807) (-2313.437) * (-2310.713) (-2300.396) (-2314.612) [-2298.755] -- 0:02:59
434500 -- (-2308.608) [-2302.233] (-2314.712) (-2300.487) * (-2313.149) [-2302.603] (-2320.740) (-2319.260) -- 0:02:59
435000 -- (-2314.823) (-2304.988) [-2309.931] (-2303.580) * (-2302.266) (-2310.932) [-2306.450] (-2310.366) -- 0:02:59
Average standard deviation of split frequencies: 0.006992
435500 -- (-2325.495) (-2308.782) (-2305.542) [-2307.439] * [-2304.445] (-2309.505) (-2316.750) (-2304.956) -- 0:02:58
436000 -- (-2313.833) (-2321.306) [-2297.234] (-2300.857) * [-2307.325] (-2312.767) (-2312.822) (-2305.417) -- 0:02:59
436500 -- (-2300.155) (-2300.265) (-2308.698) [-2307.681] * [-2302.785] (-2305.582) (-2319.869) (-2316.249) -- 0:02:59
437000 -- (-2307.489) (-2313.957) (-2303.359) [-2300.553] * [-2299.213] (-2303.241) (-2313.158) (-2312.533) -- 0:02:59
437500 -- (-2305.061) (-2303.393) (-2324.917) [-2302.844] * [-2309.524] (-2306.725) (-2315.160) (-2309.356) -- 0:02:58
438000 -- (-2305.564) (-2312.457) (-2313.893) [-2298.528] * (-2301.895) (-2308.814) (-2314.327) [-2304.385] -- 0:02:58
438500 -- [-2310.279] (-2307.095) (-2301.228) (-2308.487) * (-2311.391) [-2308.348] (-2304.261) (-2310.005) -- 0:02:57
439000 -- (-2316.268) (-2301.058) [-2301.511] (-2301.572) * (-2296.260) (-2311.598) [-2298.807] (-2303.883) -- 0:02:57
439500 -- (-2301.894) (-2310.931) (-2319.398) [-2301.269] * [-2302.749] (-2320.707) (-2306.457) (-2322.785) -- 0:02:58
440000 -- [-2307.529] (-2310.714) (-2307.031) (-2302.250) * (-2306.383) (-2309.082) [-2297.766] (-2309.184) -- 0:02:58
Average standard deviation of split frequencies: 0.007417
440500 -- [-2304.099] (-2308.491) (-2306.220) (-2315.229) * (-2300.550) (-2304.866) (-2308.086) [-2314.628] -- 0:02:57
441000 -- [-2301.668] (-2311.429) (-2325.291) (-2305.644) * (-2304.678) (-2307.684) [-2300.549] (-2322.940) -- 0:02:57
441500 -- (-2318.508) (-2314.487) (-2304.090) [-2307.079] * (-2305.935) (-2306.548) [-2306.937] (-2323.409) -- 0:02:57
442000 -- (-2314.564) (-2303.199) (-2305.708) [-2306.590] * (-2309.747) (-2312.660) [-2302.935] (-2318.456) -- 0:02:56
442500 -- (-2318.778) (-2312.969) (-2316.093) [-2299.348] * (-2316.746) (-2303.348) [-2299.739] (-2320.547) -- 0:02:56
443000 -- [-2305.302] (-2310.426) (-2301.769) (-2306.788) * [-2301.963] (-2316.290) (-2314.828) (-2301.459) -- 0:02:57
443500 -- (-2297.793) [-2301.334] (-2305.535) (-2306.899) * (-2303.255) (-2317.752) (-2299.793) [-2298.230] -- 0:02:56
444000 -- (-2311.351) [-2307.769] (-2319.850) (-2310.151) * (-2312.249) (-2318.009) (-2315.586) [-2301.770] -- 0:02:56
444500 -- (-2310.009) (-2312.325) (-2313.154) [-2310.338] * (-2303.163) [-2306.042] (-2313.770) (-2314.349) -- 0:02:56
445000 -- (-2319.552) [-2309.714] (-2301.914) (-2315.444) * (-2305.293) (-2310.915) (-2307.165) [-2307.436] -- 0:02:55
Average standard deviation of split frequencies: 0.008174
445500 -- (-2323.118) [-2306.962] (-2313.202) (-2310.361) * (-2320.693) (-2306.314) (-2301.941) [-2306.498] -- 0:02:55
446000 -- (-2306.905) (-2308.003) (-2301.286) [-2305.787] * (-2303.803) [-2300.252] (-2301.747) (-2314.436) -- 0:02:56
446500 -- (-2310.408) (-2306.770) (-2311.390) [-2310.676] * (-2304.806) [-2295.720] (-2311.629) (-2304.538) -- 0:02:56
447000 -- [-2312.258] (-2309.460) (-2312.044) (-2306.634) * (-2309.994) (-2305.726) [-2308.193] (-2299.355) -- 0:02:55
447500 -- (-2312.818) (-2311.341) [-2304.748] (-2315.027) * (-2301.673) (-2299.770) (-2307.272) [-2310.707] -- 0:02:55
448000 -- [-2298.948] (-2324.858) (-2299.503) (-2306.193) * (-2324.209) (-2305.854) (-2302.093) [-2303.507] -- 0:02:54
448500 -- (-2307.526) (-2320.004) [-2299.452] (-2313.908) * [-2304.153] (-2314.633) (-2300.506) (-2305.132) -- 0:02:54
449000 -- (-2302.763) (-2301.002) [-2308.181] (-2322.155) * (-2306.297) (-2306.271) (-2311.004) [-2309.799] -- 0:02:54
449500 -- (-2302.862) [-2300.842] (-2304.756) (-2307.647) * (-2301.324) (-2310.260) [-2302.968] (-2322.558) -- 0:02:55
450000 -- (-2302.020) [-2303.665] (-2301.999) (-2307.900) * [-2303.034] (-2305.201) (-2301.428) (-2311.574) -- 0:02:54
Average standard deviation of split frequencies: 0.008717
450500 -- (-2311.805) (-2307.826) [-2300.557] (-2311.304) * (-2304.133) [-2307.616] (-2305.086) (-2315.481) -- 0:02:54
451000 -- (-2322.214) (-2309.929) (-2298.510) [-2305.840] * [-2298.760] (-2312.666) (-2304.823) (-2321.694) -- 0:02:54
451500 -- (-2311.362) (-2312.057) (-2308.631) [-2304.609] * (-2309.061) (-2319.044) [-2302.536] (-2306.705) -- 0:02:53
452000 -- (-2304.070) [-2306.179] (-2309.865) (-2312.428) * [-2295.255] (-2303.388) (-2304.327) (-2318.117) -- 0:02:53
452500 -- [-2309.874] (-2311.084) (-2300.651) (-2314.793) * (-2314.984) [-2308.678] (-2304.762) (-2311.920) -- 0:02:54
453000 -- (-2311.911) [-2309.355] (-2313.884) (-2308.145) * (-2300.750) (-2303.772) [-2298.085] (-2312.450) -- 0:02:53
453500 -- (-2316.146) (-2308.789) [-2307.056] (-2315.637) * [-2298.224] (-2305.445) (-2312.204) (-2325.818) -- 0:02:53
454000 -- (-2312.899) (-2303.913) [-2301.452] (-2306.533) * [-2299.987] (-2300.089) (-2313.819) (-2314.193) -- 0:02:53
454500 -- [-2298.935] (-2309.872) (-2331.015) (-2308.395) * (-2301.572) (-2312.623) (-2317.993) [-2306.850] -- 0:02:52
455000 -- (-2311.409) (-2310.234) [-2302.923] (-2318.403) * (-2309.265) (-2304.440) (-2307.464) [-2309.375] -- 0:02:52
Average standard deviation of split frequencies: 0.008959
455500 -- (-2311.247) [-2305.508] (-2317.595) (-2314.281) * [-2304.493] (-2299.495) (-2317.959) (-2303.712) -- 0:02:52
456000 -- (-2312.782) [-2298.536] (-2312.601) (-2314.132) * (-2302.958) (-2309.078) (-2310.319) [-2304.568] -- 0:02:52
456500 -- (-2313.930) (-2314.179) (-2309.400) [-2299.834] * (-2300.443) [-2299.833] (-2298.896) (-2309.481) -- 0:02:52
457000 -- (-2304.252) (-2310.828) (-2309.623) [-2299.871] * (-2302.274) [-2298.941] (-2308.072) (-2318.064) -- 0:02:52
457500 -- (-2310.252) [-2303.401] (-2310.087) (-2309.730) * [-2309.601] (-2301.923) (-2308.741) (-2314.491) -- 0:02:51
458000 -- (-2303.858) (-2302.945) (-2305.998) [-2307.625] * (-2305.697) [-2306.650] (-2303.890) (-2307.339) -- 0:02:51
458500 -- (-2310.166) [-2308.435] (-2310.062) (-2304.898) * (-2307.358) [-2301.152] (-2312.561) (-2304.500) -- 0:02:51
459000 -- (-2307.664) [-2303.347] (-2301.862) (-2316.240) * [-2300.260] (-2303.760) (-2317.633) (-2314.625) -- 0:02:50
459500 -- (-2303.984) (-2313.400) [-2303.496] (-2312.267) * (-2300.136) (-2310.292) (-2309.029) [-2303.900] -- 0:02:51
460000 -- (-2307.327) [-2307.920] (-2318.526) (-2306.842) * (-2310.055) [-2307.362] (-2325.526) (-2303.846) -- 0:02:51
Average standard deviation of split frequencies: 0.009824
460500 -- (-2306.900) (-2320.246) [-2305.815] (-2302.229) * (-2302.141) (-2306.929) [-2308.517] (-2327.571) -- 0:02:51
461000 -- (-2316.766) (-2319.130) [-2309.305] (-2311.698) * (-2308.305) (-2310.254) [-2309.036] (-2315.142) -- 0:02:50
461500 -- (-2310.351) (-2317.718) (-2312.711) [-2299.396] * (-2320.012) (-2299.010) [-2310.873] (-2310.676) -- 0:02:50
462000 -- (-2313.223) (-2323.382) (-2300.119) [-2302.732] * (-2302.836) (-2306.475) (-2301.572) [-2306.685] -- 0:02:51
462500 -- [-2307.685] (-2301.790) (-2322.580) (-2302.880) * [-2295.686] (-2310.886) (-2311.089) (-2302.090) -- 0:02:50
463000 -- (-2317.493) (-2308.968) [-2304.030] (-2304.909) * (-2313.836) (-2314.718) (-2314.504) [-2305.756] -- 0:02:50
463500 -- (-2302.538) (-2304.609) [-2299.919] (-2302.586) * (-2304.927) (-2303.210) (-2307.415) [-2302.175] -- 0:02:50
464000 -- [-2308.462] (-2310.130) (-2311.463) (-2312.401) * (-2313.756) (-2311.156) (-2312.606) [-2307.163] -- 0:02:49
464500 -- (-2306.499) [-2300.033] (-2305.249) (-2309.393) * (-2307.803) (-2304.551) [-2296.758] (-2300.165) -- 0:02:49
465000 -- (-2322.687) [-2299.973] (-2320.318) (-2302.287) * (-2304.059) (-2307.547) [-2314.762] (-2312.145) -- 0:02:49
Average standard deviation of split frequencies: 0.009374
465500 -- (-2320.476) (-2317.153) (-2312.509) [-2309.515] * [-2302.503] (-2331.603) (-2325.757) (-2301.229) -- 0:02:49
466000 -- (-2321.372) (-2304.156) [-2301.051] (-2303.609) * [-2310.546] (-2318.390) (-2327.061) (-2310.777) -- 0:02:49
466500 -- (-2308.135) [-2303.410] (-2310.880) (-2309.816) * (-2311.060) [-2315.175] (-2312.220) (-2303.388) -- 0:02:49
467000 -- [-2306.651] (-2305.925) (-2305.858) (-2315.580) * [-2302.311] (-2322.144) (-2320.214) (-2307.937) -- 0:02:48
467500 -- (-2312.367) (-2306.873) [-2304.540] (-2297.769) * (-2305.921) [-2309.407] (-2319.186) (-2306.087) -- 0:02:48
468000 -- (-2306.851) (-2308.201) (-2305.171) [-2296.543] * (-2308.340) (-2313.584) [-2307.818] (-2312.770) -- 0:02:48
468500 -- (-2300.327) (-2318.370) (-2307.934) [-2306.470] * (-2304.704) (-2302.502) [-2297.824] (-2309.823) -- 0:02:47
469000 -- (-2301.467) (-2318.819) [-2301.088] (-2303.088) * (-2309.045) [-2306.043] (-2305.852) (-2311.033) -- 0:02:48
469500 -- (-2313.988) (-2305.185) (-2311.854) [-2299.096] * (-2295.684) (-2303.833) [-2308.702] (-2313.219) -- 0:02:48
470000 -- (-2317.456) (-2310.860) (-2303.562) [-2297.773] * (-2303.564) (-2307.757) (-2311.694) [-2313.608] -- 0:02:48
Average standard deviation of split frequencies: 0.008947
470500 -- (-2304.891) (-2316.952) [-2303.984] (-2302.962) * (-2318.174) [-2298.159] (-2311.486) (-2315.990) -- 0:02:47
471000 -- (-2309.128) (-2308.905) [-2317.657] (-2302.512) * (-2300.197) [-2306.838] (-2307.378) (-2308.741) -- 0:02:47
471500 -- [-2311.197] (-2304.855) (-2316.589) (-2314.399) * [-2304.783] (-2303.749) (-2310.385) (-2310.900) -- 0:02:47
472000 -- (-2311.145) (-2329.017) (-2326.372) [-2306.084] * (-2305.163) (-2300.963) [-2298.095] (-2304.042) -- 0:02:46
472500 -- (-2308.799) (-2311.016) (-2317.659) [-2307.318] * (-2303.539) (-2321.296) [-2304.143] (-2325.874) -- 0:02:47
473000 -- (-2311.362) [-2305.381] (-2308.145) (-2308.335) * (-2306.429) (-2323.421) [-2305.943] (-2312.285) -- 0:02:47
473500 -- (-2314.819) (-2307.117) (-2315.673) [-2308.073] * (-2306.204) [-2304.667] (-2304.620) (-2307.399) -- 0:02:46
474000 -- (-2303.865) [-2304.845] (-2313.491) (-2300.675) * (-2304.651) (-2315.175) [-2307.356] (-2302.406) -- 0:02:46
474500 -- (-2310.759) [-2309.484] (-2320.092) (-2302.277) * (-2305.155) [-2298.491] (-2314.165) (-2301.990) -- 0:02:46
475000 -- (-2312.865) [-2310.354] (-2320.181) (-2302.203) * (-2310.037) [-2300.054] (-2300.149) (-2305.029) -- 0:02:45
Average standard deviation of split frequencies: 0.008979
475500 -- [-2307.789] (-2308.551) (-2304.951) (-2306.204) * (-2305.926) (-2308.697) (-2316.613) [-2307.760] -- 0:02:45
476000 -- (-2306.506) (-2314.995) (-2309.494) [-2301.651] * [-2300.918] (-2306.936) (-2304.627) (-2313.153) -- 0:02:46
476500 -- (-2299.431) (-2310.126) [-2300.431] (-2303.453) * (-2312.716) [-2300.746] (-2308.897) (-2314.135) -- 0:02:45
477000 -- (-2300.845) (-2309.647) (-2309.545) [-2302.536] * (-2310.417) (-2309.403) [-2304.499] (-2314.770) -- 0:02:45
477500 -- (-2303.169) [-2312.115] (-2296.487) (-2303.166) * [-2304.890] (-2299.423) (-2319.919) (-2312.741) -- 0:02:45
478000 -- (-2315.050) (-2332.660) (-2303.381) [-2307.229] * (-2310.752) (-2308.860) (-2319.343) [-2301.036] -- 0:02:44
478500 -- (-2303.059) (-2305.456) [-2304.949] (-2311.641) * (-2311.543) (-2304.930) (-2315.319) [-2301.729] -- 0:02:44
479000 -- (-2315.665) (-2303.048) (-2304.296) [-2307.275] * [-2302.745] (-2305.912) (-2321.618) (-2297.191) -- 0:02:44
479500 -- (-2315.030) (-2326.977) [-2305.185] (-2316.190) * (-2308.578) (-2312.297) (-2319.983) [-2297.648] -- 0:02:44
480000 -- (-2309.532) (-2306.846) [-2305.926] (-2303.072) * (-2304.592) (-2307.446) (-2304.682) [-2301.532] -- 0:02:44
Average standard deviation of split frequencies: 0.009088
480500 -- [-2306.518] (-2296.917) (-2306.278) (-2300.707) * (-2305.465) [-2299.829] (-2318.109) (-2306.568) -- 0:02:44
481000 -- [-2304.346] (-2304.354) (-2297.101) (-2320.180) * (-2311.407) [-2319.743] (-2317.080) (-2307.599) -- 0:02:44
481500 -- (-2305.494) (-2310.060) [-2302.917] (-2317.661) * (-2308.125) (-2314.400) (-2306.098) [-2300.045] -- 0:02:43
482000 -- (-2317.172) [-2324.529] (-2298.943) (-2304.387) * (-2314.048) (-2310.168) [-2307.869] (-2311.022) -- 0:02:43
482500 -- (-2308.293) (-2315.891) (-2325.243) [-2310.894] * [-2303.548] (-2305.771) (-2310.047) (-2309.562) -- 0:02:43
483000 -- [-2302.007] (-2306.701) (-2305.240) (-2302.061) * (-2309.463) [-2303.042] (-2306.481) (-2311.662) -- 0:02:43
483500 -- (-2313.774) [-2301.879] (-2310.053) (-2305.440) * (-2311.287) [-2294.188] (-2314.929) (-2304.361) -- 0:02:43
484000 -- (-2309.379) [-2301.230] (-2302.742) (-2302.236) * (-2306.427) [-2300.099] (-2315.337) (-2306.736) -- 0:02:43
484500 -- (-2325.437) [-2314.086] (-2298.186) (-2304.246) * [-2296.930] (-2305.018) (-2328.894) (-2306.602) -- 0:02:42
485000 -- [-2307.241] (-2312.703) (-2305.955) (-2302.820) * (-2314.808) (-2301.446) [-2311.181] (-2300.362) -- 0:02:42
Average standard deviation of split frequencies: 0.008988
485500 -- (-2307.943) (-2310.919) (-2307.352) [-2301.524] * [-2317.900] (-2303.236) (-2314.490) (-2302.687) -- 0:02:42
486000 -- (-2302.690) (-2306.210) (-2304.751) [-2296.824] * (-2309.148) (-2304.589) [-2304.421] (-2309.368) -- 0:02:41
486500 -- (-2305.326) (-2312.271) (-2304.134) [-2302.280] * [-2300.245] (-2314.574) (-2304.950) (-2313.903) -- 0:02:42
487000 -- (-2303.562) (-2314.915) [-2308.361] (-2324.817) * (-2307.962) (-2312.904) [-2309.843] (-2300.922) -- 0:02:42
487500 -- (-2306.789) [-2302.507] (-2305.301) (-2312.535) * (-2320.539) (-2315.285) (-2322.709) [-2300.162] -- 0:02:41
488000 -- (-2304.453) (-2316.880) (-2310.127) [-2304.679] * (-2304.745) [-2301.508] (-2320.145) (-2309.320) -- 0:02:41
488500 -- (-2310.532) (-2307.469) [-2310.372] (-2312.022) * (-2308.634) (-2306.352) [-2298.086] (-2298.776) -- 0:02:42
489000 -- (-2302.407) [-2295.570] (-2318.891) (-2310.334) * [-2299.192] (-2305.265) (-2309.491) (-2302.869) -- 0:02:41
489500 -- [-2299.842] (-2319.195) (-2331.648) (-2312.660) * (-2310.780) (-2314.151) (-2306.064) [-2303.892] -- 0:02:41
490000 -- [-2304.834] (-2323.187) (-2317.090) (-2305.993) * (-2311.819) (-2306.400) [-2304.800] (-2294.916) -- 0:02:41
Average standard deviation of split frequencies: 0.008455
490500 -- (-2309.212) (-2317.593) [-2306.189] (-2300.396) * [-2312.977] (-2313.449) (-2301.448) (-2314.687) -- 0:02:41
491000 -- (-2307.403) (-2301.687) [-2306.432] (-2314.976) * (-2309.512) (-2307.796) (-2300.618) [-2303.116] -- 0:02:41
491500 -- [-2301.387] (-2309.792) (-2322.901) (-2312.154) * (-2302.670) (-2312.787) (-2304.293) [-2297.484] -- 0:02:41
492000 -- (-2301.070) [-2307.423] (-2310.942) (-2310.283) * (-2298.638) (-2302.821) [-2309.011] (-2326.565) -- 0:02:41
492500 -- [-2302.552] (-2312.360) (-2309.494) (-2310.335) * (-2311.495) [-2298.061] (-2310.730) (-2313.039) -- 0:02:40
493000 -- (-2313.914) [-2299.314] (-2304.785) (-2305.325) * (-2311.638) (-2307.685) (-2310.963) [-2304.104] -- 0:02:40
493500 -- (-2313.549) (-2304.167) (-2317.447) [-2306.582] * (-2316.344) (-2301.542) [-2308.211] (-2321.950) -- 0:02:40
494000 -- (-2318.734) [-2311.626] (-2315.685) (-2320.652) * (-2307.249) [-2313.090] (-2320.660) (-2310.285) -- 0:02:39
494500 -- (-2314.504) [-2302.198] (-2308.711) (-2319.805) * (-2309.941) (-2313.517) [-2305.292] (-2307.579) -- 0:02:40
495000 -- (-2317.201) (-2318.821) (-2312.671) [-2307.017] * (-2305.323) (-2303.118) (-2306.333) [-2304.609] -- 0:02:40
Average standard deviation of split frequencies: 0.008047
495500 -- [-2297.281] (-2313.000) (-2303.856) (-2314.062) * (-2310.621) [-2303.888] (-2304.241) (-2318.930) -- 0:02:39
496000 -- [-2313.127] (-2302.799) (-2304.543) (-2308.124) * (-2316.155) [-2304.994] (-2306.698) (-2307.529) -- 0:02:39
496500 -- (-2308.274) [-2310.171] (-2298.225) (-2308.959) * [-2314.404] (-2316.268) (-2307.283) (-2310.550) -- 0:02:39
497000 -- (-2316.478) (-2309.031) (-2310.413) [-2304.479] * (-2306.169) (-2308.955) [-2300.447] (-2302.271) -- 0:02:38
497500 -- (-2302.495) (-2306.901) [-2303.060] (-2309.026) * (-2300.883) (-2319.133) [-2306.696] (-2310.332) -- 0:02:38
498000 -- (-2312.446) [-2307.665] (-2300.008) (-2323.051) * [-2314.101] (-2303.636) (-2304.330) (-2312.341) -- 0:02:39
498500 -- (-2312.179) [-2303.447] (-2303.636) (-2310.226) * (-2313.058) [-2305.002] (-2300.703) (-2323.696) -- 0:02:38
499000 -- [-2307.380] (-2309.301) (-2315.093) (-2309.242) * (-2300.705) (-2310.764) [-2303.462] (-2301.691) -- 0:02:38
499500 -- (-2314.343) (-2302.747) [-2306.137] (-2317.762) * [-2308.324] (-2314.406) (-2313.409) (-2317.554) -- 0:02:38
500000 -- (-2318.699) [-2310.451] (-2304.455) (-2310.993) * (-2310.877) [-2311.057] (-2312.485) (-2306.065) -- 0:02:38
Average standard deviation of split frequencies: 0.008662
500500 -- (-2310.290) (-2323.253) (-2311.945) [-2315.655] * (-2310.806) (-2317.906) [-2305.997] (-2295.291) -- 0:02:37
501000 -- (-2302.723) (-2317.030) (-2308.875) [-2308.111] * [-2305.025] (-2313.321) (-2312.642) (-2307.156) -- 0:02:38
501500 -- (-2318.755) (-2304.585) (-2304.597) [-2309.047] * (-2328.328) (-2321.202) [-2304.523] (-2298.591) -- 0:02:38
502000 -- (-2307.328) (-2307.271) (-2319.781) [-2303.096] * [-2307.587] (-2303.268) (-2309.387) (-2301.536) -- 0:02:37
502500 -- [-2307.365] (-2326.568) (-2309.400) (-2303.136) * [-2301.499] (-2312.932) (-2310.317) (-2305.465) -- 0:02:37
503000 -- (-2316.061) (-2324.577) (-2310.060) [-2313.660] * (-2302.951) [-2307.621] (-2311.042) (-2316.463) -- 0:02:37
503500 -- (-2311.986) (-2307.398) (-2317.586) [-2306.721] * [-2312.441] (-2311.735) (-2319.272) (-2302.606) -- 0:02:36
504000 -- (-2306.157) (-2317.399) [-2296.630] (-2307.768) * (-2307.378) [-2301.590] (-2312.294) (-2308.299) -- 0:02:36
504500 -- [-2305.987] (-2315.583) (-2309.796) (-2308.558) * (-2301.475) [-2298.635] (-2301.368) (-2308.560) -- 0:02:37
505000 -- (-2313.505) (-2301.725) [-2311.752] (-2314.640) * [-2307.831] (-2305.139) (-2304.909) (-2315.470) -- 0:02:36
Average standard deviation of split frequencies: 0.008198
505500 -- [-2302.889] (-2304.393) (-2313.695) (-2314.618) * (-2308.881) (-2309.574) [-2308.548] (-2300.681) -- 0:02:36
506000 -- (-2306.479) [-2295.675] (-2316.910) (-2307.666) * [-2309.170] (-2311.937) (-2305.645) (-2301.829) -- 0:02:36
506500 -- (-2308.961) (-2315.348) (-2313.364) [-2304.743] * (-2311.999) [-2295.616] (-2307.862) (-2312.569) -- 0:02:35
507000 -- (-2309.120) (-2307.213) [-2312.327] (-2309.234) * (-2303.620) [-2305.694] (-2308.935) (-2313.984) -- 0:02:35
507500 -- (-2307.715) [-2302.559] (-2313.529) (-2306.205) * [-2310.072] (-2317.456) (-2303.469) (-2311.909) -- 0:02:35
508000 -- (-2316.072) (-2309.442) [-2301.888] (-2302.701) * (-2313.567) [-2303.306] (-2303.568) (-2301.901) -- 0:02:35
508500 -- (-2323.912) (-2308.478) (-2301.650) [-2303.928] * (-2299.851) [-2306.115] (-2309.233) (-2305.361) -- 0:02:35
509000 -- (-2310.152) [-2311.604] (-2313.971) (-2301.277) * (-2300.714) [-2298.465] (-2309.825) (-2306.692) -- 0:02:35
509500 -- (-2310.293) (-2306.938) [-2305.397] (-2305.891) * (-2304.854) [-2302.541] (-2314.777) (-2300.431) -- 0:02:34
510000 -- [-2300.325] (-2320.571) (-2307.260) (-2312.302) * (-2300.883) (-2320.368) [-2307.785] (-2303.616) -- 0:02:34
Average standard deviation of split frequencies: 0.008554
510500 -- (-2300.871) (-2302.949) [-2308.241] (-2305.006) * (-2304.838) (-2313.663) [-2301.986] (-2310.961) -- 0:02:35
511000 -- (-2320.709) [-2307.018] (-2308.295) (-2299.254) * (-2309.058) (-2303.544) (-2310.734) [-2307.048] -- 0:02:35
511500 -- (-2312.364) (-2313.342) [-2298.281] (-2306.631) * [-2307.525] (-2303.263) (-2310.060) (-2311.333) -- 0:02:34
512000 -- [-2299.670] (-2307.670) (-2312.586) (-2309.241) * [-2303.050] (-2321.844) (-2316.403) (-2305.152) -- 0:02:34
512500 -- (-2300.661) (-2299.665) (-2311.891) [-2297.931] * (-2309.613) [-2307.265] (-2319.826) (-2313.702) -- 0:02:34
513000 -- [-2301.376] (-2305.945) (-2308.330) (-2313.589) * (-2301.183) (-2306.742) [-2306.080] (-2311.120) -- 0:02:33
513500 -- [-2309.484] (-2324.248) (-2317.352) (-2310.372) * [-2305.729] (-2307.295) (-2305.409) (-2315.011) -- 0:02:34
514000 -- (-2305.755) [-2303.054] (-2309.330) (-2311.051) * (-2305.878) [-2297.483] (-2319.879) (-2310.630) -- 0:02:34
514500 -- (-2305.574) (-2305.131) [-2299.827] (-2304.752) * (-2307.899) [-2299.316] (-2311.307) (-2314.505) -- 0:02:33
515000 -- [-2308.598] (-2311.812) (-2314.835) (-2302.186) * (-2311.398) (-2307.074) (-2305.318) [-2299.182] -- 0:02:33
Average standard deviation of split frequencies: 0.008709
515500 -- (-2314.968) (-2312.402) (-2305.755) [-2302.093] * (-2322.729) [-2299.800] (-2305.609) (-2309.642) -- 0:02:33
516000 -- [-2309.583] (-2310.378) (-2308.043) (-2313.231) * (-2320.545) (-2295.175) [-2308.626] (-2313.997) -- 0:02:32
516500 -- (-2313.763) (-2316.880) [-2306.122] (-2324.230) * [-2310.506] (-2301.006) (-2306.711) (-2312.618) -- 0:02:32
517000 -- (-2305.244) [-2307.170] (-2318.293) (-2310.354) * (-2313.454) (-2317.347) (-2319.395) [-2301.841] -- 0:02:33
517500 -- (-2316.688) (-2304.109) [-2308.550] (-2316.551) * (-2310.387) (-2312.186) (-2302.276) [-2309.506] -- 0:02:32
518000 -- (-2306.562) [-2322.530] (-2306.767) (-2313.869) * (-2314.996) (-2307.489) [-2305.084] (-2308.715) -- 0:02:32
518500 -- (-2318.911) (-2305.756) (-2313.914) [-2308.057] * [-2308.487] (-2311.268) (-2305.133) (-2312.541) -- 0:02:32
519000 -- (-2314.483) [-2307.990] (-2312.890) (-2308.650) * [-2301.978] (-2327.710) (-2304.351) (-2306.558) -- 0:02:31
519500 -- (-2312.378) [-2307.294] (-2306.546) (-2308.055) * [-2300.247] (-2318.869) (-2304.918) (-2302.991) -- 0:02:31
520000 -- (-2313.492) (-2316.282) (-2328.936) [-2307.769] * (-2302.430) (-2315.247) [-2305.239] (-2310.905) -- 0:02:32
Average standard deviation of split frequencies: 0.008873
520500 -- (-2302.206) (-2309.407) (-2305.818) [-2309.932] * (-2313.015) (-2313.792) (-2304.311) [-2296.905] -- 0:02:32
521000 -- (-2304.608) [-2307.519] (-2308.020) (-2307.473) * (-2318.119) (-2323.025) (-2305.500) [-2302.723] -- 0:02:31
521500 -- (-2309.057) (-2298.609) [-2298.739] (-2308.256) * (-2303.951) (-2316.967) (-2311.849) [-2302.664] -- 0:02:31
522000 -- (-2303.519) (-2301.779) [-2303.012] (-2307.492) * (-2301.324) (-2312.270) [-2303.496] (-2307.107) -- 0:02:31
522500 -- [-2303.785] (-2304.029) (-2311.368) (-2317.306) * [-2312.661] (-2312.089) (-2310.745) (-2308.246) -- 0:02:30
523000 -- [-2300.876] (-2301.285) (-2319.467) (-2326.591) * (-2328.785) (-2314.011) [-2302.124] (-2306.452) -- 0:02:30
523500 -- (-2310.532) [-2297.589] (-2313.116) (-2308.895) * [-2305.106] (-2323.743) (-2302.720) (-2312.884) -- 0:02:31
524000 -- (-2307.698) (-2317.850) [-2313.842] (-2317.566) * (-2317.000) (-2306.448) [-2303.250] (-2304.104) -- 0:02:30
524500 -- (-2308.575) (-2310.755) [-2297.068] (-2321.823) * (-2311.155) (-2305.286) [-2295.760] (-2311.751) -- 0:02:30
525000 -- (-2311.409) (-2310.714) (-2318.169) [-2307.510] * (-2318.932) (-2309.629) (-2308.863) [-2306.492] -- 0:02:30
Average standard deviation of split frequencies: 0.008245
525500 -- (-2305.179) [-2308.119] (-2314.676) (-2313.639) * (-2326.508) (-2308.577) (-2304.332) [-2313.403] -- 0:02:29
526000 -- [-2306.853] (-2315.612) (-2299.093) (-2306.995) * [-2297.352] (-2317.191) (-2303.237) (-2314.257) -- 0:02:29
526500 -- [-2299.070] (-2313.389) (-2295.687) (-2317.469) * (-2315.430) (-2305.779) (-2310.539) [-2296.877] -- 0:02:29
527000 -- (-2309.632) (-2316.071) [-2302.344] (-2309.706) * (-2320.766) [-2305.962] (-2300.405) (-2305.319) -- 0:02:29
527500 -- (-2310.295) [-2308.628] (-2320.427) (-2304.082) * (-2310.065) (-2310.486) [-2303.557] (-2323.385) -- 0:02:29
528000 -- [-2295.026] (-2312.767) (-2320.310) (-2302.443) * (-2312.303) [-2299.626] (-2306.961) (-2320.922) -- 0:02:29
528500 -- [-2299.945] (-2302.766) (-2312.774) (-2316.479) * (-2309.296) (-2314.671) [-2306.604] (-2318.095) -- 0:02:28
529000 -- (-2307.008) [-2309.862] (-2303.281) (-2306.271) * (-2313.019) (-2323.469) [-2304.740] (-2311.080) -- 0:02:28
529500 -- (-2306.794) (-2302.198) [-2302.317] (-2311.816) * (-2309.846) (-2312.787) (-2303.119) [-2314.178] -- 0:02:28
530000 -- (-2317.179) [-2310.820] (-2303.241) (-2320.381) * (-2305.199) [-2302.820] (-2301.837) (-2305.814) -- 0:02:28
Average standard deviation of split frequencies: 0.007403
530500 -- (-2310.171) (-2323.295) (-2306.143) [-2302.527] * [-2303.924] (-2322.405) (-2317.864) (-2302.817) -- 0:02:28
531000 -- (-2305.338) (-2308.346) (-2309.020) [-2321.351] * (-2308.969) [-2305.086] (-2317.389) (-2306.661) -- 0:02:28
531500 -- (-2316.589) [-2313.254] (-2314.940) (-2305.108) * (-2311.376) (-2325.032) (-2310.735) [-2297.565] -- 0:02:28
532000 -- (-2309.340) [-2311.226] (-2317.974) (-2308.758) * (-2304.973) (-2316.494) [-2315.682] (-2311.264) -- 0:02:27
532500 -- (-2315.842) [-2307.447] (-2307.434) (-2324.259) * (-2308.773) (-2312.648) (-2322.722) [-2301.207] -- 0:02:27
533000 -- (-2305.684) [-2307.366] (-2312.198) (-2309.742) * (-2319.948) (-2312.830) (-2299.957) [-2301.778] -- 0:02:27
533500 -- (-2312.586) (-2299.200) [-2307.837] (-2312.908) * (-2311.303) (-2309.398) (-2305.372) [-2305.775] -- 0:02:27
534000 -- (-2296.100) (-2306.194) (-2303.491) [-2308.294] * (-2323.331) (-2310.292) (-2304.090) [-2312.160] -- 0:02:27
534500 -- (-2310.992) (-2307.268) [-2305.668] (-2314.319) * (-2311.288) (-2316.285) [-2301.585] (-2310.358) -- 0:02:27
535000 -- [-2300.150] (-2309.496) (-2303.762) (-2307.492) * (-2306.868) (-2312.325) [-2307.863] (-2303.316) -- 0:02:26
Average standard deviation of split frequencies: 0.007505
535500 -- [-2307.191] (-2310.165) (-2304.183) (-2309.622) * (-2305.956) [-2303.556] (-2321.798) (-2348.212) -- 0:02:26
536000 -- (-2305.020) (-2307.001) (-2314.649) [-2310.379] * [-2299.796] (-2308.153) (-2307.024) (-2315.450) -- 0:02:26
536500 -- [-2295.317] (-2310.573) (-2303.830) (-2322.574) * (-2309.504) (-2298.853) [-2313.804] (-2309.489) -- 0:02:26
537000 -- (-2300.607) (-2320.983) [-2299.057] (-2304.136) * (-2307.539) [-2303.072] (-2311.585) (-2316.736) -- 0:02:26
537500 -- (-2306.185) (-2306.732) (-2311.131) [-2303.689] * (-2308.989) (-2310.658) [-2300.827] (-2322.288) -- 0:02:26
538000 -- (-2314.004) (-2317.394) (-2304.063) [-2310.522] * (-2302.972) [-2300.840] (-2309.536) (-2306.288) -- 0:02:25
538500 -- [-2311.185] (-2307.728) (-2303.613) (-2311.414) * (-2312.509) [-2305.725] (-2299.179) (-2309.653) -- 0:02:25
539000 -- (-2317.743) [-2311.673] (-2303.587) (-2312.128) * (-2308.839) (-2304.626) (-2303.283) [-2304.906] -- 0:02:26
539500 -- (-2306.205) (-2321.874) (-2300.929) [-2311.151] * (-2305.453) [-2307.158] (-2323.622) (-2300.929) -- 0:02:25
540000 -- [-2301.729] (-2313.017) (-2314.760) (-2319.126) * [-2305.656] (-2322.750) (-2307.671) (-2313.328) -- 0:02:25
Average standard deviation of split frequencies: 0.007847
540500 -- (-2316.977) (-2309.816) [-2296.199] (-2304.963) * (-2318.675) (-2305.206) (-2301.506) [-2304.841] -- 0:02:25
541000 -- (-2312.036) (-2298.451) [-2297.548] (-2312.429) * [-2304.309] (-2302.361) (-2304.048) (-2314.365) -- 0:02:25
541500 -- (-2306.064) (-2298.332) [-2302.323] (-2317.177) * (-2313.988) [-2300.144] (-2301.683) (-2302.262) -- 0:02:25
542000 -- (-2311.032) (-2299.879) [-2301.662] (-2317.058) * (-2311.237) [-2307.658] (-2310.636) (-2305.045) -- 0:02:25
542500 -- (-2309.664) (-2308.564) [-2310.154] (-2313.879) * (-2307.879) [-2302.887] (-2316.422) (-2302.185) -- 0:02:25
543000 -- (-2312.107) (-2306.981) [-2311.355] (-2301.877) * (-2318.060) (-2302.992) (-2316.468) [-2304.660] -- 0:02:24
543500 -- (-2306.965) (-2312.220) [-2301.212] (-2311.543) * (-2309.786) (-2310.352) (-2309.514) [-2305.333] -- 0:02:24
544000 -- (-2308.616) (-2303.461) (-2325.916) [-2311.978] * [-2300.007] (-2317.065) (-2325.588) (-2312.814) -- 0:02:24
544500 -- (-2305.894) [-2310.010] (-2326.967) (-2299.086) * (-2300.868) (-2313.319) [-2310.462] (-2309.304) -- 0:02:23
545000 -- (-2313.331) (-2313.899) (-2317.153) [-2300.290] * (-2311.502) (-2314.413) [-2304.019] (-2303.047) -- 0:02:24
Average standard deviation of split frequencies: 0.007598
545500 -- (-2301.026) (-2308.268) (-2306.493) [-2300.356] * (-2312.425) [-2296.168] (-2312.206) (-2326.543) -- 0:02:24
546000 -- (-2311.972) (-2307.703) [-2302.601] (-2311.541) * (-2320.694) (-2302.885) [-2304.608] (-2311.714) -- 0:02:23
546500 -- (-2313.029) (-2311.862) [-2307.585] (-2308.597) * (-2312.805) (-2304.741) [-2308.299] (-2304.285) -- 0:02:23
547000 -- (-2309.085) [-2305.386] (-2307.159) (-2304.919) * (-2314.136) (-2309.620) (-2310.436) [-2311.482] -- 0:02:23
547500 -- [-2305.013] (-2303.489) (-2304.881) (-2310.000) * [-2311.511] (-2301.086) (-2304.043) (-2328.982) -- 0:02:23
548000 -- (-2296.912) (-2303.134) [-2307.564] (-2298.525) * (-2307.269) (-2312.451) (-2309.227) [-2308.858] -- 0:02:23
548500 -- [-2297.376] (-2306.555) (-2307.985) (-2320.001) * (-2311.201) (-2307.254) (-2307.416) [-2303.038] -- 0:02:23
549000 -- (-2303.895) [-2303.112] (-2309.701) (-2314.585) * (-2312.058) (-2308.745) (-2311.823) [-2306.915] -- 0:02:22
549500 -- [-2306.547] (-2302.926) (-2306.933) (-2314.083) * [-2301.095] (-2313.339) (-2311.086) (-2311.349) -- 0:02:22
550000 -- (-2302.547) [-2300.950] (-2308.325) (-2323.646) * [-2304.335] (-2303.705) (-2306.463) (-2305.745) -- 0:02:22
Average standard deviation of split frequencies: 0.008218
550500 -- (-2309.526) [-2298.313] (-2314.126) (-2327.904) * (-2304.951) (-2316.883) (-2319.900) [-2302.810] -- 0:02:22
551000 -- (-2304.064) [-2306.759] (-2306.908) (-2320.237) * (-2300.874) [-2308.244] (-2322.344) (-2313.225) -- 0:02:22
551500 -- [-2311.000] (-2318.137) (-2304.199) (-2312.726) * [-2304.395] (-2305.262) (-2321.654) (-2317.414) -- 0:02:22
552000 -- [-2304.907] (-2316.108) (-2300.984) (-2302.094) * (-2303.634) (-2308.592) (-2312.012) [-2311.523] -- 0:02:22
552500 -- (-2309.842) (-2318.851) (-2313.264) [-2300.235] * (-2306.808) [-2296.739] (-2306.666) (-2305.848) -- 0:02:21
553000 -- (-2326.048) (-2313.217) [-2304.486] (-2302.085) * [-2308.051] (-2303.803) (-2311.401) (-2311.400) -- 0:02:21
553500 -- (-2308.248) (-2314.897) [-2313.837] (-2304.397) * (-2323.964) (-2307.534) (-2315.297) [-2304.819] -- 0:02:21
554000 -- (-2307.650) (-2303.661) (-2323.919) [-2301.284] * (-2312.621) (-2306.169) [-2302.587] (-2306.820) -- 0:02:20
554500 -- [-2304.762] (-2301.535) (-2316.958) (-2304.710) * (-2311.322) [-2301.931] (-2300.244) (-2306.798) -- 0:02:21
555000 -- (-2305.057) (-2307.087) (-2315.122) [-2306.702] * (-2314.339) (-2298.715) [-2299.617] (-2305.874) -- 0:02:21
Average standard deviation of split frequencies: 0.008987
555500 -- (-2313.168) [-2309.535] (-2306.520) (-2322.170) * (-2315.672) (-2305.620) [-2301.599] (-2323.102) -- 0:02:20
556000 -- (-2313.575) [-2303.255] (-2304.219) (-2302.096) * (-2314.018) (-2314.940) (-2309.522) [-2306.474] -- 0:02:20
556500 -- (-2308.687) [-2314.234] (-2310.817) (-2311.817) * (-2320.004) (-2300.799) (-2312.095) [-2300.558] -- 0:02:20
557000 -- (-2307.729) (-2316.348) (-2312.328) [-2306.398] * [-2306.139] (-2304.126) (-2302.711) (-2297.372) -- 0:02:19
557500 -- (-2310.582) (-2320.378) [-2301.109] (-2314.296) * [-2301.861] (-2303.691) (-2303.637) (-2316.913) -- 0:02:19
558000 -- (-2309.190) (-2305.412) [-2300.057] (-2307.019) * (-2323.238) (-2300.861) [-2307.192] (-2314.725) -- 0:02:20
558500 -- (-2313.710) (-2307.702) (-2318.494) [-2305.889] * (-2309.107) (-2313.366) (-2305.795) [-2309.854] -- 0:02:19
559000 -- (-2307.949) (-2299.296) [-2294.786] (-2305.434) * [-2304.175] (-2305.374) (-2304.463) (-2307.012) -- 0:02:19
559500 -- (-2314.816) (-2299.665) (-2309.386) [-2301.895] * [-2306.439] (-2314.867) (-2314.659) (-2314.780) -- 0:02:19
560000 -- (-2315.355) [-2302.496] (-2308.454) (-2304.245) * (-2309.964) (-2316.299) [-2307.058] (-2306.503) -- 0:02:19
Average standard deviation of split frequencies: 0.008744
560500 -- (-2310.142) [-2298.576] (-2322.931) (-2302.497) * (-2303.435) [-2306.202] (-2315.775) (-2315.373) -- 0:02:18
561000 -- (-2310.795) (-2302.289) (-2306.053) [-2301.269] * (-2302.146) (-2309.664) [-2309.154] (-2298.021) -- 0:02:18
561500 -- (-2305.146) [-2301.672] (-2305.768) (-2316.514) * (-2306.623) (-2307.210) [-2301.306] (-2307.691) -- 0:02:19
562000 -- (-2316.963) (-2306.270) (-2308.214) [-2300.109] * (-2313.746) (-2311.350) [-2306.177] (-2317.292) -- 0:02:18
562500 -- (-2326.345) (-2315.222) [-2299.946] (-2306.113) * [-2307.713] (-2310.485) (-2302.853) (-2319.018) -- 0:02:18
563000 -- (-2316.196) [-2304.980] (-2315.600) (-2304.228) * (-2309.680) (-2307.830) [-2302.914] (-2316.152) -- 0:02:18
563500 -- (-2308.264) [-2307.936] (-2306.223) (-2300.214) * (-2312.838) [-2306.485] (-2303.925) (-2315.913) -- 0:02:17
564000 -- (-2308.084) (-2313.408) (-2313.657) [-2309.540] * (-2314.790) (-2306.464) [-2295.267] (-2316.581) -- 0:02:17
564500 -- [-2302.069] (-2307.355) (-2318.691) (-2306.398) * [-2308.589] (-2309.165) (-2303.610) (-2303.061) -- 0:02:17
565000 -- (-2317.179) (-2305.553) (-2321.237) [-2309.748] * [-2304.721] (-2316.615) (-2315.142) (-2306.386) -- 0:02:17
Average standard deviation of split frequencies: 0.009106
565500 -- [-2300.930] (-2314.394) (-2308.184) (-2298.381) * (-2307.956) [-2301.801] (-2310.767) (-2298.837) -- 0:02:17
566000 -- (-2309.810) (-2310.636) [-2310.707] (-2304.210) * [-2306.926] (-2305.256) (-2318.222) (-2316.832) -- 0:02:17
566500 -- [-2299.340] (-2304.969) (-2300.557) (-2310.463) * (-2312.319) [-2301.519] (-2320.239) (-2300.346) -- 0:02:16
567000 -- [-2308.504] (-2306.879) (-2312.657) (-2310.634) * [-2302.562] (-2307.971) (-2300.488) (-2315.821) -- 0:02:16
567500 -- (-2308.066) (-2318.104) [-2303.591] (-2302.123) * (-2294.785) [-2298.012] (-2318.068) (-2318.603) -- 0:02:16
568000 -- [-2309.751] (-2309.701) (-2308.011) (-2310.258) * (-2310.472) (-2314.583) [-2309.818] (-2312.463) -- 0:02:16
568500 -- (-2304.018) (-2320.958) (-2315.785) [-2310.267] * (-2310.257) (-2304.077) (-2318.119) [-2314.369] -- 0:02:16
569000 -- [-2307.463] (-2311.063) (-2328.785) (-2308.775) * [-2298.147] (-2305.944) (-2307.713) (-2314.438) -- 0:02:16
569500 -- [-2308.933] (-2309.323) (-2310.745) (-2302.426) * (-2311.278) (-2308.942) [-2306.232] (-2301.737) -- 0:02:16
570000 -- (-2311.732) [-2315.459] (-2327.351) (-2313.920) * (-2298.178) [-2307.786] (-2312.356) (-2325.413) -- 0:02:15
Average standard deviation of split frequencies: 0.008481
570500 -- (-2304.532) (-2316.256) (-2317.807) [-2307.125] * (-2304.105) [-2303.515] (-2306.086) (-2315.681) -- 0:02:15
571000 -- (-2314.785) [-2304.985] (-2312.297) (-2313.884) * (-2312.270) (-2322.967) [-2302.382] (-2301.851) -- 0:02:15
571500 -- (-2314.375) (-2308.246) (-2300.894) [-2309.419] * [-2306.714] (-2316.837) (-2304.744) (-2301.949) -- 0:02:15
572000 -- [-2299.766] (-2309.730) (-2304.708) (-2307.868) * [-2305.485] (-2310.928) (-2301.449) (-2307.859) -- 0:02:15
572500 -- [-2306.674] (-2305.600) (-2309.864) (-2304.648) * [-2306.675] (-2307.171) (-2317.624) (-2314.725) -- 0:02:15
573000 -- (-2313.780) (-2314.450) (-2305.285) [-2308.789] * (-2305.152) [-2299.506] (-2311.378) (-2308.438) -- 0:02:14
573500 -- (-2309.853) [-2303.270] (-2315.668) (-2317.954) * (-2307.706) (-2302.472) (-2323.758) [-2300.342] -- 0:02:14
574000 -- (-2305.021) (-2309.035) (-2313.756) [-2305.901] * [-2306.279] (-2303.909) (-2312.437) (-2304.233) -- 0:02:14
574500 -- [-2308.824] (-2308.044) (-2311.722) (-2306.860) * (-2303.987) [-2304.095] (-2310.399) (-2306.873) -- 0:02:14
575000 -- (-2309.776) (-2305.105) [-2314.340] (-2309.721) * (-2309.275) (-2317.611) (-2303.366) [-2310.182] -- 0:02:14
Average standard deviation of split frequencies: 0.008566
575500 -- (-2311.574) (-2307.814) (-2311.446) [-2306.066] * (-2306.245) [-2308.113] (-2311.149) (-2307.707) -- 0:02:14
576000 -- (-2311.423) (-2304.313) [-2310.635] (-2312.252) * (-2307.855) (-2319.771) (-2318.689) [-2305.248] -- 0:02:13
576500 -- (-2312.120) [-2302.896] (-2308.590) (-2304.256) * (-2302.783) [-2297.872] (-2315.987) (-2318.285) -- 0:02:13
577000 -- (-2329.079) (-2304.746) [-2304.329] (-2318.219) * (-2315.550) [-2304.449] (-2316.226) (-2303.465) -- 0:02:13
577500 -- (-2303.454) (-2314.276) [-2299.311] (-2328.557) * [-2313.130] (-2306.831) (-2321.567) (-2313.293) -- 0:02:13
578000 -- (-2312.982) (-2315.050) (-2309.843) [-2308.963] * (-2311.861) (-2312.401) (-2305.167) [-2300.820] -- 0:02:12
578500 -- (-2310.602) (-2315.414) (-2307.758) [-2304.855] * (-2312.878) (-2305.438) (-2303.942) [-2300.552] -- 0:02:13
579000 -- (-2307.191) (-2305.958) [-2307.169] (-2304.667) * (-2310.699) (-2299.839) (-2316.189) [-2301.991] -- 0:02:13
579500 -- (-2302.972) (-2312.641) (-2315.690) [-2297.452] * [-2303.980] (-2309.381) (-2315.165) (-2305.437) -- 0:02:12
580000 -- [-2302.508] (-2307.698) (-2309.621) (-2302.307) * (-2303.357) [-2300.986] (-2313.037) (-2308.917) -- 0:02:12
Average standard deviation of split frequencies: 0.009093
580500 -- (-2308.630) (-2312.413) [-2307.083] (-2299.668) * [-2309.518] (-2314.612) (-2311.284) (-2312.380) -- 0:02:12
581000 -- (-2305.319) (-2307.838) (-2312.832) [-2305.164] * (-2316.709) (-2317.483) [-2302.782] (-2310.841) -- 0:02:11
581500 -- (-2313.002) (-2326.504) (-2308.653) [-2296.568] * [-2304.772] (-2309.277) (-2307.270) (-2322.551) -- 0:02:11
582000 -- (-2302.598) (-2304.661) [-2297.917] (-2300.832) * (-2304.995) (-2314.569) [-2302.033] (-2325.694) -- 0:02:11
582500 -- (-2304.438) (-2309.426) [-2299.042] (-2307.339) * [-2303.088] (-2313.328) (-2310.621) (-2308.311) -- 0:02:11
583000 -- [-2298.507] (-2303.111) (-2300.167) (-2305.054) * (-2307.438) (-2319.330) [-2307.800] (-2307.995) -- 0:02:11
583500 -- (-2318.055) (-2319.624) (-2314.684) [-2302.808] * (-2317.513) [-2315.270] (-2320.042) (-2305.900) -- 0:02:11
584000 -- [-2316.862] (-2311.474) (-2307.116) (-2309.272) * (-2311.906) [-2314.269] (-2308.447) (-2301.781) -- 0:02:11
584500 -- (-2302.055) (-2307.853) (-2304.543) [-2305.342] * (-2306.282) (-2305.769) (-2312.718) [-2299.678] -- 0:02:10
585000 -- (-2306.870) (-2309.322) [-2299.869] (-2307.237) * (-2311.109) [-2301.684] (-2304.669) (-2296.932) -- 0:02:10
Average standard deviation of split frequencies: 0.008903
585500 -- (-2306.257) (-2305.664) (-2308.961) [-2296.727] * (-2314.279) (-2307.960) [-2298.636] (-2307.282) -- 0:02:10
586000 -- (-2313.712) (-2303.846) [-2300.010] (-2305.977) * (-2302.251) [-2307.101] (-2311.793) (-2311.689) -- 0:02:10
586500 -- (-2306.601) (-2324.249) (-2322.023) [-2305.341] * [-2300.032] (-2320.020) (-2307.769) (-2309.667) -- 0:02:10
587000 -- (-2307.440) (-2313.394) (-2307.713) [-2300.922] * [-2301.370] (-2310.772) (-2318.488) (-2311.786) -- 0:02:10
587500 -- (-2312.819) (-2316.993) (-2301.778) [-2302.414] * (-2304.643) (-2320.926) [-2299.446] (-2307.686) -- 0:02:09
588000 -- (-2300.390) (-2316.171) [-2300.806] (-2308.313) * [-2305.044] (-2301.966) (-2316.759) (-2315.106) -- 0:02:09
588500 -- (-2314.279) [-2304.467] (-2317.277) (-2306.390) * (-2313.357) (-2301.294) (-2324.691) [-2300.127] -- 0:02:09
589000 -- (-2310.784) (-2300.705) (-2310.479) [-2303.398] * (-2322.016) [-2304.451] (-2321.284) (-2310.205) -- 0:02:09
589500 -- (-2312.820) (-2295.517) (-2312.278) [-2302.242] * [-2301.553] (-2314.278) (-2312.718) (-2310.708) -- 0:02:09
590000 -- [-2302.943] (-2299.305) (-2316.814) (-2314.054) * [-2313.243] (-2311.781) (-2318.435) (-2318.014) -- 0:02:09
Average standard deviation of split frequencies: 0.009258
590500 -- [-2299.992] (-2305.059) (-2307.818) (-2307.608) * [-2309.108] (-2305.542) (-2312.090) (-2317.955) -- 0:02:08
591000 -- [-2305.313] (-2298.288) (-2318.137) (-2308.897) * (-2327.029) (-2308.774) [-2311.968] (-2313.006) -- 0:02:08
591500 -- (-2304.663) [-2306.165] (-2316.984) (-2313.886) * (-2301.811) [-2307.559] (-2316.148) (-2322.779) -- 0:02:08
592000 -- [-2303.254] (-2303.799) (-2309.811) (-2303.358) * (-2318.160) (-2300.075) (-2299.932) [-2305.362] -- 0:02:08
592500 -- (-2324.167) [-2305.370] (-2311.049) (-2308.191) * (-2305.713) (-2300.520) (-2316.249) [-2308.280] -- 0:02:08
593000 -- (-2329.243) (-2309.400) [-2312.978] (-2302.080) * (-2323.628) [-2313.916] (-2311.619) (-2313.210) -- 0:02:08
593500 -- (-2311.764) (-2306.099) [-2304.120] (-2313.630) * (-2304.353) (-2324.301) (-2302.745) [-2307.819] -- 0:02:08
594000 -- (-2317.851) (-2304.942) [-2301.718] (-2306.338) * (-2313.725) (-2316.242) [-2296.225] (-2312.852) -- 0:02:07
594500 -- (-2308.417) [-2303.770] (-2309.111) (-2307.964) * (-2307.781) (-2312.666) (-2308.695) [-2310.065] -- 0:02:07
595000 -- [-2306.409] (-2299.181) (-2317.152) (-2314.311) * (-2307.354) (-2304.144) (-2314.942) [-2305.157] -- 0:02:07
Average standard deviation of split frequencies: 0.009860
595500 -- (-2311.123) [-2301.001] (-2308.973) (-2305.735) * [-2299.274] (-2305.279) (-2308.618) (-2311.723) -- 0:02:07
596000 -- (-2320.913) (-2307.517) [-2297.239] (-2303.368) * [-2299.332] (-2298.524) (-2309.383) (-2309.373) -- 0:02:07
596500 -- (-2306.636) (-2298.725) (-2313.531) [-2310.772] * (-2305.542) (-2309.366) [-2300.675] (-2307.447) -- 0:02:07
597000 -- [-2304.641] (-2294.835) (-2309.375) (-2310.496) * (-2310.251) (-2310.890) [-2305.813] (-2308.184) -- 0:02:06
597500 -- (-2324.308) [-2303.815] (-2324.008) (-2313.512) * (-2299.842) (-2302.860) (-2311.079) [-2303.333] -- 0:02:06
598000 -- (-2311.430) (-2310.251) (-2304.635) [-2301.758] * [-2309.851] (-2300.473) (-2304.944) (-2306.219) -- 0:02:06
598500 -- (-2325.353) [-2299.509] (-2304.455) (-2303.829) * (-2318.974) (-2306.913) (-2300.634) [-2308.104] -- 0:02:06
599000 -- (-2316.237) [-2303.835] (-2295.706) (-2327.059) * (-2303.484) (-2308.149) [-2306.525] (-2305.281) -- 0:02:05
599500 -- (-2311.149) [-2316.471] (-2305.939) (-2305.759) * [-2302.189] (-2303.324) (-2302.966) (-2310.988) -- 0:02:06
600000 -- (-2307.055) (-2315.415) [-2306.440] (-2313.505) * [-2305.542] (-2303.350) (-2318.925) (-2306.800) -- 0:02:06
Average standard deviation of split frequencies: 0.010621
600500 -- [-2303.350] (-2305.091) (-2312.666) (-2307.036) * (-2309.514) [-2305.589] (-2303.308) (-2308.268) -- 0:02:05
601000 -- [-2298.854] (-2318.805) (-2314.954) (-2309.261) * (-2310.475) (-2310.524) (-2312.042) [-2302.728] -- 0:02:05
601500 -- [-2295.593] (-2302.756) (-2301.182) (-2304.469) * (-2306.106) (-2318.226) (-2304.916) [-2306.927] -- 0:02:05
602000 -- (-2306.875) [-2302.635] (-2308.274) (-2302.896) * (-2308.279) [-2303.323] (-2314.417) (-2314.240) -- 0:02:04
602500 -- (-2297.592) (-2311.247) (-2299.944) [-2302.380] * (-2336.379) (-2305.178) [-2303.044] (-2305.271) -- 0:02:04
603000 -- (-2308.841) (-2314.382) [-2306.097] (-2311.183) * (-2310.552) (-2316.603) [-2303.179] (-2321.920) -- 0:02:05
603500 -- [-2306.280] (-2317.120) (-2307.107) (-2303.923) * (-2311.421) (-2323.162) (-2314.499) [-2303.163] -- 0:02:04
604000 -- (-2311.981) [-2297.995] (-2303.446) (-2306.034) * (-2318.024) (-2308.797) (-2308.705) [-2299.774] -- 0:02:04
604500 -- (-2327.025) [-2308.569] (-2308.443) (-2314.085) * (-2307.303) (-2317.462) (-2306.504) [-2302.717] -- 0:02:04
605000 -- [-2313.834] (-2310.536) (-2301.893) (-2306.754) * (-2312.112) (-2302.087) [-2311.190] (-2302.254) -- 0:02:04
Average standard deviation of split frequencies: 0.010839
605500 -- (-2307.372) (-2311.008) [-2304.132] (-2312.459) * (-2314.534) [-2298.149] (-2306.296) (-2300.305) -- 0:02:03
606000 -- (-2297.496) (-2321.498) [-2299.355] (-2316.435) * (-2313.052) [-2296.223] (-2301.147) (-2308.312) -- 0:02:03
606500 -- (-2310.817) (-2303.543) [-2301.226] (-2311.749) * (-2313.686) (-2315.919) [-2306.924] (-2305.807) -- 0:02:03
607000 -- [-2306.736] (-2313.399) (-2300.511) (-2309.116) * (-2317.860) (-2304.186) (-2306.885) [-2301.522] -- 0:02:03
607500 -- (-2302.525) (-2314.421) (-2317.307) [-2301.422] * (-2304.304) [-2298.793] (-2296.968) (-2305.624) -- 0:02:03
608000 -- (-2302.624) [-2310.368] (-2312.816) (-2312.260) * (-2315.307) (-2312.675) (-2302.572) [-2312.053] -- 0:02:03
608500 -- (-2309.624) [-2304.625] (-2301.858) (-2305.063) * (-2301.003) [-2299.612] (-2309.299) (-2315.494) -- 0:02:02
609000 -- [-2305.771] (-2313.043) (-2302.667) (-2312.385) * (-2314.876) (-2305.574) [-2301.823] (-2306.988) -- 0:02:02
609500 -- [-2305.190] (-2299.149) (-2299.762) (-2303.013) * (-2319.379) (-2306.756) (-2296.864) [-2300.859] -- 0:02:03
610000 -- (-2320.072) [-2306.047] (-2320.211) (-2302.717) * (-2307.922) [-2303.744] (-2315.800) (-2311.859) -- 0:02:02
Average standard deviation of split frequencies: 0.010087
610500 -- (-2318.016) [-2306.401] (-2307.934) (-2310.641) * [-2300.260] (-2304.939) (-2304.110) (-2314.965) -- 0:02:02
611000 -- (-2314.964) (-2315.428) [-2304.978] (-2307.157) * (-2322.427) [-2301.148] (-2310.546) (-2307.989) -- 0:02:02
611500 -- (-2301.326) (-2307.909) (-2320.487) [-2298.851] * (-2303.555) (-2310.647) (-2302.203) [-2303.270] -- 0:02:01
612000 -- (-2306.455) (-2317.547) [-2303.938] (-2305.504) * (-2306.496) [-2293.912] (-2298.100) (-2310.368) -- 0:02:01
612500 -- (-2301.817) (-2303.027) (-2303.509) [-2303.455] * (-2308.460) (-2299.680) (-2305.739) [-2310.108] -- 0:02:01
613000 -- (-2311.867) (-2309.241) [-2302.917] (-2321.271) * (-2308.932) (-2308.683) [-2311.046] (-2307.342) -- 0:02:01
613500 -- (-2304.318) (-2307.028) (-2306.450) [-2299.290] * (-2306.337) [-2297.115] (-2307.806) (-2305.040) -- 0:02:01
614000 -- (-2297.667) (-2309.066) [-2307.104] (-2306.406) * (-2318.539) [-2307.360] (-2303.135) (-2310.504) -- 0:02:01
614500 -- [-2303.270] (-2316.665) (-2316.961) (-2320.018) * [-2306.179] (-2315.185) (-2325.853) (-2304.347) -- 0:02:01
615000 -- [-2305.496] (-2310.944) (-2311.854) (-2304.399) * [-2303.874] (-2309.519) (-2305.704) (-2305.227) -- 0:02:00
Average standard deviation of split frequencies: 0.009795
615500 -- (-2303.547) (-2314.611) [-2303.527] (-2309.305) * (-2300.445) (-2321.317) (-2310.266) [-2296.237] -- 0:02:00
616000 -- (-2296.598) [-2300.240] (-2311.639) (-2312.801) * [-2310.125] (-2308.814) (-2310.824) (-2307.488) -- 0:02:00
616500 -- [-2308.104] (-2308.618) (-2309.579) (-2316.994) * (-2302.195) (-2314.778) [-2313.591] (-2301.754) -- 0:02:00
617000 -- (-2317.526) (-2305.595) (-2301.488) [-2303.893] * (-2308.787) (-2312.972) [-2301.422] (-2308.488) -- 0:02:00
617500 -- [-2304.217] (-2313.368) (-2303.856) (-2302.558) * (-2310.104) (-2318.857) (-2307.505) [-2299.155] -- 0:02:00
618000 -- (-2311.608) (-2319.622) (-2314.947) [-2304.972] * (-2309.159) [-2305.167] (-2300.525) (-2312.532) -- 0:01:59
618500 -- (-2312.840) [-2308.532] (-2299.771) (-2304.377) * (-2307.609) [-2306.624] (-2305.278) (-2298.064) -- 0:01:59
619000 -- [-2298.231] (-2308.502) (-2311.709) (-2302.934) * [-2305.509] (-2311.739) (-2304.824) (-2311.797) -- 0:02:00
619500 -- (-2315.371) [-2304.366] (-2312.332) (-2311.193) * (-2314.778) [-2308.635] (-2316.611) (-2318.563) -- 0:01:59
620000 -- (-2305.694) (-2314.619) [-2305.071] (-2311.897) * (-2319.975) (-2315.697) [-2305.280] (-2305.837) -- 0:01:59
Average standard deviation of split frequencies: 0.009469
620500 -- (-2310.457) (-2305.279) [-2306.571] (-2318.259) * (-2304.540) (-2301.141) (-2300.990) [-2305.881] -- 0:01:59
621000 -- (-2309.995) [-2308.031] (-2310.020) (-2321.629) * [-2298.848] (-2301.634) (-2305.343) (-2315.154) -- 0:01:59
621500 -- (-2313.319) [-2304.550] (-2302.542) (-2309.025) * [-2311.116] (-2306.900) (-2313.191) (-2305.389) -- 0:01:58
622000 -- [-2306.153] (-2310.716) (-2304.441) (-2309.206) * [-2304.461] (-2306.488) (-2306.770) (-2318.626) -- 0:01:59
622500 -- [-2302.296] (-2315.186) (-2309.896) (-2309.802) * (-2303.926) (-2303.866) (-2333.420) [-2300.982] -- 0:01:58
623000 -- [-2298.428] (-2304.804) (-2309.260) (-2309.953) * (-2304.479) [-2310.070] (-2311.630) (-2308.838) -- 0:01:58
623500 -- (-2317.870) (-2310.596) (-2316.039) [-2307.346] * (-2311.946) [-2321.832] (-2313.007) (-2305.799) -- 0:01:58
624000 -- (-2315.856) (-2301.975) (-2319.672) [-2299.306] * (-2313.380) (-2299.954) [-2299.052] (-2307.513) -- 0:01:58
624500 -- (-2305.049) (-2307.127) (-2310.800) [-2303.475] * (-2320.537) (-2297.654) [-2304.025] (-2312.687) -- 0:01:57
625000 -- [-2309.216] (-2317.164) (-2307.161) (-2300.830) * (-2312.912) (-2309.751) [-2301.210] (-2323.882) -- 0:01:58
Average standard deviation of split frequencies: 0.009438
625500 -- (-2313.525) (-2301.779) (-2309.233) [-2302.459] * (-2304.124) [-2306.764] (-2297.044) (-2304.196) -- 0:01:57
626000 -- (-2296.560) (-2310.520) [-2302.712] (-2304.659) * (-2303.757) (-2312.552) (-2308.459) [-2301.835] -- 0:01:57
626500 -- (-2307.324) (-2308.173) (-2302.790) [-2299.288] * [-2303.793] (-2308.894) (-2302.737) (-2314.458) -- 0:01:57
627000 -- (-2303.697) (-2303.144) (-2311.697) [-2299.432] * (-2304.962) (-2309.868) [-2299.900] (-2305.217) -- 0:01:57
627500 -- (-2312.198) (-2304.376) (-2305.198) [-2303.335] * (-2304.561) (-2306.222) [-2310.304] (-2307.460) -- 0:01:56
628000 -- (-2307.767) (-2308.338) [-2305.946] (-2303.827) * (-2312.926) [-2308.228] (-2312.304) (-2314.087) -- 0:01:57
628500 -- (-2311.684) (-2312.865) (-2307.604) [-2300.831] * [-2305.434] (-2302.579) (-2300.122) (-2325.266) -- 0:01:57
629000 -- (-2311.523) (-2309.970) (-2297.816) [-2297.017] * (-2307.910) (-2303.404) [-2307.640] (-2303.807) -- 0:01:56
629500 -- (-2307.631) (-2302.885) [-2299.938] (-2315.259) * (-2320.827) (-2306.963) [-2300.425] (-2308.363) -- 0:01:56
630000 -- (-2313.979) (-2303.948) [-2299.086] (-2310.695) * (-2307.068) (-2317.480) [-2304.499] (-2302.949) -- 0:01:56
Average standard deviation of split frequencies: 0.009318
630500 -- (-2326.453) (-2308.345) [-2298.530] (-2317.698) * [-2305.694] (-2311.166) (-2305.217) (-2316.409) -- 0:01:56
631000 -- (-2308.121) [-2301.301] (-2311.310) (-2301.048) * (-2306.924) [-2310.517] (-2320.630) (-2310.228) -- 0:01:56
631500 -- (-2308.068) (-2300.237) (-2305.539) [-2304.471] * (-2303.069) (-2307.349) (-2310.133) [-2308.013] -- 0:01:56
632000 -- (-2305.255) (-2312.125) [-2304.800] (-2308.151) * (-2317.841) (-2311.261) (-2310.240) [-2303.961] -- 0:01:55
632500 -- [-2313.441] (-2314.512) (-2306.420) (-2310.762) * (-2306.541) (-2305.238) [-2295.282] (-2319.218) -- 0:01:55
633000 -- (-2306.556) [-2302.689] (-2303.446) (-2323.938) * [-2304.164] (-2299.677) (-2295.202) (-2316.825) -- 0:01:55
633500 -- (-2315.705) (-2309.466) [-2302.869] (-2312.263) * (-2311.538) (-2325.932) (-2317.826) [-2295.558] -- 0:01:55
634000 -- [-2313.675] (-2312.314) (-2299.398) (-2307.482) * [-2306.792] (-2322.078) (-2305.886) (-2301.195) -- 0:01:55
634500 -- (-2318.158) [-2301.812] (-2302.171) (-2312.473) * (-2309.261) (-2313.650) (-2306.372) [-2306.229] -- 0:01:55
635000 -- [-2307.715] (-2304.937) (-2318.651) (-2307.642) * [-2304.739] (-2309.074) (-2299.296) (-2300.741) -- 0:01:54
Average standard deviation of split frequencies: 0.009290
635500 -- (-2306.877) [-2301.195] (-2314.256) (-2310.076) * [-2299.990] (-2324.915) (-2313.251) (-2304.833) -- 0:01:54
636000 -- (-2323.994) (-2298.165) (-2308.791) [-2306.517] * (-2304.944) (-2310.909) [-2302.044] (-2310.000) -- 0:01:54
636500 -- (-2307.166) (-2303.240) [-2312.025] (-2310.292) * (-2309.425) (-2306.908) (-2303.494) [-2298.965] -- 0:01:54
637000 -- (-2316.123) (-2304.704) [-2308.141] (-2299.448) * (-2321.413) (-2309.030) [-2299.316] (-2312.090) -- 0:01:54
637500 -- (-2310.610) (-2306.306) (-2315.309) [-2299.276] * (-2312.159) (-2318.045) [-2300.651] (-2303.620) -- 0:01:54
638000 -- (-2306.750) [-2308.044] (-2310.151) (-2306.379) * (-2305.069) (-2308.515) [-2306.860] (-2318.197) -- 0:01:54
638500 -- (-2303.955) [-2300.774] (-2313.988) (-2302.261) * (-2306.131) (-2309.649) (-2313.872) [-2308.703] -- 0:01:53
639000 -- (-2310.606) (-2303.715) [-2306.331] (-2316.174) * (-2313.922) [-2308.233] (-2311.825) (-2312.860) -- 0:01:53
639500 -- (-2313.156) (-2306.886) (-2295.598) [-2316.892] * (-2314.455) (-2313.396) (-2306.662) [-2301.025] -- 0:01:53
640000 -- (-2312.731) (-2312.794) [-2300.850] (-2315.368) * [-2307.648] (-2314.574) (-2320.838) (-2314.106) -- 0:01:53
Average standard deviation of split frequencies: 0.009026
640500 -- [-2305.875] (-2306.100) (-2313.141) (-2316.343) * [-2310.530] (-2311.942) (-2319.419) (-2318.217) -- 0:01:53
641000 -- (-2311.367) [-2303.005] (-2302.019) (-2313.123) * (-2303.043) [-2317.165] (-2310.785) (-2301.138) -- 0:01:53
641500 -- (-2305.719) (-2306.992) [-2307.259] (-2308.775) * (-2301.237) (-2308.558) [-2301.449] (-2301.992) -- 0:01:52
642000 -- (-2301.370) (-2300.457) (-2305.419) [-2308.113] * [-2302.383] (-2304.187) (-2304.606) (-2299.222) -- 0:01:52
642500 -- (-2310.987) [-2299.504] (-2310.713) (-2308.613) * [-2300.422] (-2306.163) (-2309.278) (-2308.917) -- 0:01:52
643000 -- (-2304.358) [-2300.666] (-2305.827) (-2298.013) * (-2313.717) [-2302.286] (-2301.694) (-2315.735) -- 0:01:52
643500 -- (-2308.000) (-2307.914) (-2310.147) [-2314.006] * (-2307.749) (-2316.720) (-2300.982) [-2304.884] -- 0:01:51
644000 -- [-2316.078] (-2307.913) (-2309.535) (-2320.571) * (-2305.560) (-2308.325) [-2299.650] (-2307.902) -- 0:01:52
644500 -- [-2301.814] (-2320.840) (-2312.301) (-2305.597) * (-2304.138) [-2300.792] (-2297.662) (-2312.946) -- 0:01:51
645000 -- (-2305.728) (-2311.479) (-2300.444) [-2307.299] * [-2308.217] (-2322.034) (-2305.337) (-2311.958) -- 0:01:51
Average standard deviation of split frequencies: 0.010022
645500 -- [-2298.807] (-2306.492) (-2311.394) (-2298.931) * (-2322.968) (-2315.899) [-2307.484] (-2312.034) -- 0:01:51
646000 -- (-2318.591) (-2310.260) (-2308.037) [-2303.358] * (-2310.546) [-2311.888] (-2309.519) (-2304.440) -- 0:01:51
646500 -- (-2303.883) [-2298.307] (-2315.049) (-2305.917) * (-2320.731) [-2303.771] (-2309.531) (-2309.776) -- 0:01:50
647000 -- (-2314.004) [-2301.301] (-2305.454) (-2306.047) * (-2309.956) [-2315.212] (-2305.359) (-2317.709) -- 0:01:50
647500 -- (-2319.259) [-2310.531] (-2302.451) (-2305.095) * (-2316.367) [-2307.280] (-2308.865) (-2321.229) -- 0:01:51
648000 -- (-2313.771) (-2302.919) [-2302.573] (-2307.007) * (-2315.239) (-2303.188) [-2314.153] (-2316.452) -- 0:01:50
648500 -- (-2316.796) (-2308.579) [-2305.927] (-2315.696) * (-2311.156) [-2296.788] (-2311.051) (-2301.089) -- 0:01:50
649000 -- (-2308.986) (-2323.784) [-2311.206] (-2310.750) * (-2306.982) [-2304.651] (-2310.797) (-2309.590) -- 0:01:50
649500 -- (-2311.897) [-2305.753] (-2308.343) (-2302.768) * (-2310.151) (-2310.207) [-2312.770] (-2314.906) -- 0:01:50
650000 -- (-2307.059) (-2304.845) [-2312.191] (-2318.606) * (-2314.444) (-2307.629) (-2317.954) [-2308.142] -- 0:01:49
Average standard deviation of split frequencies: 0.010384
650500 -- (-2322.104) (-2300.956) (-2311.313) [-2300.978] * (-2307.248) (-2314.104) [-2313.247] (-2306.624) -- 0:01:49
651000 -- (-2311.248) [-2303.303] (-2310.314) (-2307.633) * (-2326.595) [-2308.992] (-2304.889) (-2307.414) -- 0:01:49
651500 -- (-2315.756) (-2314.628) [-2304.310] (-2305.813) * [-2299.441] (-2306.613) (-2316.246) (-2312.098) -- 0:01:49
652000 -- [-2297.786] (-2311.222) (-2316.330) (-2303.287) * (-2312.585) (-2300.605) (-2308.839) [-2303.774] -- 0:01:49
652500 -- (-2317.898) (-2318.725) (-2303.788) [-2300.901] * [-2302.219] (-2299.121) (-2311.405) (-2312.185) -- 0:01:49
653000 -- (-2311.516) [-2303.571] (-2308.026) (-2305.388) * [-2306.744] (-2313.721) (-2320.030) (-2309.970) -- 0:01:48
653500 -- (-2305.845) [-2303.906] (-2310.353) (-2310.973) * (-2307.045) [-2301.540] (-2310.135) (-2299.482) -- 0:01:48
654000 -- (-2324.541) (-2305.504) [-2303.164] (-2301.025) * (-2323.269) [-2307.160] (-2304.672) (-2315.617) -- 0:01:48
654500 -- (-2313.016) [-2299.398] (-2304.802) (-2317.950) * (-2305.046) [-2305.916] (-2321.613) (-2317.278) -- 0:01:48
655000 -- (-2319.542) (-2300.270) [-2307.595] (-2324.372) * (-2302.496) (-2305.554) [-2320.706] (-2306.616) -- 0:01:48
Average standard deviation of split frequencies: 0.011833
655500 -- (-2306.175) (-2308.055) [-2308.091] (-2319.391) * (-2306.561) (-2312.588) (-2308.809) [-2306.370] -- 0:01:48
656000 -- (-2311.574) [-2296.973] (-2308.687) (-2308.766) * (-2308.846) (-2304.597) [-2305.376] (-2305.696) -- 0:01:48
656500 -- (-2308.004) (-2308.305) (-2312.867) [-2313.923] * (-2310.474) (-2308.941) [-2307.465] (-2319.765) -- 0:01:47
657000 -- (-2295.953) (-2299.518) (-2319.647) [-2306.661] * (-2316.402) (-2325.368) (-2299.183) [-2310.836] -- 0:01:47
657500 -- (-2303.084) [-2294.040] (-2298.904) (-2311.894) * [-2310.120] (-2316.175) (-2310.914) (-2298.209) -- 0:01:47
658000 -- (-2304.262) [-2304.945] (-2301.122) (-2318.202) * [-2301.656] (-2311.716) (-2304.032) (-2304.397) -- 0:01:47
658500 -- (-2309.414) [-2309.883] (-2303.417) (-2317.427) * [-2310.555] (-2304.113) (-2317.203) (-2303.738) -- 0:01:47
659000 -- [-2310.864] (-2302.687) (-2301.796) (-2305.766) * (-2305.876) [-2305.582] (-2309.512) (-2304.673) -- 0:01:47
659500 -- (-2310.063) (-2308.837) (-2319.077) [-2305.922] * [-2302.469] (-2308.860) (-2304.573) (-2306.444) -- 0:01:46
660000 -- (-2301.669) [-2300.617] (-2308.261) (-2313.155) * (-2308.790) (-2316.403) [-2308.062] (-2309.673) -- 0:01:46
Average standard deviation of split frequencies: 0.012701
660500 -- (-2308.755) [-2299.659] (-2305.882) (-2310.698) * (-2303.089) (-2314.003) (-2302.416) [-2309.827] -- 0:01:46
661000 -- [-2310.475] (-2311.372) (-2300.647) (-2315.243) * (-2302.948) (-2315.685) [-2299.489] (-2312.701) -- 0:01:46
661500 -- [-2302.147] (-2309.576) (-2306.960) (-2309.214) * (-2301.639) (-2313.968) (-2300.099) [-2305.333] -- 0:01:45
662000 -- [-2304.107] (-2299.338) (-2304.053) (-2313.831) * (-2308.579) (-2304.196) (-2306.762) [-2306.543] -- 0:01:46
662500 -- [-2297.281] (-2310.324) (-2314.851) (-2310.964) * (-2304.071) [-2305.912] (-2308.497) (-2322.668) -- 0:01:45
663000 -- (-2300.775) (-2308.893) (-2305.092) [-2303.198] * [-2319.937] (-2305.675) (-2315.852) (-2316.730) -- 0:01:45
663500 -- (-2309.693) [-2308.345] (-2314.832) (-2303.108) * (-2318.669) [-2310.037] (-2308.418) (-2309.338) -- 0:01:45
664000 -- (-2325.334) (-2312.145) [-2307.011] (-2304.395) * (-2307.590) (-2303.789) [-2302.381] (-2305.563) -- 0:01:45
664500 -- (-2297.421) (-2311.780) (-2319.266) [-2303.679] * (-2316.326) (-2301.911) [-2308.495] (-2314.181) -- 0:01:45
665000 -- [-2307.591] (-2305.471) (-2314.985) (-2302.228) * (-2310.965) [-2310.326] (-2315.441) (-2328.325) -- 0:01:45
Average standard deviation of split frequencies: 0.012882
665500 -- [-2309.015] (-2305.711) (-2301.919) (-2307.079) * (-2308.161) (-2299.301) [-2310.182] (-2308.253) -- 0:01:45
666000 -- (-2318.183) (-2307.983) [-2313.255] (-2316.339) * (-2311.215) [-2294.728] (-2308.482) (-2310.672) -- 0:01:44
666500 -- (-2313.177) (-2299.525) [-2300.351] (-2319.585) * [-2305.872] (-2295.996) (-2319.124) (-2309.460) -- 0:01:44
667000 -- (-2315.521) [-2306.692] (-2303.472) (-2304.031) * (-2311.469) (-2300.684) (-2315.379) [-2307.792] -- 0:01:44
667500 -- (-2305.505) [-2308.950] (-2303.380) (-2308.305) * (-2308.217) (-2301.754) (-2329.246) [-2314.226] -- 0:01:44
668000 -- (-2308.606) (-2309.239) [-2303.520] (-2303.457) * (-2319.330) (-2313.609) (-2306.530) [-2311.611] -- 0:01:43
668500 -- (-2308.444) (-2305.943) [-2307.698] (-2307.496) * [-2305.971] (-2320.830) (-2306.388) (-2310.256) -- 0:01:43
669000 -- (-2313.457) [-2303.598] (-2305.925) (-2316.818) * (-2303.037) [-2302.402] (-2311.218) (-2304.519) -- 0:01:43
669500 -- (-2318.013) (-2317.888) [-2307.623] (-2304.667) * (-2297.154) (-2310.870) (-2316.309) [-2308.553] -- 0:01:43
670000 -- (-2315.602) (-2301.580) [-2308.965] (-2307.444) * (-2300.528) [-2304.675] (-2308.320) (-2306.606) -- 0:01:43
Average standard deviation of split frequencies: 0.012465
670500 -- (-2313.614) [-2299.487] (-2315.484) (-2306.476) * (-2315.707) (-2305.073) (-2295.243) [-2302.065] -- 0:01:43
671000 -- (-2306.238) [-2312.504] (-2310.010) (-2317.184) * (-2315.109) [-2299.566] (-2309.895) (-2311.811) -- 0:01:42
671500 -- (-2301.830) (-2311.695) (-2312.687) [-2309.615] * (-2317.049) (-2315.323) (-2312.049) [-2303.536] -- 0:01:42
672000 -- [-2298.644] (-2295.780) (-2305.324) (-2309.081) * (-2316.265) [-2310.252] (-2309.397) (-2313.982) -- 0:01:42
672500 -- (-2305.143) (-2298.422) [-2303.005] (-2312.318) * (-2312.830) (-2306.576) [-2307.139] (-2319.869) -- 0:01:42
673000 -- (-2311.717) (-2314.003) [-2307.259] (-2307.548) * [-2301.825] (-2331.578) (-2309.054) (-2325.453) -- 0:01:42
673500 -- [-2311.937] (-2312.555) (-2316.244) (-2314.786) * (-2310.240) (-2310.830) (-2310.127) [-2303.991] -- 0:01:42
674000 -- (-2302.406) [-2311.151] (-2319.311) (-2303.211) * (-2312.658) (-2312.857) [-2311.781] (-2300.794) -- 0:01:42
674500 -- (-2321.571) (-2307.578) (-2311.787) [-2301.603] * (-2300.402) (-2309.502) [-2303.626] (-2313.565) -- 0:01:41
675000 -- (-2306.568) (-2305.271) [-2300.929] (-2304.342) * (-2311.502) (-2313.379) [-2312.448] (-2316.313) -- 0:01:41
Average standard deviation of split frequencies: 0.012041
675500 -- (-2308.674) [-2304.175] (-2317.467) (-2304.766) * (-2321.033) (-2318.913) [-2299.856] (-2304.929) -- 0:01:41
676000 -- [-2311.045] (-2302.476) (-2322.322) (-2313.910) * (-2325.720) (-2315.005) [-2321.559] (-2321.218) -- 0:01:41
676500 -- (-2310.253) (-2311.296) (-2310.136) [-2307.956] * (-2307.581) (-2327.513) (-2309.290) [-2311.700] -- 0:01:41
677000 -- (-2315.686) (-2304.270) [-2304.125] (-2308.621) * (-2306.111) (-2302.478) [-2305.355] (-2317.541) -- 0:01:41
677500 -- (-2306.053) (-2308.603) [-2302.452] (-2318.376) * (-2322.940) [-2300.367] (-2313.975) (-2311.755) -- 0:01:40
678000 -- (-2309.464) (-2310.013) [-2304.060] (-2305.603) * (-2312.138) (-2307.642) [-2307.840] (-2309.481) -- 0:01:40
678500 -- (-2305.609) (-2312.610) [-2295.248] (-2306.367) * [-2303.029] (-2302.690) (-2314.592) (-2301.953) -- 0:01:40
679000 -- (-2311.285) (-2311.632) [-2312.239] (-2310.320) * (-2306.111) (-2300.734) (-2313.400) [-2309.315] -- 0:01:40
679500 -- (-2302.110) (-2331.188) [-2310.497] (-2308.830) * (-2306.285) [-2302.756] (-2317.843) (-2303.101) -- 0:01:40
680000 -- (-2311.817) (-2318.663) (-2311.934) [-2306.451] * [-2310.124] (-2309.557) (-2314.432) (-2314.976) -- 0:01:40
Average standard deviation of split frequencies: 0.011589
680500 -- (-2304.353) (-2316.970) [-2307.902] (-2330.627) * (-2319.804) [-2303.439] (-2311.959) (-2306.200) -- 0:01:40
681000 -- [-2307.057] (-2313.700) (-2322.309) (-2304.293) * (-2309.562) (-2308.749) [-2304.368] (-2313.842) -- 0:01:39
681500 -- (-2313.818) (-2323.811) [-2300.684] (-2299.361) * (-2302.200) [-2305.216] (-2303.677) (-2318.976) -- 0:01:39
682000 -- (-2320.697) (-2315.936) [-2302.590] (-2317.604) * [-2303.540] (-2307.725) (-2307.247) (-2318.397) -- 0:01:39
682500 -- (-2306.578) (-2312.828) [-2305.765] (-2310.766) * (-2306.861) [-2308.767] (-2324.018) (-2303.532) -- 0:01:39
683000 -- (-2301.718) (-2306.320) [-2301.445] (-2311.204) * (-2304.085) [-2302.517] (-2307.342) (-2309.031) -- 0:01:39
683500 -- (-2310.402) (-2311.834) [-2309.757] (-2315.004) * [-2297.073] (-2299.534) (-2304.986) (-2315.713) -- 0:01:39
684000 -- (-2314.045) (-2321.773) (-2301.146) [-2316.841] * [-2299.705] (-2299.989) (-2305.464) (-2306.416) -- 0:01:38
684500 -- (-2302.300) [-2306.963] (-2299.193) (-2315.168) * (-2300.603) [-2302.539] (-2317.908) (-2304.304) -- 0:01:39
685000 -- (-2304.801) (-2313.341) [-2298.565] (-2314.976) * [-2298.740] (-2313.182) (-2310.460) (-2311.371) -- 0:01:38
Average standard deviation of split frequencies: 0.012049
685500 -- (-2294.946) [-2299.236] (-2301.229) (-2311.912) * [-2307.718] (-2315.734) (-2311.571) (-2301.837) -- 0:01:38
686000 -- (-2300.625) (-2301.097) (-2303.137) [-2307.015] * [-2322.881] (-2312.892) (-2307.580) (-2307.816) -- 0:01:38
686500 -- (-2303.014) (-2304.015) [-2305.883] (-2315.836) * (-2307.729) (-2322.411) [-2302.216] (-2310.011) -- 0:01:38
687000 -- (-2304.497) (-2306.545) [-2311.067] (-2310.595) * (-2307.582) (-2313.605) (-2306.945) [-2303.162] -- 0:01:37
687500 -- [-2306.700] (-2303.813) (-2314.344) (-2304.171) * (-2309.518) [-2309.638] (-2299.006) (-2310.539) -- 0:01:37
688000 -- (-2314.393) (-2305.372) [-2305.545] (-2301.320) * (-2312.496) (-2317.204) (-2310.624) [-2309.365] -- 0:01:37
688500 -- (-2309.926) [-2303.361] (-2307.488) (-2309.686) * (-2316.457) [-2308.777] (-2310.678) (-2317.488) -- 0:01:37
689000 -- (-2311.488) [-2301.655] (-2313.556) (-2300.677) * (-2308.707) (-2315.223) [-2303.439] (-2309.462) -- 0:01:37
689500 -- (-2310.456) (-2298.881) (-2304.489) [-2299.618] * [-2311.644] (-2320.209) (-2301.510) (-2306.034) -- 0:01:37
690000 -- (-2308.656) (-2299.709) (-2317.990) [-2300.773] * [-2306.928] (-2312.002) (-2306.353) (-2304.491) -- 0:01:37
Average standard deviation of split frequencies: 0.011467
690500 -- (-2311.800) (-2306.986) (-2303.207) [-2303.117] * [-2303.457] (-2303.327) (-2313.165) (-2300.772) -- 0:01:36
691000 -- [-2308.371] (-2310.093) (-2311.848) (-2313.679) * (-2309.364) (-2311.521) [-2302.610] (-2309.131) -- 0:01:36
691500 -- (-2305.540) [-2297.672] (-2306.610) (-2307.479) * (-2308.218) (-2310.377) (-2316.077) [-2303.100] -- 0:01:36
692000 -- [-2320.033] (-2305.515) (-2317.253) (-2309.247) * (-2303.070) (-2305.237) [-2306.981] (-2305.817) -- 0:01:36
692500 -- (-2315.970) (-2303.615) [-2305.514] (-2301.220) * (-2304.608) (-2306.679) (-2309.841) [-2301.537] -- 0:01:36
693000 -- (-2308.849) [-2308.022] (-2298.997) (-2306.152) * (-2309.958) [-2299.934] (-2311.965) (-2305.372) -- 0:01:36
693500 -- (-2302.251) (-2321.228) (-2309.917) [-2301.860] * (-2302.890) (-2305.264) [-2306.527] (-2304.405) -- 0:01:35
694000 -- (-2307.547) (-2319.709) (-2320.290) [-2302.629] * (-2307.321) (-2297.939) [-2302.023] (-2314.507) -- 0:01:35
694500 -- (-2302.291) (-2309.155) (-2305.322) [-2297.860] * (-2302.679) (-2311.895) [-2304.967] (-2308.382) -- 0:01:35
695000 -- [-2300.815] (-2313.378) (-2313.160) (-2300.621) * (-2301.524) (-2302.795) [-2312.505] (-2307.105) -- 0:01:35
Average standard deviation of split frequencies: 0.010611
695500 -- (-2308.802) (-2316.795) (-2321.774) [-2301.555] * (-2307.533) (-2304.133) [-2311.120] (-2299.409) -- 0:01:35
696000 -- (-2316.590) (-2316.550) (-2306.217) [-2300.113] * [-2307.124] (-2307.001) (-2313.599) (-2312.429) -- 0:01:35
696500 -- (-2320.316) [-2308.925] (-2312.950) (-2314.825) * (-2303.222) (-2306.744) (-2321.932) [-2303.470] -- 0:01:34
697000 -- (-2309.203) [-2301.462] (-2317.548) (-2309.562) * (-2301.055) [-2303.655] (-2314.188) (-2311.395) -- 0:01:34
697500 -- (-2316.664) [-2308.727] (-2313.596) (-2303.702) * (-2326.509) (-2312.034) (-2300.104) [-2300.942] -- 0:01:34
698000 -- (-2308.249) [-2300.643] (-2304.482) (-2307.602) * [-2314.215] (-2322.196) (-2305.531) (-2309.733) -- 0:01:34
698500 -- (-2318.696) [-2304.080] (-2316.329) (-2313.687) * [-2304.859] (-2305.570) (-2305.235) (-2306.284) -- 0:01:34
699000 -- [-2302.513] (-2315.440) (-2308.269) (-2310.199) * [-2312.480] (-2304.433) (-2315.276) (-2310.438) -- 0:01:34
699500 -- [-2303.757] (-2317.687) (-2308.609) (-2307.398) * (-2301.044) (-2306.382) (-2303.324) [-2309.393] -- 0:01:34
700000 -- (-2319.008) [-2304.343] (-2322.635) (-2305.574) * (-2320.957) (-2303.241) [-2308.001] (-2307.531) -- 0:01:33
Average standard deviation of split frequencies: 0.010451
700500 -- (-2310.009) (-2308.176) (-2309.890) [-2302.618] * (-2318.624) [-2313.236] (-2323.171) (-2298.197) -- 0:01:34
701000 -- (-2309.421) [-2303.915] (-2308.787) (-2307.795) * (-2319.040) (-2304.864) (-2303.893) [-2302.345] -- 0:01:33
701500 -- (-2306.295) (-2312.856) [-2306.843] (-2313.212) * [-2307.506] (-2306.228) (-2304.548) (-2307.601) -- 0:01:33
702000 -- (-2312.790) [-2308.313] (-2312.044) (-2300.224) * (-2303.913) (-2310.087) (-2309.748) [-2310.036] -- 0:01:33
702500 -- [-2295.839] (-2313.727) (-2311.187) (-2304.167) * (-2308.824) [-2301.521] (-2321.819) (-2313.580) -- 0:01:33
703000 -- (-2310.492) [-2297.499] (-2312.680) (-2298.311) * (-2305.415) (-2310.209) [-2301.859] (-2307.395) -- 0:01:32
703500 -- (-2308.173) (-2313.568) [-2314.342] (-2304.700) * [-2297.625] (-2311.362) (-2302.885) (-2315.267) -- 0:01:32
704000 -- [-2295.580] (-2305.635) (-2319.752) (-2304.654) * (-2298.083) [-2303.429] (-2304.518) (-2309.998) -- 0:01:32
704500 -- (-2304.684) [-2305.323] (-2306.929) (-2304.700) * (-2306.132) (-2313.366) [-2295.364] (-2311.113) -- 0:01:32
705000 -- [-2309.960] (-2320.289) (-2303.892) (-2297.113) * (-2310.675) (-2307.496) [-2297.929] (-2309.213) -- 0:01:32
Average standard deviation of split frequencies: 0.010238
705500 -- (-2306.598) [-2298.262] (-2301.450) (-2314.773) * [-2323.511] (-2308.129) (-2302.038) (-2302.842) -- 0:01:32
706000 -- [-2306.525] (-2303.585) (-2314.363) (-2309.318) * (-2332.431) [-2309.668] (-2320.457) (-2305.961) -- 0:01:32
706500 -- [-2298.598] (-2299.584) (-2313.799) (-2314.610) * (-2301.977) (-2332.912) [-2304.861] (-2304.003) -- 0:01:31
707000 -- (-2305.192) [-2302.837] (-2328.728) (-2315.284) * (-2306.115) (-2324.941) [-2295.955] (-2314.062) -- 0:01:31
707500 -- (-2310.936) (-2307.984) [-2307.188] (-2317.079) * (-2311.649) (-2309.004) [-2298.357] (-2314.829) -- 0:01:31
708000 -- (-2308.931) [-2318.615] (-2313.419) (-2307.719) * (-2312.570) (-2319.975) (-2307.857) [-2299.032] -- 0:01:31
708500 -- [-2305.212] (-2316.755) (-2297.630) (-2296.530) * (-2307.144) [-2299.519] (-2304.677) (-2310.699) -- 0:01:31
709000 -- (-2305.423) [-2306.445] (-2301.559) (-2306.824) * (-2302.619) (-2317.800) (-2302.378) [-2312.248] -- 0:01:31
709500 -- (-2312.583) (-2304.889) (-2310.176) [-2297.899] * (-2300.896) [-2301.749] (-2316.387) (-2312.251) -- 0:01:30
710000 -- (-2308.358) (-2308.750) (-2311.253) [-2298.009] * (-2309.807) (-2303.852) [-2299.558] (-2322.553) -- 0:01:30
Average standard deviation of split frequencies: 0.010834
710500 -- (-2313.593) (-2302.034) (-2311.061) [-2302.683] * (-2306.010) [-2313.802] (-2315.938) (-2314.313) -- 0:01:30
711000 -- [-2303.418] (-2319.447) (-2317.111) (-2316.374) * (-2302.521) [-2313.887] (-2319.367) (-2315.663) -- 0:01:30
711500 -- (-2319.865) [-2309.081] (-2297.735) (-2314.425) * [-2302.123] (-2305.265) (-2314.644) (-2323.440) -- 0:01:30
712000 -- [-2301.117] (-2312.206) (-2296.901) (-2307.632) * (-2323.452) [-2311.430] (-2312.322) (-2313.763) -- 0:01:30
712500 -- (-2309.426) (-2311.780) (-2300.520) [-2297.809] * (-2309.643) (-2310.046) [-2309.444] (-2308.648) -- 0:01:29
713000 -- [-2304.708] (-2305.286) (-2312.603) (-2302.456) * (-2304.026) [-2315.871] (-2303.627) (-2310.059) -- 0:01:29
713500 -- (-2312.868) [-2296.181] (-2302.658) (-2319.812) * [-2299.087] (-2309.068) (-2311.433) (-2306.523) -- 0:01:29
714000 -- (-2307.256) (-2304.058) [-2293.918] (-2306.109) * [-2303.228] (-2305.810) (-2315.820) (-2304.564) -- 0:01:29
714500 -- (-2310.146) (-2300.885) [-2300.250] (-2313.280) * (-2305.893) [-2305.355] (-2314.017) (-2306.278) -- 0:01:29
715000 -- [-2302.445] (-2305.466) (-2309.473) (-2304.055) * [-2312.506] (-2308.772) (-2302.598) (-2300.262) -- 0:01:29
Average standard deviation of split frequencies: 0.010403
715500 -- (-2301.379) [-2303.142] (-2299.371) (-2302.436) * [-2296.639] (-2306.566) (-2312.443) (-2310.160) -- 0:01:29
716000 -- [-2301.941] (-2303.848) (-2304.836) (-2306.786) * (-2314.843) (-2306.372) [-2305.765] (-2326.411) -- 0:01:28
716500 -- [-2308.333] (-2311.001) (-2297.781) (-2312.115) * (-2315.623) (-2309.307) [-2302.602] (-2304.142) -- 0:01:28
717000 -- (-2308.093) (-2309.540) (-2305.274) [-2307.586] * (-2311.677) (-2305.504) [-2297.979] (-2306.526) -- 0:01:28
717500 -- (-2305.636) (-2309.170) [-2304.699] (-2308.539) * (-2320.372) [-2302.537] (-2304.508) (-2312.337) -- 0:01:28
718000 -- (-2309.281) (-2302.440) (-2307.192) [-2303.973] * (-2300.924) (-2326.320) (-2330.132) [-2302.363] -- 0:01:28
718500 -- [-2300.463] (-2305.071) (-2318.775) (-2304.510) * [-2309.534] (-2300.471) (-2310.867) (-2305.466) -- 0:01:28
719000 -- (-2319.455) (-2310.985) (-2300.790) [-2304.742] * (-2319.673) [-2302.370] (-2319.753) (-2308.013) -- 0:01:27
719500 -- (-2311.759) (-2306.017) (-2309.014) [-2295.049] * [-2307.767] (-2310.561) (-2317.986) (-2301.721) -- 0:01:27
720000 -- (-2306.663) [-2306.218] (-2314.577) (-2311.461) * (-2315.916) (-2301.949) (-2314.811) [-2300.109] -- 0:01:27
Average standard deviation of split frequencies: 0.010858
720500 -- (-2313.376) [-2301.828] (-2308.654) (-2303.642) * [-2303.457] (-2308.737) (-2306.896) (-2298.588) -- 0:01:27
721000 -- (-2296.449) (-2312.204) [-2304.759] (-2311.496) * [-2307.588] (-2314.943) (-2309.587) (-2306.670) -- 0:01:27
721500 -- (-2311.070) (-2305.154) (-2308.159) [-2308.928] * [-2294.528] (-2299.797) (-2306.771) (-2321.362) -- 0:01:27
722000 -- (-2311.549) (-2310.288) [-2295.408] (-2323.013) * [-2300.680] (-2305.956) (-2304.540) (-2311.821) -- 0:01:27
722500 -- [-2319.079] (-2319.087) (-2312.184) (-2304.868) * [-2309.777] (-2303.439) (-2311.649) (-2309.846) -- 0:01:26
723000 -- (-2316.198) [-2312.692] (-2302.567) (-2327.404) * (-2301.765) (-2307.603) [-2306.201] (-2305.377) -- 0:01:26
723500 -- (-2304.703) [-2303.466] (-2320.705) (-2304.759) * [-2300.050] (-2310.245) (-2308.659) (-2299.644) -- 0:01:26
724000 -- [-2307.615] (-2305.755) (-2305.658) (-2325.985) * (-2307.329) (-2332.229) (-2305.748) [-2305.842] -- 0:01:26
724500 -- (-2297.295) (-2308.066) [-2305.592] (-2316.508) * [-2307.830] (-2313.615) (-2309.543) (-2297.747) -- 0:01:26
725000 -- (-2316.160) (-2316.096) [-2310.292] (-2310.654) * [-2304.383] (-2301.838) (-2319.580) (-2307.893) -- 0:01:26
Average standard deviation of split frequencies: 0.010995
725500 -- (-2310.491) [-2307.293] (-2306.399) (-2309.667) * (-2312.220) (-2300.766) [-2307.102] (-2305.547) -- 0:01:25
726000 -- (-2311.395) (-2315.545) (-2306.318) [-2302.435] * (-2312.390) [-2303.639] (-2302.846) (-2312.451) -- 0:01:25
726500 -- [-2293.890] (-2312.577) (-2310.288) (-2311.211) * (-2304.996) (-2302.180) [-2297.298] (-2308.447) -- 0:01:25
727000 -- (-2314.091) (-2317.733) (-2305.590) [-2312.581] * [-2311.522] (-2321.581) (-2298.832) (-2323.256) -- 0:01:25
727500 -- (-2303.808) (-2323.779) [-2295.761] (-2303.219) * [-2298.866] (-2323.323) (-2310.357) (-2309.894) -- 0:01:25
728000 -- [-2304.896] (-2314.690) (-2302.594) (-2298.572) * [-2312.702] (-2314.439) (-2323.240) (-2310.306) -- 0:01:25
728500 -- (-2308.674) (-2313.972) (-2303.638) [-2304.386] * (-2316.985) [-2305.971] (-2307.201) (-2311.918) -- 0:01:24
729000 -- (-2306.683) (-2301.717) (-2304.541) [-2306.149] * (-2305.489) [-2304.882] (-2303.516) (-2312.894) -- 0:01:24
729500 -- (-2310.037) (-2308.447) (-2305.289) [-2306.505] * [-2300.646] (-2303.010) (-2314.791) (-2318.738) -- 0:01:24
730000 -- (-2315.475) (-2311.148) [-2307.897] (-2307.452) * (-2305.737) [-2312.084] (-2320.424) (-2316.266) -- 0:01:24
Average standard deviation of split frequencies: 0.010925
730500 -- (-2306.288) (-2319.360) [-2300.329] (-2320.231) * (-2319.472) [-2305.425] (-2306.162) (-2318.524) -- 0:01:24
731000 -- (-2300.888) (-2312.912) [-2300.657] (-2317.803) * (-2313.585) [-2298.030] (-2311.614) (-2301.505) -- 0:01:23
731500 -- (-2306.258) (-2325.885) [-2297.522] (-2313.549) * (-2317.081) (-2304.850) (-2304.645) [-2299.963] -- 0:01:24
732000 -- (-2303.379) [-2306.672] (-2312.515) (-2312.569) * (-2304.126) [-2303.517] (-2314.096) (-2303.522) -- 0:01:23
732500 -- (-2311.447) [-2302.126] (-2313.571) (-2317.031) * (-2310.412) (-2297.624) (-2311.483) [-2301.922] -- 0:01:23
733000 -- [-2301.126] (-2311.465) (-2308.987) (-2308.913) * [-2322.348] (-2309.793) (-2306.013) (-2297.245) -- 0:01:23
733500 -- [-2301.197] (-2301.624) (-2300.701) (-2319.530) * (-2313.371) (-2306.336) (-2306.659) [-2308.236] -- 0:01:23
734000 -- (-2305.852) (-2313.959) [-2302.285] (-2321.336) * (-2305.965) [-2308.260] (-2313.158) (-2301.553) -- 0:01:22
734500 -- (-2304.393) (-2312.100) [-2301.687] (-2310.188) * (-2311.047) [-2302.148] (-2326.899) (-2308.362) -- 0:01:22
735000 -- (-2309.099) [-2302.528] (-2308.812) (-2307.223) * [-2315.262] (-2307.369) (-2316.574) (-2305.740) -- 0:01:22
Average standard deviation of split frequencies: 0.011444
735500 -- (-2311.701) (-2317.744) [-2313.700] (-2309.697) * (-2319.798) (-2310.284) [-2307.190] (-2301.214) -- 0:01:22
736000 -- [-2313.847] (-2307.646) (-2323.199) (-2311.333) * (-2304.035) (-2311.109) (-2309.276) [-2303.871] -- 0:01:22
736500 -- (-2320.111) [-2304.133] (-2315.080) (-2316.522) * (-2315.310) (-2315.867) (-2312.706) [-2305.861] -- 0:01:22
737000 -- [-2310.310] (-2302.646) (-2303.154) (-2306.834) * (-2311.455) (-2312.660) [-2307.459] (-2310.902) -- 0:01:22
737500 -- (-2314.574) (-2322.516) [-2310.330] (-2302.033) * [-2306.258] (-2309.786) (-2322.112) (-2303.560) -- 0:01:22
738000 -- (-2301.594) (-2312.328) (-2304.016) [-2308.794] * (-2307.767) [-2307.759] (-2322.706) (-2309.820) -- 0:01:22
738500 -- (-2306.533) (-2307.406) (-2304.631) [-2302.655] * (-2308.190) (-2304.886) (-2316.153) [-2302.176] -- 0:01:21
739000 -- (-2309.001) (-2315.526) [-2304.408] (-2308.655) * (-2314.310) (-2304.168) [-2322.012] (-2318.994) -- 0:01:21
739500 -- (-2307.141) [-2300.386] (-2306.104) (-2317.202) * (-2300.328) (-2311.103) [-2305.159] (-2313.293) -- 0:01:21
740000 -- (-2319.790) (-2318.035) [-2298.453] (-2315.314) * (-2321.631) (-2306.787) [-2315.802] (-2306.192) -- 0:01:21
Average standard deviation of split frequencies: 0.010990
740500 -- (-2302.039) [-2311.294] (-2308.086) (-2318.850) * (-2305.616) [-2304.823] (-2302.903) (-2311.657) -- 0:01:21
741000 -- [-2297.328] (-2305.222) (-2308.802) (-2298.288) * (-2304.871) (-2306.507) (-2308.966) [-2305.830] -- 0:01:21
741500 -- (-2304.054) (-2307.517) (-2305.702) [-2305.956] * (-2309.126) [-2302.292] (-2317.098) (-2319.077) -- 0:01:20
742000 -- (-2308.938) (-2307.090) (-2321.132) [-2312.474] * [-2299.579] (-2303.364) (-2311.350) (-2326.169) -- 0:01:20
742500 -- (-2312.005) (-2314.605) [-2309.491] (-2299.896) * (-2323.847) (-2309.692) [-2310.197] (-2310.106) -- 0:01:20
743000 -- (-2316.448) (-2307.500) [-2307.091] (-2302.695) * (-2310.086) (-2310.532) (-2308.689) [-2306.685] -- 0:01:20
743500 -- [-2305.046] (-2308.593) (-2301.495) (-2306.856) * (-2330.276) (-2318.545) [-2307.530] (-2299.317) -- 0:01:20
744000 -- [-2308.164] (-2311.577) (-2304.759) (-2312.229) * (-2300.088) [-2299.177] (-2305.887) (-2315.872) -- 0:01:20
744500 -- [-2301.603] (-2309.139) (-2301.377) (-2315.479) * [-2298.859] (-2305.887) (-2300.554) (-2310.426) -- 0:01:19
745000 -- (-2312.762) (-2309.658) (-2304.405) [-2302.754] * (-2315.222) [-2298.442] (-2309.207) (-2316.842) -- 0:01:19
Average standard deviation of split frequencies: 0.011290
745500 -- (-2316.263) [-2295.132] (-2310.709) (-2321.527) * [-2312.197] (-2308.081) (-2302.324) (-2309.164) -- 0:01:19
746000 -- (-2308.809) (-2311.354) (-2307.123) [-2301.258] * (-2305.473) (-2310.940) [-2307.936] (-2307.463) -- 0:01:19
746500 -- (-2303.073) (-2315.976) (-2304.009) [-2304.574] * (-2314.535) [-2312.158] (-2312.388) (-2302.051) -- 0:01:19
747000 -- (-2314.366) (-2314.341) [-2300.443] (-2305.931) * (-2302.852) (-2306.133) (-2305.772) [-2299.464] -- 0:01:19
747500 -- [-2314.174] (-2309.433) (-2302.778) (-2315.336) * (-2313.504) (-2308.423) (-2312.567) [-2305.489] -- 0:01:19
748000 -- [-2309.316] (-2310.489) (-2315.270) (-2317.277) * (-2313.065) (-2317.558) [-2302.806] (-2310.882) -- 0:01:18
748500 -- [-2295.472] (-2321.658) (-2308.939) (-2309.564) * (-2309.792) (-2310.946) (-2305.004) [-2298.577] -- 0:01:18
749000 -- [-2305.901] (-2310.083) (-2304.080) (-2302.630) * (-2305.768) (-2312.505) [-2297.421] (-2309.177) -- 0:01:18
749500 -- (-2311.896) (-2316.218) [-2304.778] (-2307.922) * (-2310.021) (-2321.642) [-2300.917] (-2309.422) -- 0:01:18
750000 -- (-2320.419) (-2305.534) (-2312.544) [-2307.289] * [-2307.025] (-2321.304) (-2301.680) (-2307.749) -- 0:01:18
Average standard deviation of split frequencies: 0.010927
750500 -- [-2310.307] (-2306.197) (-2309.655) (-2320.826) * (-2315.900) (-2310.112) (-2314.062) [-2303.477] -- 0:01:18
751000 -- (-2307.703) [-2306.732] (-2319.931) (-2308.320) * [-2311.648] (-2298.398) (-2313.748) (-2309.757) -- 0:01:17
751500 -- [-2299.048] (-2305.051) (-2307.656) (-2302.896) * (-2313.336) (-2312.655) (-2311.491) [-2300.121] -- 0:01:17
752000 -- [-2300.306] (-2306.058) (-2304.760) (-2313.524) * [-2310.407] (-2304.122) (-2311.175) (-2325.029) -- 0:01:17
752500 -- (-2299.774) (-2304.997) (-2304.204) [-2300.648] * (-2304.805) (-2313.648) [-2306.203] (-2302.253) -- 0:01:17
753000 -- [-2302.819] (-2326.853) (-2306.159) (-2313.492) * (-2312.618) [-2298.175] (-2307.968) (-2311.859) -- 0:01:17
753500 -- [-2304.212] (-2320.115) (-2310.271) (-2305.148) * (-2308.655) (-2300.223) [-2296.828] (-2312.344) -- 0:01:17
754000 -- (-2302.974) (-2308.460) (-2306.827) [-2311.666] * (-2305.679) [-2300.138] (-2300.791) (-2317.488) -- 0:01:16
754500 -- [-2304.293] (-2309.984) (-2311.881) (-2317.125) * (-2313.500) (-2310.887) (-2313.899) [-2314.443] -- 0:01:16
755000 -- [-2313.446] (-2303.035) (-2319.265) (-2306.758) * (-2315.817) (-2311.929) [-2305.050] (-2314.027) -- 0:01:16
Average standard deviation of split frequencies: 0.010891
755500 -- (-2308.646) (-2308.252) [-2305.159] (-2303.483) * (-2305.190) (-2308.364) (-2298.942) [-2307.624] -- 0:01:16
756000 -- [-2319.313] (-2303.049) (-2294.429) (-2314.738) * (-2301.228) [-2305.180] (-2306.957) (-2314.450) -- 0:01:16
756500 -- (-2308.843) (-2304.375) [-2313.175] (-2315.432) * [-2301.003] (-2318.118) (-2307.737) (-2302.772) -- 0:01:16
757000 -- (-2311.439) (-2308.000) [-2303.611] (-2311.114) * (-2308.484) (-2313.168) (-2308.756) [-2311.394] -- 0:01:16
757500 -- (-2318.021) (-2308.545) [-2296.535] (-2308.064) * (-2310.153) (-2311.404) [-2299.789] (-2303.910) -- 0:01:15
758000 -- (-2310.894) (-2307.231) (-2300.153) [-2305.744] * (-2314.973) (-2320.135) [-2307.018] (-2310.640) -- 0:01:15
758500 -- (-2310.652) [-2297.621] (-2316.905) (-2304.202) * (-2312.256) (-2308.987) [-2311.859] (-2302.278) -- 0:01:15
759000 -- (-2298.880) (-2307.155) [-2301.286] (-2309.277) * (-2310.594) (-2306.493) (-2313.440) [-2302.576] -- 0:01:15
759500 -- (-2317.135) [-2306.231] (-2304.104) (-2307.244) * [-2304.215] (-2298.411) (-2314.801) (-2311.964) -- 0:01:15
760000 -- (-2319.388) (-2316.430) (-2298.617) [-2300.582] * (-2308.546) (-2302.030) (-2311.177) [-2307.631] -- 0:01:15
Average standard deviation of split frequencies: 0.010287
760500 -- (-2301.353) (-2315.998) [-2303.821] (-2309.888) * (-2314.094) [-2307.249] (-2316.919) (-2304.072) -- 0:01:14
761000 -- (-2306.920) (-2325.630) (-2313.522) [-2300.354] * (-2330.047) (-2311.283) [-2304.414] (-2310.697) -- 0:01:14
761500 -- (-2308.536) (-2303.780) (-2303.884) [-2313.584] * (-2306.527) (-2303.355) [-2305.781] (-2307.797) -- 0:01:14
762000 -- (-2308.214) [-2299.151] (-2310.126) (-2309.806) * (-2312.346) (-2305.930) [-2297.832] (-2309.202) -- 0:01:14
762500 -- [-2296.745] (-2314.134) (-2299.750) (-2307.177) * [-2307.704] (-2306.094) (-2319.116) (-2315.766) -- 0:01:14
763000 -- (-2307.129) (-2305.699) (-2319.474) [-2314.500] * (-2317.119) (-2308.111) (-2314.317) [-2308.281] -- 0:01:14
763500 -- (-2303.009) (-2306.337) (-2326.894) [-2297.548] * (-2311.678) [-2304.756] (-2316.976) (-2310.401) -- 0:01:14
764000 -- (-2306.263) [-2309.189] (-2310.858) (-2316.068) * (-2307.216) [-2309.895] (-2314.281) (-2317.112) -- 0:01:13
764500 -- [-2304.542] (-2320.299) (-2307.462) (-2300.757) * (-2315.394) (-2317.050) (-2307.394) [-2317.077] -- 0:01:13
765000 -- (-2311.223) (-2313.609) [-2301.455] (-2307.216) * (-2311.963) [-2305.853] (-2303.656) (-2318.620) -- 0:01:13
Average standard deviation of split frequencies: 0.010462
765500 -- (-2304.886) (-2305.535) [-2302.331] (-2303.787) * (-2298.876) (-2317.995) [-2299.430] (-2298.441) -- 0:01:13
766000 -- (-2314.141) [-2303.241] (-2305.052) (-2312.228) * [-2304.119] (-2326.498) (-2304.453) (-2307.341) -- 0:01:13
766500 -- (-2308.514) (-2297.650) [-2300.062] (-2307.895) * (-2309.340) (-2329.361) (-2300.474) [-2303.838] -- 0:01:13
767000 -- (-2309.305) (-2308.811) (-2304.338) [-2307.034] * (-2305.722) (-2315.150) (-2316.886) [-2312.325] -- 0:01:12
767500 -- (-2316.129) (-2302.835) (-2318.197) [-2302.482] * (-2311.867) (-2318.598) (-2320.990) [-2304.840] -- 0:01:12
768000 -- (-2311.448) [-2300.880] (-2316.751) (-2307.792) * (-2312.834) (-2310.400) (-2306.969) [-2307.889] -- 0:01:12
768500 -- (-2305.168) [-2314.338] (-2304.847) (-2309.580) * [-2298.154] (-2317.799) (-2312.030) (-2298.757) -- 0:01:12
769000 -- (-2304.328) (-2302.159) (-2308.834) [-2305.404] * (-2322.538) (-2312.217) (-2304.816) [-2303.054] -- 0:01:12
769500 -- (-2308.230) (-2313.686) (-2301.220) [-2302.813] * (-2311.607) (-2309.264) (-2311.093) [-2308.319] -- 0:01:12
770000 -- (-2307.066) (-2308.934) [-2299.964] (-2304.682) * (-2316.952) (-2323.404) [-2309.905] (-2301.849) -- 0:01:11
Average standard deviation of split frequencies: 0.010766
770500 -- (-2321.894) (-2309.029) [-2302.820] (-2313.719) * (-2312.676) [-2302.841] (-2311.886) (-2312.671) -- 0:01:11
771000 -- [-2308.654] (-2311.296) (-2302.162) (-2313.471) * (-2312.226) (-2307.527) [-2303.544] (-2312.245) -- 0:01:11
771500 -- (-2303.916) [-2301.389] (-2317.113) (-2304.569) * (-2304.359) (-2305.762) (-2314.172) [-2310.233] -- 0:01:11
772000 -- (-2304.882) [-2305.679] (-2303.059) (-2308.185) * (-2306.231) (-2321.851) (-2300.700) [-2299.642] -- 0:01:11
772500 -- (-2307.789) (-2310.053) [-2297.920] (-2302.622) * (-2313.602) (-2316.854) [-2302.698] (-2298.560) -- 0:01:11
773000 -- (-2302.687) (-2320.475) (-2300.260) [-2299.218] * [-2302.045] (-2306.804) (-2314.277) (-2326.184) -- 0:01:11
773500 -- (-2303.903) [-2307.038] (-2308.555) (-2305.392) * (-2317.137) (-2309.442) [-2305.568] (-2302.373) -- 0:01:10
774000 -- [-2296.663] (-2307.721) (-2308.078) (-2313.852) * (-2309.713) (-2305.484) [-2304.240] (-2315.638) -- 0:01:10
774500 -- (-2309.721) (-2319.429) [-2302.876] (-2313.445) * [-2302.685] (-2317.547) (-2308.604) (-2312.499) -- 0:01:10
775000 -- [-2308.936] (-2323.107) (-2308.664) (-2304.116) * [-2302.173] (-2320.371) (-2306.309) (-2309.894) -- 0:01:10
Average standard deviation of split frequencies: 0.010813
775500 -- (-2301.808) (-2297.960) (-2310.455) [-2306.649] * [-2299.577] (-2305.815) (-2310.668) (-2311.911) -- 0:01:10
776000 -- (-2310.714) [-2311.026] (-2308.880) (-2306.485) * (-2304.841) [-2303.597] (-2303.694) (-2305.133) -- 0:01:10
776500 -- (-2306.162) (-2310.218) (-2301.073) [-2302.779] * (-2310.755) [-2299.370] (-2306.017) (-2309.745) -- 0:01:09
777000 -- [-2295.898] (-2303.918) (-2310.808) (-2313.123) * (-2313.657) (-2312.625) [-2301.625] (-2305.907) -- 0:01:09
777500 -- (-2310.727) (-2308.522) (-2314.742) [-2303.642] * (-2301.680) [-2305.847] (-2297.747) (-2314.432) -- 0:01:09
778000 -- (-2313.705) [-2305.940] (-2310.098) (-2317.939) * [-2302.802] (-2318.439) (-2318.071) (-2302.963) -- 0:01:09
778500 -- [-2309.996] (-2296.931) (-2302.209) (-2315.890) * (-2319.844) (-2307.515) (-2313.917) [-2308.471] -- 0:01:09
779000 -- (-2303.890) [-2302.425] (-2309.261) (-2312.594) * (-2308.776) (-2316.010) (-2320.576) [-2300.863] -- 0:01:08
779500 -- (-2323.523) (-2311.931) (-2307.958) [-2301.090] * [-2311.680] (-2317.724) (-2307.940) (-2305.417) -- 0:01:08
780000 -- (-2308.797) (-2306.491) (-2311.899) [-2302.326] * [-2313.297] (-2313.644) (-2306.637) (-2305.429) -- 0:01:08
Average standard deviation of split frequencies: 0.009501
780500 -- (-2307.643) [-2297.695] (-2312.960) (-2311.978) * (-2305.085) (-2309.069) [-2297.462] (-2308.859) -- 0:01:08
781000 -- (-2313.333) (-2307.608) (-2318.377) [-2305.518] * (-2300.486) (-2302.902) [-2294.818] (-2302.426) -- 0:01:08
781500 -- [-2304.325] (-2312.963) (-2311.014) (-2308.708) * (-2303.552) [-2314.930] (-2302.771) (-2311.165) -- 0:01:08
782000 -- [-2305.948] (-2309.316) (-2303.548) (-2318.753) * (-2315.479) (-2298.055) (-2299.580) [-2302.624] -- 0:01:08
782500 -- [-2314.931] (-2325.284) (-2307.667) (-2296.820) * (-2328.546) [-2301.049] (-2307.121) (-2303.456) -- 0:01:07
783000 -- (-2313.750) (-2308.201) [-2304.055] (-2302.377) * (-2316.796) [-2304.587] (-2319.102) (-2311.882) -- 0:01:07
783500 -- (-2313.915) [-2299.185] (-2313.076) (-2306.750) * [-2302.887] (-2306.005) (-2301.977) (-2312.523) -- 0:01:07
784000 -- (-2309.203) (-2301.489) [-2310.788] (-2321.296) * (-2307.563) (-2299.768) [-2308.110] (-2299.201) -- 0:01:07
784500 -- (-2308.914) (-2310.602) (-2306.021) [-2309.407] * (-2309.789) (-2304.186) [-2302.583] (-2309.883) -- 0:01:07
785000 -- (-2310.679) [-2297.916] (-2306.357) (-2323.207) * (-2320.598) (-2303.956) [-2307.581] (-2316.799) -- 0:01:07
Average standard deviation of split frequencies: 0.009156
785500 -- [-2306.895] (-2315.626) (-2314.522) (-2307.158) * (-2330.231) (-2310.187) [-2300.667] (-2308.402) -- 0:01:06
786000 -- (-2315.109) (-2309.085) [-2299.161] (-2313.049) * (-2300.216) (-2305.019) [-2299.239] (-2307.283) -- 0:01:06
786500 -- (-2307.814) (-2313.553) [-2304.552] (-2301.459) * (-2312.041) (-2320.481) [-2300.832] (-2301.560) -- 0:01:06
787000 -- (-2306.589) (-2312.836) (-2305.437) [-2298.454] * [-2310.964] (-2316.381) (-2313.296) (-2305.619) -- 0:01:06
787500 -- (-2308.679) (-2300.853) [-2300.058] (-2305.873) * [-2302.955] (-2307.714) (-2305.291) (-2307.061) -- 0:01:06
788000 -- [-2303.561] (-2313.944) (-2312.036) (-2310.842) * (-2325.466) (-2300.792) [-2307.364] (-2299.891) -- 0:01:06
788500 -- (-2301.577) [-2312.885] (-2316.647) (-2302.401) * (-2321.713) (-2307.841) (-2310.656) [-2298.470] -- 0:01:05
789000 -- (-2305.786) (-2313.240) [-2305.714] (-2308.279) * (-2304.116) [-2307.102] (-2317.311) (-2314.115) -- 0:01:05
789500 -- (-2311.704) (-2309.597) (-2311.795) [-2300.023] * (-2304.948) (-2309.502) [-2294.817] (-2324.824) -- 0:01:05
790000 -- (-2307.245) (-2315.737) (-2312.087) [-2301.885] * (-2305.889) (-2309.935) [-2298.400] (-2316.307) -- 0:01:05
Average standard deviation of split frequencies: 0.009221
790500 -- (-2296.639) (-2307.072) (-2321.942) [-2304.992] * (-2304.478) (-2317.885) (-2308.255) [-2300.915] -- 0:01:05
791000 -- (-2302.864) [-2309.304] (-2302.593) (-2318.346) * (-2303.242) [-2316.658] (-2300.146) (-2314.738) -- 0:01:05
791500 -- (-2300.725) [-2310.946] (-2310.056) (-2308.109) * (-2314.534) (-2313.784) [-2312.492] (-2311.929) -- 0:01:05
792000 -- (-2309.830) [-2305.853] (-2312.316) (-2310.852) * (-2299.967) [-2300.592] (-2322.487) (-2305.010) -- 0:01:04
792500 -- (-2306.845) (-2316.415) (-2312.150) [-2306.602] * (-2305.039) (-2303.261) [-2309.609] (-2303.974) -- 0:01:04
793000 -- [-2309.356] (-2310.815) (-2321.586) (-2308.913) * (-2318.315) (-2304.340) [-2307.049] (-2315.840) -- 0:01:04
793500 -- (-2313.499) [-2302.459] (-2316.482) (-2297.556) * (-2317.326) (-2302.616) (-2308.247) [-2304.863] -- 0:01:04
794000 -- (-2304.775) (-2306.227) [-2307.353] (-2306.228) * (-2312.328) (-2309.876) [-2306.340] (-2309.701) -- 0:01:04
794500 -- [-2310.812] (-2313.051) (-2304.545) (-2316.884) * (-2317.379) (-2306.887) [-2296.108] (-2315.315) -- 0:01:04
795000 -- (-2309.841) (-2302.127) (-2307.353) [-2297.022] * (-2306.228) [-2304.506] (-2310.532) (-2314.469) -- 0:01:03
Average standard deviation of split frequencies: 0.008488
795500 -- [-2298.398] (-2303.784) (-2313.419) (-2316.394) * (-2312.904) (-2309.160) [-2316.011] (-2316.782) -- 0:01:03
796000 -- (-2310.983) [-2305.441] (-2306.885) (-2317.379) * (-2311.157) [-2297.141] (-2321.942) (-2313.692) -- 0:01:03
796500 -- (-2313.701) (-2306.107) [-2313.818] (-2320.136) * (-2308.621) [-2300.553] (-2323.459) (-2298.591) -- 0:01:03
797000 -- [-2306.094] (-2309.506) (-2314.859) (-2312.539) * (-2306.730) [-2306.693] (-2319.220) (-2318.051) -- 0:01:03
797500 -- (-2315.761) (-2306.701) (-2320.185) [-2308.661] * (-2310.648) (-2329.472) (-2316.274) [-2306.880] -- 0:01:03
798000 -- (-2319.415) [-2300.743] (-2308.632) (-2304.609) * (-2309.730) (-2315.732) (-2300.736) [-2302.789] -- 0:01:03
798500 -- (-2309.947) (-2315.821) (-2310.974) [-2311.481] * (-2316.055) (-2316.776) (-2308.710) [-2298.740] -- 0:01:02
799000 -- (-2317.926) (-2303.636) [-2300.142] (-2312.255) * (-2303.234) (-2303.971) [-2301.935] (-2303.386) -- 0:01:02
799500 -- (-2317.710) (-2309.318) [-2310.968] (-2317.446) * [-2295.920] (-2301.430) (-2309.420) (-2310.350) -- 0:01:02
800000 -- (-2307.491) (-2313.457) [-2306.178] (-2332.452) * [-2293.701] (-2308.402) (-2302.749) (-2308.593) -- 0:01:02
Average standard deviation of split frequencies: 0.007732
800500 -- (-2308.901) (-2306.460) [-2306.610] (-2321.721) * (-2308.331) [-2306.252] (-2305.132) (-2301.349) -- 0:01:02
801000 -- [-2303.287] (-2309.220) (-2298.499) (-2304.572) * [-2302.894] (-2301.529) (-2302.507) (-2306.267) -- 0:01:02
801500 -- [-2299.764] (-2297.444) (-2304.052) (-2301.216) * (-2313.462) [-2301.190] (-2302.269) (-2308.678) -- 0:01:01
802000 -- (-2300.756) (-2311.384) [-2306.022] (-2312.671) * (-2305.133) (-2301.685) (-2304.323) [-2307.979] -- 0:01:01
802500 -- (-2312.302) (-2299.296) [-2295.137] (-2302.873) * (-2302.562) [-2308.182] (-2308.623) (-2306.882) -- 0:01:01
803000 -- [-2311.708] (-2304.289) (-2307.002) (-2310.041) * (-2302.087) [-2307.672] (-2318.923) (-2315.355) -- 0:01:01
803500 -- (-2310.399) (-2310.006) [-2305.789] (-2317.817) * (-2306.593) (-2304.896) (-2308.265) [-2305.536] -- 0:01:01
804000 -- (-2300.545) [-2313.495] (-2305.970) (-2315.648) * [-2307.255] (-2307.581) (-2311.771) (-2314.634) -- 0:01:00
804500 -- [-2314.246] (-2297.873) (-2335.103) (-2307.697) * (-2307.376) (-2319.313) [-2299.516] (-2317.475) -- 0:01:00
805000 -- (-2303.830) [-2312.469] (-2328.282) (-2320.139) * (-2311.044) [-2305.872] (-2298.963) (-2299.746) -- 0:01:00
Average standard deviation of split frequencies: 0.008149
805500 -- (-2311.582) [-2303.759] (-2318.862) (-2309.832) * (-2314.152) [-2302.621] (-2316.398) (-2309.605) -- 0:01:00
806000 -- (-2308.692) [-2307.685] (-2307.268) (-2301.188) * (-2307.868) (-2310.287) [-2307.189] (-2299.490) -- 0:01:00
806500 -- (-2306.120) (-2310.704) [-2305.985] (-2306.006) * (-2312.903) (-2308.834) [-2298.348] (-2318.551) -- 0:01:00
807000 -- (-2300.398) [-2309.619] (-2298.809) (-2306.542) * [-2307.560] (-2306.648) (-2303.903) (-2310.385) -- 0:01:00
807500 -- (-2306.834) (-2305.830) (-2304.927) [-2306.752] * (-2305.220) (-2309.601) (-2302.401) [-2303.435] -- 0:00:59
808000 -- (-2315.741) (-2309.392) (-2299.815) [-2302.191] * (-2306.931) (-2314.676) [-2308.765] (-2302.145) -- 0:00:59
808500 -- (-2310.347) (-2326.348) [-2304.456] (-2312.841) * (-2312.383) (-2312.776) (-2304.874) [-2306.311] -- 0:00:59
809000 -- [-2312.809] (-2304.361) (-2297.375) (-2308.407) * [-2303.491] (-2315.562) (-2308.784) (-2311.167) -- 0:00:59
809500 -- (-2325.303) [-2309.366] (-2307.623) (-2300.175) * [-2305.387] (-2301.842) (-2304.952) (-2317.401) -- 0:00:59
810000 -- (-2323.371) [-2304.617] (-2311.003) (-2309.585) * (-2315.394) (-2313.613) (-2300.590) [-2304.836] -- 0:00:59
Average standard deviation of split frequencies: 0.007637
810500 -- (-2317.129) (-2319.980) (-2311.621) [-2309.210] * (-2306.742) (-2311.160) (-2302.048) [-2302.012] -- 0:00:58
811000 -- [-2300.782] (-2311.897) (-2300.653) (-2311.725) * (-2313.291) (-2313.281) [-2307.619] (-2311.169) -- 0:00:58
811500 -- (-2310.081) (-2313.346) (-2300.775) [-2315.997] * (-2326.208) (-2310.080) (-2320.166) [-2299.971] -- 0:00:58
812000 -- (-2311.731) (-2322.939) [-2301.133] (-2305.091) * (-2315.900) [-2310.502] (-2318.227) (-2307.151) -- 0:00:58
812500 -- (-2320.635) [-2306.625] (-2310.963) (-2315.649) * (-2309.814) (-2316.603) [-2309.066] (-2304.579) -- 0:00:58
813000 -- [-2309.754] (-2308.809) (-2310.641) (-2307.798) * (-2309.405) (-2318.558) (-2325.356) [-2297.932] -- 0:00:58
813500 -- (-2308.269) [-2311.193] (-2306.535) (-2305.460) * (-2327.398) (-2312.893) (-2303.416) [-2300.209] -- 0:00:58
814000 -- [-2306.647] (-2306.427) (-2310.426) (-2320.319) * (-2314.952) (-2303.761) [-2312.642] (-2315.569) -- 0:00:58
814500 -- (-2311.595) [-2308.662] (-2308.624) (-2318.358) * (-2300.129) (-2307.701) [-2305.828] (-2318.104) -- 0:00:57
815000 -- (-2301.696) [-2300.570] (-2309.480) (-2299.552) * (-2310.193) (-2309.640) [-2299.881] (-2312.275) -- 0:00:57
Average standard deviation of split frequencies: 0.007626
815500 -- (-2315.257) (-2312.587) (-2306.200) [-2311.239] * [-2302.572] (-2323.593) (-2311.229) (-2303.521) -- 0:00:57
816000 -- (-2307.845) (-2312.240) [-2301.506] (-2307.377) * (-2308.429) (-2313.478) (-2313.194) [-2303.856] -- 0:00:57
816500 -- (-2296.717) (-2318.007) [-2303.362] (-2316.357) * (-2297.865) (-2305.350) (-2308.785) [-2297.768] -- 0:00:57
817000 -- [-2300.303] (-2309.730) (-2311.783) (-2315.526) * (-2309.532) (-2310.729) [-2305.508] (-2312.248) -- 0:00:57
817500 -- (-2301.671) [-2303.093] (-2321.364) (-2306.973) * (-2306.636) (-2313.536) [-2309.782] (-2300.717) -- 0:00:56
818000 -- (-2311.216) [-2302.734] (-2307.979) (-2305.521) * (-2305.791) (-2308.400) (-2315.251) [-2303.974] -- 0:00:56
818500 -- (-2310.770) (-2316.256) (-2316.291) [-2305.228] * (-2304.089) (-2302.753) [-2305.512] (-2298.483) -- 0:00:56
819000 -- (-2312.251) (-2315.411) (-2313.394) [-2308.978] * (-2310.425) (-2307.048) (-2309.239) [-2301.042] -- 0:00:56
819500 -- (-2322.053) (-2317.740) [-2300.379] (-2313.238) * [-2300.350] (-2313.255) (-2313.727) (-2305.719) -- 0:00:56
820000 -- (-2311.794) (-2307.275) [-2300.955] (-2306.337) * (-2312.553) (-2316.443) [-2311.183] (-2309.815) -- 0:00:55
Average standard deviation of split frequencies: 0.007084
820500 -- (-2328.193) (-2313.376) [-2300.817] (-2299.796) * (-2305.416) (-2317.548) [-2301.354] (-2318.552) -- 0:00:56
821000 -- (-2309.802) (-2309.025) (-2320.159) [-2304.430] * (-2298.433) (-2313.935) [-2302.511] (-2324.725) -- 0:00:55
821500 -- (-2316.209) (-2304.760) (-2305.376) [-2301.771] * (-2306.931) (-2312.368) (-2302.195) [-2310.241] -- 0:00:55
822000 -- (-2307.603) (-2306.752) (-2309.202) [-2299.138] * [-2301.545] (-2305.040) (-2299.835) (-2304.190) -- 0:00:55
822500 -- (-2308.966) (-2308.484) (-2318.335) [-2313.069] * (-2316.630) (-2307.434) (-2313.201) [-2300.009] -- 0:00:55
823000 -- [-2303.092] (-2319.709) (-2304.073) (-2310.312) * (-2302.101) (-2311.292) (-2306.979) [-2304.236] -- 0:00:55
823500 -- [-2302.526] (-2306.551) (-2304.368) (-2324.888) * (-2308.511) (-2311.117) (-2319.501) [-2312.897] -- 0:00:54
824000 -- (-2310.132) [-2303.375] (-2314.398) (-2306.929) * (-2305.875) (-2311.044) [-2296.405] (-2305.525) -- 0:00:54
824500 -- [-2299.923] (-2311.127) (-2305.711) (-2312.746) * (-2301.002) [-2308.690] (-2300.071) (-2313.018) -- 0:00:54
825000 -- [-2301.211] (-2317.309) (-2312.917) (-2311.371) * [-2308.819] (-2317.260) (-2305.190) (-2322.311) -- 0:00:54
Average standard deviation of split frequencies: 0.006088
825500 -- (-2297.932) (-2307.123) (-2311.064) [-2301.951] * (-2303.634) [-2306.469] (-2304.858) (-2306.469) -- 0:00:54
826000 -- (-2302.652) (-2313.836) (-2306.839) [-2297.723] * (-2304.324) (-2307.472) (-2310.153) [-2303.493] -- 0:00:54
826500 -- (-2304.298) (-2326.957) (-2306.450) [-2307.747] * [-2309.109] (-2308.869) (-2308.385) (-2317.190) -- 0:00:53
827000 -- (-2311.883) [-2313.220] (-2309.890) (-2319.567) * (-2307.455) (-2303.429) (-2307.693) [-2308.788] -- 0:00:53
827500 -- (-2309.510) (-2310.914) (-2302.661) [-2304.917] * [-2305.451] (-2301.438) (-2297.303) (-2319.943) -- 0:00:53
828000 -- (-2309.196) (-2306.238) [-2307.516] (-2318.666) * (-2310.767) (-2305.837) [-2311.952] (-2312.378) -- 0:00:53
828500 -- (-2307.621) (-2313.650) (-2315.627) [-2305.093] * (-2304.300) (-2321.344) [-2293.614] (-2303.742) -- 0:00:53
829000 -- [-2298.368] (-2313.796) (-2314.592) (-2305.378) * (-2312.604) (-2312.463) (-2309.100) [-2300.465] -- 0:00:53
829500 -- [-2299.383] (-2322.246) (-2307.942) (-2308.658) * (-2301.661) (-2305.682) (-2317.301) [-2301.388] -- 0:00:53
830000 -- (-2309.118) (-2319.085) (-2306.837) [-2308.538] * (-2312.109) [-2303.997] (-2303.386) (-2302.591) -- 0:00:52
Average standard deviation of split frequencies: 0.006318
830500 -- (-2316.023) (-2309.113) (-2305.514) [-2303.442] * (-2307.984) [-2298.448] (-2305.659) (-2304.908) -- 0:00:52
831000 -- (-2306.757) (-2310.902) (-2308.913) [-2298.823] * (-2302.457) (-2300.548) (-2318.067) [-2305.492] -- 0:00:52
831500 -- (-2308.087) (-2309.604) (-2304.167) [-2300.175] * (-2306.072) [-2296.955] (-2305.238) (-2301.577) -- 0:00:52
832000 -- (-2305.087) [-2297.629] (-2311.762) (-2305.683) * (-2301.480) (-2302.512) [-2314.482] (-2305.190) -- 0:00:52
832500 -- (-2314.554) (-2308.816) (-2313.118) [-2304.539] * (-2318.265) [-2306.561] (-2301.350) (-2302.755) -- 0:00:52
833000 -- (-2309.909) (-2312.360) [-2303.491] (-2315.378) * (-2310.621) [-2303.467] (-2299.761) (-2308.665) -- 0:00:51
833500 -- (-2324.351) (-2304.625) [-2311.065] (-2315.999) * (-2310.882) [-2307.023] (-2300.887) (-2311.714) -- 0:00:51
834000 -- (-2315.086) (-2305.017) [-2300.999] (-2306.331) * [-2301.039] (-2311.903) (-2308.745) (-2313.348) -- 0:00:51
834500 -- (-2320.531) (-2306.643) (-2309.247) [-2304.230] * (-2307.727) (-2313.943) [-2298.753] (-2300.232) -- 0:00:51
835000 -- [-2307.978] (-2302.097) (-2304.600) (-2298.852) * (-2314.745) (-2305.903) [-2303.222] (-2303.540) -- 0:00:51
Average standard deviation of split frequencies: 0.005639
835500 -- (-2303.852) [-2308.435] (-2309.294) (-2306.329) * (-2301.029) (-2300.447) [-2306.284] (-2318.916) -- 0:00:51
836000 -- [-2304.249] (-2308.344) (-2307.659) (-2303.891) * (-2300.050) [-2305.004] (-2306.671) (-2303.030) -- 0:00:51
836500 -- [-2307.238] (-2305.917) (-2311.856) (-2320.286) * (-2302.210) (-2308.031) [-2301.485] (-2303.549) -- 0:00:50
837000 -- (-2312.599) (-2314.503) [-2310.707] (-2322.595) * (-2302.869) (-2313.664) [-2301.581] (-2317.249) -- 0:00:50
837500 -- (-2317.480) (-2315.449) (-2297.780) [-2303.809] * (-2314.239) [-2307.210] (-2300.397) (-2313.841) -- 0:00:50
838000 -- (-2306.300) (-2311.958) (-2301.230) [-2311.835] * (-2306.847) (-2305.211) [-2305.629] (-2312.851) -- 0:00:50
838500 -- [-2306.867] (-2308.365) (-2300.335) (-2320.353) * (-2307.897) (-2305.262) [-2310.935] (-2306.955) -- 0:00:50
839000 -- (-2319.573) (-2306.999) (-2307.950) [-2306.231] * (-2300.648) [-2301.057] (-2311.369) (-2302.359) -- 0:00:50
839500 -- (-2313.193) [-2306.555] (-2307.114) (-2308.109) * (-2298.735) (-2305.357) (-2317.341) [-2303.605] -- 0:00:49
840000 -- (-2306.234) [-2304.355] (-2312.580) (-2303.462) * (-2307.932) (-2306.515) [-2311.938] (-2313.196) -- 0:00:49
Average standard deviation of split frequencies: 0.006692
840500 -- (-2309.051) (-2316.940) (-2311.681) [-2300.120] * (-2297.816) (-2304.745) [-2303.418] (-2310.732) -- 0:00:49
841000 -- [-2303.094] (-2314.299) (-2307.604) (-2317.936) * (-2302.076) (-2305.337) [-2312.104] (-2308.208) -- 0:00:49
841500 -- (-2311.804) [-2296.824] (-2311.640) (-2321.060) * (-2303.275) (-2304.996) (-2314.114) [-2298.017] -- 0:00:49
842000 -- (-2304.050) (-2308.987) [-2304.990] (-2312.594) * [-2296.911] (-2300.992) (-2314.351) (-2304.167) -- 0:00:49
842500 -- [-2299.709] (-2309.001) (-2304.198) (-2306.962) * (-2303.399) [-2306.472] (-2306.763) (-2312.871) -- 0:00:48
843000 -- [-2295.006] (-2311.741) (-2304.541) (-2308.137) * (-2311.998) [-2306.068] (-2302.373) (-2297.427) -- 0:00:48
843500 -- [-2305.879] (-2309.266) (-2297.587) (-2303.497) * (-2310.317) [-2303.761] (-2303.202) (-2311.929) -- 0:00:48
844000 -- (-2304.134) (-2315.280) (-2310.348) [-2305.338] * (-2310.779) (-2313.445) [-2305.787] (-2316.446) -- 0:00:48
844500 -- [-2303.406] (-2311.824) (-2314.974) (-2316.008) * (-2317.643) [-2305.396] (-2307.359) (-2312.238) -- 0:00:48
845000 -- (-2308.640) (-2310.665) (-2302.725) [-2300.441] * (-2304.316) (-2300.213) [-2302.650] (-2311.615) -- 0:00:48
Average standard deviation of split frequencies: 0.007095
845500 -- (-2306.373) (-2312.145) [-2303.278] (-2311.815) * [-2305.853] (-2307.350) (-2303.048) (-2307.995) -- 0:00:48
846000 -- (-2295.179) [-2307.688] (-2305.549) (-2310.338) * [-2299.054] (-2307.096) (-2315.501) (-2306.992) -- 0:00:47
846500 -- [-2300.104] (-2308.954) (-2303.818) (-2306.182) * (-2317.449) [-2304.366] (-2316.387) (-2315.911) -- 0:00:47
847000 -- (-2310.270) (-2314.120) [-2307.925] (-2309.456) * [-2303.286] (-2306.012) (-2309.657) (-2303.454) -- 0:00:47
847500 -- (-2308.894) [-2298.476] (-2310.781) (-2314.715) * (-2314.051) (-2306.350) [-2309.052] (-2314.527) -- 0:00:47
848000 -- [-2301.961] (-2303.329) (-2303.626) (-2308.225) * (-2309.720) (-2311.389) [-2310.534] (-2315.239) -- 0:00:47
848500 -- [-2305.130] (-2310.235) (-2299.220) (-2309.741) * (-2306.310) (-2317.504) (-2310.537) [-2308.603] -- 0:00:47
849000 -- (-2308.905) (-2314.621) [-2304.359] (-2312.292) * [-2306.796] (-2317.544) (-2303.112) (-2318.971) -- 0:00:46
849500 -- (-2306.592) (-2302.820) (-2309.844) [-2310.723] * (-2299.154) (-2317.055) [-2312.160] (-2314.146) -- 0:00:46
850000 -- [-2308.006] (-2304.667) (-2313.937) (-2307.498) * (-2304.997) (-2323.063) [-2304.080] (-2313.525) -- 0:00:46
Average standard deviation of split frequencies: 0.007389
850500 -- (-2310.690) (-2307.446) [-2299.346] (-2306.971) * [-2304.105] (-2306.075) (-2316.290) (-2315.901) -- 0:00:46
851000 -- (-2315.717) [-2302.801] (-2309.353) (-2311.868) * (-2305.738) (-2312.473) [-2308.500] (-2323.645) -- 0:00:46
851500 -- (-2301.364) [-2304.672] (-2313.212) (-2319.705) * (-2301.553) [-2306.413] (-2316.421) (-2319.926) -- 0:00:46
852000 -- [-2305.178] (-2308.571) (-2302.175) (-2315.991) * (-2312.444) (-2321.509) [-2301.625] (-2314.401) -- 0:00:46
852500 -- [-2300.574] (-2323.117) (-2311.273) (-2318.896) * (-2309.832) [-2305.406] (-2305.640) (-2316.830) -- 0:00:45
853000 -- [-2298.869] (-2312.595) (-2305.033) (-2309.728) * (-2307.152) (-2306.034) [-2307.683] (-2307.522) -- 0:00:45
853500 -- (-2300.853) [-2309.887] (-2307.614) (-2315.316) * (-2306.007) (-2315.138) [-2299.889] (-2321.476) -- 0:00:45
854000 -- (-2305.822) (-2309.845) [-2307.135] (-2312.755) * (-2311.972) [-2305.520] (-2300.856) (-2319.549) -- 0:00:45
854500 -- [-2294.041] (-2309.067) (-2309.026) (-2316.793) * (-2305.960) (-2304.635) (-2308.008) [-2313.801] -- 0:00:45
855000 -- (-2306.468) [-2299.473] (-2298.769) (-2314.760) * [-2303.112] (-2305.675) (-2317.100) (-2309.643) -- 0:00:45
Average standard deviation of split frequencies: 0.006608
855500 -- (-2311.554) [-2300.656] (-2302.690) (-2300.418) * (-2299.537) (-2308.482) [-2298.616] (-2316.716) -- 0:00:44
856000 -- (-2315.222) (-2313.618) (-2298.318) [-2306.095] * (-2309.266) [-2297.836] (-2304.278) (-2321.204) -- 0:00:44
856500 -- (-2304.472) (-2306.775) (-2301.149) [-2303.347] * (-2300.714) [-2308.118] (-2307.044) (-2318.860) -- 0:00:44
857000 -- (-2306.741) (-2302.435) (-2300.297) [-2301.810] * [-2312.774] (-2304.635) (-2303.617) (-2306.237) -- 0:00:44
857500 -- [-2304.949] (-2310.889) (-2313.653) (-2304.856) * [-2301.386] (-2308.479) (-2302.044) (-2299.380) -- 0:00:44
858000 -- (-2311.085) (-2307.894) [-2301.427] (-2313.009) * (-2298.600) (-2303.064) (-2306.819) [-2298.036] -- 0:00:44
858500 -- (-2326.386) [-2300.793] (-2315.113) (-2312.011) * (-2309.351) (-2303.786) (-2331.201) [-2304.732] -- 0:00:44
859000 -- (-2325.664) (-2309.556) (-2319.988) [-2301.374] * [-2309.950] (-2313.357) (-2319.092) (-2305.060) -- 0:00:43
859500 -- [-2309.514] (-2315.246) (-2310.442) (-2319.790) * (-2312.107) (-2322.308) [-2314.524] (-2303.321) -- 0:00:43
860000 -- (-2316.649) [-2297.903] (-2309.335) (-2316.887) * [-2309.629] (-2319.116) (-2310.059) (-2313.203) -- 0:00:43
Average standard deviation of split frequencies: 0.006354
860500 -- (-2308.393) [-2298.985] (-2309.754) (-2312.550) * (-2316.754) (-2300.929) (-2319.915) [-2303.767] -- 0:00:43
861000 -- (-2300.705) [-2304.695] (-2310.649) (-2311.809) * (-2319.012) (-2299.192) [-2308.767] (-2308.111) -- 0:00:43
861500 -- [-2298.140] (-2313.827) (-2311.555) (-2304.950) * [-2305.513] (-2318.672) (-2310.434) (-2304.948) -- 0:00:42
862000 -- (-2316.508) (-2312.301) [-2304.551] (-2316.500) * [-2298.338] (-2303.617) (-2309.713) (-2311.674) -- 0:00:42
862500 -- (-2305.373) (-2320.254) [-2307.419] (-2312.529) * (-2308.769) (-2308.334) [-2302.281] (-2309.050) -- 0:00:42
863000 -- (-2332.698) [-2298.958] (-2295.245) (-2311.101) * [-2302.891] (-2306.357) (-2301.319) (-2310.457) -- 0:00:42
863500 -- (-2303.275) (-2305.512) [-2307.035] (-2309.587) * (-2307.995) (-2309.090) [-2305.997] (-2310.263) -- 0:00:42
864000 -- (-2310.530) (-2320.313) [-2308.748] (-2309.487) * [-2310.694] (-2310.263) (-2305.109) (-2302.517) -- 0:00:42
864500 -- (-2318.178) [-2302.416] (-2324.071) (-2299.211) * (-2300.624) (-2306.274) (-2318.127) [-2299.706] -- 0:00:42
865000 -- [-2312.224] (-2311.678) (-2312.507) (-2311.762) * (-2307.835) (-2304.512) [-2303.047] (-2315.321) -- 0:00:41
Average standard deviation of split frequencies: 0.005697
865500 -- (-2309.818) (-2310.268) (-2301.424) [-2303.363] * (-2301.483) (-2308.258) [-2302.085] (-2310.168) -- 0:00:41
866000 -- (-2320.759) (-2298.026) (-2304.953) [-2302.600] * (-2299.021) (-2306.902) (-2304.666) [-2310.024] -- 0:00:41
866500 -- (-2307.854) [-2300.391] (-2310.637) (-2303.577) * (-2310.302) [-2305.105] (-2304.433) (-2303.799) -- 0:00:41
867000 -- (-2306.728) [-2310.489] (-2310.207) (-2309.372) * (-2321.135) [-2296.471] (-2310.372) (-2310.537) -- 0:00:41
867500 -- (-2319.056) (-2312.258) [-2307.033] (-2314.760) * (-2320.293) (-2307.860) (-2303.964) [-2299.632] -- 0:00:41
868000 -- (-2303.347) (-2303.062) (-2306.376) [-2298.649] * (-2300.283) (-2307.234) (-2313.635) [-2303.836] -- 0:00:41
868500 -- (-2298.230) (-2306.704) [-2302.782] (-2307.901) * (-2305.030) (-2313.159) [-2317.226] (-2306.504) -- 0:00:40
869000 -- (-2324.457) [-2306.559] (-2314.903) (-2297.802) * [-2306.661] (-2314.255) (-2306.034) (-2314.812) -- 0:00:40
869500 -- (-2325.852) (-2316.127) [-2302.429] (-2304.933) * (-2323.760) [-2304.644] (-2307.319) (-2308.167) -- 0:00:40
870000 -- (-2305.132) (-2308.175) (-2314.045) [-2305.060] * (-2315.064) (-2309.335) [-2307.688] (-2307.298) -- 0:00:40
Average standard deviation of split frequencies: 0.005162
870500 -- (-2309.324) [-2312.788] (-2323.540) (-2308.591) * (-2311.674) [-2302.594] (-2302.859) (-2310.065) -- 0:00:40
871000 -- [-2307.544] (-2308.040) (-2306.401) (-2301.511) * (-2307.343) (-2297.818) (-2307.392) [-2311.746] -- 0:00:40
871500 -- (-2312.827) [-2307.445] (-2308.267) (-2302.560) * [-2313.871] (-2304.475) (-2307.451) (-2307.226) -- 0:00:39
872000 -- (-2309.067) (-2304.739) (-2312.210) [-2303.206] * (-2300.538) [-2297.597] (-2323.363) (-2308.865) -- 0:00:39
872500 -- (-2314.068) (-2307.208) (-2311.003) [-2307.748] * (-2307.270) (-2301.446) (-2307.033) [-2317.232] -- 0:00:39
873000 -- (-2308.273) (-2316.352) [-2312.687] (-2310.442) * (-2307.837) (-2308.096) [-2299.983] (-2316.212) -- 0:00:39
873500 -- (-2303.430) (-2305.786) [-2308.374] (-2309.447) * (-2307.692) (-2304.734) [-2304.931] (-2311.443) -- 0:00:39
874000 -- (-2300.452) [-2304.751] (-2306.283) (-2311.324) * (-2318.769) (-2305.643) (-2306.821) [-2305.150] -- 0:00:39
874500 -- (-2311.418) [-2307.627] (-2308.297) (-2309.398) * (-2312.787) (-2311.852) [-2314.297] (-2305.265) -- 0:00:39
875000 -- (-2306.835) (-2313.125) [-2303.410] (-2304.026) * (-2314.618) [-2306.843] (-2304.802) (-2307.623) -- 0:00:38
Average standard deviation of split frequencies: 0.005094
875500 -- [-2301.519] (-2316.497) (-2300.624) (-2304.174) * (-2318.199) [-2312.215] (-2314.067) (-2313.444) -- 0:00:38
876000 -- [-2305.010] (-2311.117) (-2314.893) (-2314.885) * (-2313.026) [-2309.760] (-2312.965) (-2306.200) -- 0:00:38
876500 -- (-2306.222) [-2309.475] (-2316.601) (-2308.018) * [-2310.867] (-2304.002) (-2313.833) (-2315.050) -- 0:00:38
877000 -- (-2315.085) [-2301.768] (-2308.833) (-2304.471) * (-2305.634) (-2313.679) (-2311.252) [-2302.868] -- 0:00:38
877500 -- (-2309.939) [-2309.164] (-2305.183) (-2301.862) * (-2308.543) (-2329.488) (-2315.604) [-2299.726] -- 0:00:38
878000 -- (-2308.455) [-2323.633] (-2304.762) (-2305.924) * (-2310.233) [-2315.791] (-2306.276) (-2312.374) -- 0:00:37
878500 -- (-2305.935) [-2305.037] (-2302.259) (-2311.581) * (-2319.636) [-2305.096] (-2299.344) (-2313.862) -- 0:00:37
879000 -- (-2306.396) (-2306.261) [-2304.426] (-2314.380) * (-2304.361) [-2311.170] (-2318.407) (-2317.923) -- 0:00:37
879500 -- (-2298.898) (-2317.213) [-2303.356] (-2312.853) * [-2305.948] (-2306.453) (-2308.280) (-2327.747) -- 0:00:37
880000 -- (-2315.033) [-2308.707] (-2306.026) (-2313.094) * [-2297.761] (-2312.703) (-2302.722) (-2322.478) -- 0:00:37
Average standard deviation of split frequencies: 0.006067
880500 -- (-2300.936) [-2304.858] (-2309.270) (-2303.549) * (-2311.918) (-2307.360) [-2302.030] (-2310.246) -- 0:00:37
881000 -- [-2308.157] (-2312.627) (-2305.212) (-2307.890) * [-2304.107] (-2308.178) (-2296.734) (-2331.679) -- 0:00:37
881500 -- (-2314.582) (-2302.113) (-2310.727) [-2302.056] * (-2311.916) (-2307.939) (-2304.493) [-2308.207] -- 0:00:36
882000 -- [-2302.831] (-2304.488) (-2316.699) (-2301.300) * [-2307.713] (-2324.933) (-2302.802) (-2301.073) -- 0:00:36
882500 -- (-2307.183) [-2307.210] (-2315.953) (-2296.013) * (-2325.257) [-2306.092] (-2315.818) (-2311.219) -- 0:00:36
883000 -- (-2316.121) (-2317.579) [-2301.334] (-2312.479) * (-2318.748) [-2305.636] (-2308.935) (-2324.373) -- 0:00:36
883500 -- (-2303.852) (-2312.008) [-2304.277] (-2308.571) * [-2304.548] (-2298.064) (-2312.400) (-2312.039) -- 0:00:36
884000 -- [-2302.662] (-2315.962) (-2304.819) (-2306.796) * (-2301.434) (-2307.469) (-2319.946) [-2305.797] -- 0:00:36
884500 -- (-2306.628) (-2324.561) (-2309.650) [-2303.032] * [-2302.138] (-2317.671) (-2322.237) (-2309.597) -- 0:00:35
885000 -- [-2303.266] (-2321.718) (-2301.832) (-2305.872) * (-2304.437) [-2301.244] (-2304.386) (-2306.643) -- 0:00:35
Average standard deviation of split frequencies: 0.005888
885500 -- [-2294.753] (-2303.806) (-2306.185) (-2304.938) * [-2302.042] (-2319.258) (-2319.767) (-2297.636) -- 0:00:35
886000 -- (-2311.621) (-2304.818) (-2307.965) [-2312.077] * (-2320.080) (-2310.327) (-2300.928) [-2306.085] -- 0:00:35
886500 -- (-2307.105) [-2300.388] (-2307.671) (-2311.004) * (-2312.701) (-2311.579) (-2303.419) [-2303.870] -- 0:00:35
887000 -- (-2308.840) [-2304.875] (-2308.603) (-2304.938) * (-2319.928) (-2314.336) [-2306.497] (-2322.069) -- 0:00:35
887500 -- [-2309.235] (-2310.049) (-2313.783) (-2303.175) * (-2319.073) (-2311.828) (-2306.197) [-2307.146] -- 0:00:34
888000 -- (-2306.072) (-2299.798) (-2307.843) [-2306.511] * (-2306.198) (-2305.570) [-2306.484] (-2306.899) -- 0:00:34
888500 -- (-2308.379) [-2303.490] (-2308.997) (-2315.205) * [-2304.009] (-2301.147) (-2319.763) (-2314.888) -- 0:00:34
889000 -- (-2310.329) [-2318.375] (-2309.290) (-2311.232) * (-2305.527) (-2302.518) (-2314.732) [-2299.964] -- 0:00:34
889500 -- [-2305.996] (-2310.885) (-2309.549) (-2312.316) * (-2318.272) [-2298.081] (-2314.460) (-2313.020) -- 0:00:34
890000 -- (-2316.558) (-2311.390) (-2307.865) [-2305.892] * (-2307.725) (-2322.241) (-2301.939) [-2304.086] -- 0:00:34
Average standard deviation of split frequencies: 0.005681
890500 -- (-2320.739) (-2313.241) [-2303.923] (-2306.762) * [-2310.702] (-2304.494) (-2304.061) (-2315.438) -- 0:00:34
891000 -- (-2307.590) (-2311.044) [-2305.224] (-2311.793) * (-2316.627) [-2296.198] (-2303.282) (-2302.428) -- 0:00:34
891500 -- (-2328.560) (-2305.745) (-2313.635) [-2300.190] * (-2311.174) (-2309.342) (-2313.516) [-2309.224] -- 0:00:33
892000 -- [-2310.946] (-2315.976) (-2305.285) (-2310.033) * [-2304.857] (-2301.360) (-2307.795) (-2311.568) -- 0:00:33
892500 -- (-2313.985) [-2301.220] (-2317.513) (-2320.279) * (-2307.564) (-2303.208) [-2297.444] (-2302.177) -- 0:00:33
893000 -- (-2313.090) (-2307.314) [-2301.221] (-2319.121) * (-2304.593) (-2319.252) [-2306.344] (-2305.732) -- 0:00:33
893500 -- (-2312.810) (-2313.468) [-2299.980] (-2310.323) * (-2310.050) [-2308.622] (-2312.384) (-2310.024) -- 0:00:33
894000 -- [-2305.284] (-2318.035) (-2312.282) (-2314.211) * [-2303.337] (-2309.283) (-2320.794) (-2303.781) -- 0:00:33
894500 -- (-2313.578) (-2306.456) (-2319.317) [-2304.620] * [-2303.990] (-2311.489) (-2300.962) (-2310.723) -- 0:00:32
895000 -- (-2311.061) (-2312.050) (-2316.667) [-2314.052] * (-2312.228) [-2301.581] (-2311.703) (-2320.458) -- 0:00:32
Average standard deviation of split frequencies: 0.005928
895500 -- (-2302.418) (-2315.671) (-2308.362) [-2301.490] * [-2309.391] (-2306.853) (-2304.247) (-2325.318) -- 0:00:32
896000 -- [-2308.482] (-2314.982) (-2318.854) (-2315.649) * (-2307.692) (-2325.295) (-2303.740) [-2298.322] -- 0:00:32
896500 -- (-2307.212) (-2317.258) (-2304.090) [-2300.732] * (-2300.342) (-2310.758) (-2317.356) [-2305.771] -- 0:00:32
897000 -- (-2309.332) (-2312.318) [-2309.299] (-2306.325) * [-2304.171] (-2322.123) (-2315.518) (-2311.366) -- 0:00:32
897500 -- [-2310.077] (-2305.959) (-2310.426) (-2298.687) * (-2314.254) (-2317.996) [-2305.234] (-2304.086) -- 0:00:31
898000 -- (-2303.500) (-2313.761) (-2310.195) [-2307.133] * [-2294.573] (-2308.572) (-2298.289) (-2304.094) -- 0:00:31
898500 -- [-2304.565] (-2316.944) (-2309.677) (-2316.980) * (-2305.808) (-2314.494) (-2305.087) [-2305.503] -- 0:00:31
899000 -- [-2299.077] (-2312.584) (-2330.297) (-2313.909) * (-2303.085) (-2301.087) [-2307.004] (-2296.868) -- 0:00:31
899500 -- [-2304.017] (-2303.514) (-2305.870) (-2323.414) * (-2313.923) [-2303.356] (-2306.883) (-2311.223) -- 0:00:31
900000 -- (-2319.827) (-2306.018) [-2305.363] (-2301.521) * [-2304.843] (-2310.188) (-2309.364) (-2305.660) -- 0:00:31
Average standard deviation of split frequencies: 0.006665
900500 -- (-2302.218) (-2317.473) (-2310.674) [-2309.401] * (-2303.632) [-2300.113] (-2310.594) (-2325.176) -- 0:00:31
901000 -- (-2311.495) (-2304.738) (-2323.720) [-2300.716] * [-2295.230] (-2300.988) (-2319.960) (-2306.202) -- 0:00:30
901500 -- (-2310.664) (-2302.853) (-2323.366) [-2310.617] * (-2306.999) (-2307.358) [-2301.087] (-2313.414) -- 0:00:30
902000 -- (-2304.713) [-2302.966] (-2313.494) (-2310.554) * (-2301.033) [-2303.837] (-2308.665) (-2310.608) -- 0:00:30
902500 -- (-2308.149) (-2305.533) [-2311.925] (-2311.344) * (-2310.736) (-2309.741) (-2308.698) [-2301.663] -- 0:00:30
903000 -- [-2301.865] (-2305.815) (-2305.979) (-2309.649) * (-2314.065) (-2305.120) (-2321.364) [-2299.404] -- 0:00:30
903500 -- (-2319.307) (-2317.806) (-2315.042) [-2310.265] * (-2322.850) (-2304.579) (-2318.384) [-2309.017] -- 0:00:30
904000 -- (-2310.399) (-2325.932) [-2314.654] (-2303.744) * (-2311.308) [-2293.483] (-2314.014) (-2315.564) -- 0:00:29
904500 -- (-2308.537) (-2310.272) (-2307.621) [-2309.763] * (-2307.511) (-2298.709) (-2306.745) [-2312.154] -- 0:00:29
905000 -- (-2309.507) (-2311.061) [-2307.790] (-2313.602) * (-2323.870) (-2303.049) [-2298.501] (-2302.805) -- 0:00:29
Average standard deviation of split frequencies: 0.006348
905500 -- (-2298.259) (-2313.267) [-2309.386] (-2316.343) * (-2315.504) (-2301.467) (-2305.082) [-2301.146] -- 0:00:29
906000 -- [-2305.323] (-2312.004) (-2306.592) (-2303.063) * (-2303.819) [-2301.772] (-2310.301) (-2302.647) -- 0:00:29
906500 -- (-2302.524) (-2303.726) (-2318.995) [-2300.713] * (-2305.037) (-2308.146) (-2307.509) [-2300.355] -- 0:00:29
907000 -- [-2297.192] (-2309.068) (-2313.997) (-2306.211) * (-2317.817) (-2307.495) [-2305.848] (-2307.215) -- 0:00:29
907500 -- (-2313.475) (-2308.574) (-2323.940) [-2303.253] * (-2301.150) (-2309.354) [-2313.881] (-2302.007) -- 0:00:28
908000 -- (-2308.460) (-2309.658) (-2298.676) [-2302.060] * [-2312.792] (-2309.311) (-2310.200) (-2308.522) -- 0:00:28
908500 -- (-2311.846) (-2311.727) (-2315.296) [-2301.834] * (-2311.222) [-2297.741] (-2311.316) (-2306.630) -- 0:00:28
909000 -- [-2308.374] (-2320.686) (-2302.803) (-2295.831) * [-2299.791] (-2305.764) (-2316.787) (-2298.154) -- 0:00:28
909500 -- (-2320.881) (-2308.712) (-2301.864) [-2306.027] * (-2299.858) (-2312.008) (-2317.486) [-2306.706] -- 0:00:28
910000 -- (-2307.277) (-2304.959) (-2305.918) [-2295.481] * (-2300.205) (-2308.137) (-2316.812) [-2300.807] -- 0:00:28
Average standard deviation of split frequencies: 0.005729
910500 -- [-2313.039] (-2313.125) (-2314.103) (-2316.511) * (-2319.745) (-2302.842) [-2300.691] (-2310.596) -- 0:00:27
911000 -- (-2302.871) (-2298.777) [-2308.005] (-2311.841) * (-2295.916) [-2305.645] (-2309.736) (-2304.781) -- 0:00:27
911500 -- (-2306.664) (-2315.933) [-2302.927] (-2314.678) * [-2307.460] (-2314.608) (-2306.262) (-2317.819) -- 0:00:27
912000 -- (-2308.018) (-2302.567) (-2308.097) [-2315.796] * (-2304.341) (-2326.409) [-2312.529] (-2309.368) -- 0:00:27
912500 -- (-2316.136) (-2311.043) [-2305.561] (-2311.293) * (-2306.353) (-2333.538) [-2302.049] (-2308.941) -- 0:00:27
913000 -- (-2316.528) [-2298.033] (-2314.528) (-2319.571) * (-2294.964) [-2302.200] (-2298.909) (-2314.894) -- 0:00:27
913500 -- [-2307.817] (-2308.338) (-2316.080) (-2300.537) * (-2314.812) (-2302.503) [-2306.378] (-2307.058) -- 0:00:26
914000 -- (-2304.786) [-2315.787] (-2305.595) (-2300.356) * [-2311.793] (-2300.728) (-2312.902) (-2317.631) -- 0:00:26
914500 -- (-2315.167) [-2307.872] (-2313.057) (-2305.128) * (-2306.817) (-2310.777) [-2304.953] (-2307.982) -- 0:00:26
915000 -- (-2304.805) [-2306.642] (-2309.624) (-2308.974) * (-2317.580) [-2307.009] (-2308.257) (-2311.278) -- 0:00:26
Average standard deviation of split frequencies: 0.006176
915500 -- (-2303.789) (-2302.923) [-2313.738] (-2316.929) * (-2304.261) (-2308.806) (-2296.610) [-2309.184] -- 0:00:26
916000 -- (-2303.927) (-2310.755) [-2306.758] (-2319.093) * (-2313.690) (-2306.555) [-2300.318] (-2303.264) -- 0:00:26
916500 -- (-2311.325) (-2296.973) [-2304.993] (-2302.063) * (-2310.191) [-2308.970] (-2317.699) (-2307.007) -- 0:00:26
917000 -- (-2312.918) (-2305.384) [-2304.671] (-2305.560) * (-2313.883) [-2305.236] (-2304.775) (-2313.448) -- 0:00:25
917500 -- (-2318.520) (-2305.791) [-2300.486] (-2310.071) * (-2302.543) (-2319.712) (-2310.942) [-2307.325] -- 0:00:25
918000 -- (-2308.551) (-2303.199) (-2316.609) [-2306.298] * [-2303.640] (-2302.940) (-2302.475) (-2306.517) -- 0:00:25
918500 -- (-2308.872) [-2307.450] (-2312.610) (-2303.636) * (-2303.751) [-2297.302] (-2308.640) (-2303.641) -- 0:00:25
919000 -- (-2304.908) (-2306.505) (-2306.834) [-2300.205] * (-2309.051) (-2313.101) (-2319.931) [-2307.663] -- 0:00:25
919500 -- (-2311.313) (-2304.943) [-2304.394] (-2297.505) * (-2313.556) [-2309.913] (-2299.934) (-2309.641) -- 0:00:25
920000 -- (-2311.636) (-2310.248) (-2318.549) [-2302.045] * (-2313.045) [-2304.478] (-2302.509) (-2318.605) -- 0:00:24
Average standard deviation of split frequencies: 0.006656
920500 -- (-2309.713) (-2320.711) [-2302.825] (-2316.215) * (-2303.729) [-2302.758] (-2305.760) (-2313.292) -- 0:00:24
921000 -- [-2309.167] (-2309.386) (-2296.596) (-2309.072) * (-2315.444) (-2301.443) [-2305.780] (-2306.787) -- 0:00:24
921500 -- (-2306.347) (-2305.246) (-2306.606) [-2307.656] * [-2304.079] (-2304.587) (-2311.919) (-2302.474) -- 0:00:24
922000 -- (-2303.896) (-2310.309) (-2302.455) [-2307.809] * (-2307.083) (-2314.714) [-2310.341] (-2303.865) -- 0:00:24
922500 -- (-2305.051) (-2307.106) (-2308.115) [-2296.764] * [-2298.923] (-2320.017) (-2308.430) (-2309.317) -- 0:00:24
923000 -- (-2315.926) (-2314.148) [-2308.063] (-2308.266) * [-2297.993] (-2324.222) (-2310.421) (-2316.349) -- 0:00:24
923500 -- (-2310.065) [-2316.317] (-2313.925) (-2307.706) * [-2306.961] (-2307.199) (-2299.272) (-2308.044) -- 0:00:23
924000 -- (-2313.893) (-2311.309) (-2305.412) [-2298.728] * [-2303.207] (-2308.126) (-2305.278) (-2300.021) -- 0:00:23
924500 -- (-2302.932) (-2312.825) [-2302.870] (-2311.511) * [-2301.633] (-2306.487) (-2301.703) (-2321.439) -- 0:00:23
925000 -- (-2307.830) (-2305.875) [-2301.673] (-2322.399) * (-2305.793) (-2314.595) (-2318.720) [-2304.112] -- 0:00:23
Average standard deviation of split frequencies: 0.006177
925500 -- [-2297.754] (-2311.969) (-2302.579) (-2306.912) * (-2309.167) [-2305.041] (-2316.004) (-2305.256) -- 0:00:23
926000 -- (-2305.550) (-2305.175) (-2313.890) [-2310.930] * (-2313.115) [-2303.106] (-2301.805) (-2315.560) -- 0:00:23
926500 -- (-2302.450) (-2312.516) [-2302.366] (-2317.793) * (-2313.125) [-2302.795] (-2305.712) (-2310.378) -- 0:00:22
927000 -- [-2303.404] (-2322.488) (-2312.731) (-2309.445) * (-2321.079) [-2306.856] (-2307.477) (-2306.006) -- 0:00:22
927500 -- [-2310.244] (-2321.111) (-2309.932) (-2313.123) * (-2309.788) (-2314.344) [-2302.663] (-2301.233) -- 0:00:22
928000 -- [-2300.794] (-2318.446) (-2310.803) (-2315.837) * (-2303.914) (-2315.182) [-2301.508] (-2306.877) -- 0:00:22
928500 -- [-2309.421] (-2314.147) (-2315.145) (-2321.536) * (-2303.237) (-2307.051) (-2307.527) [-2309.234] -- 0:00:22
929000 -- [-2310.527] (-2325.193) (-2311.590) (-2302.890) * [-2305.800] (-2304.711) (-2306.909) (-2311.579) -- 0:00:22
929500 -- (-2308.309) (-2309.147) (-2304.092) [-2303.154] * (-2300.792) [-2306.696] (-2303.733) (-2306.274) -- 0:00:21
930000 -- (-2304.257) (-2308.747) (-2305.894) [-2298.199] * (-2302.654) (-2318.684) (-2306.533) [-2306.299] -- 0:00:21
Average standard deviation of split frequencies: 0.006922
930500 -- (-2315.771) (-2321.969) [-2305.001] (-2303.944) * [-2303.500] (-2314.937) (-2313.977) (-2317.307) -- 0:00:21
931000 -- (-2320.070) [-2310.281] (-2311.315) (-2309.751) * (-2311.418) (-2315.967) [-2298.622] (-2307.157) -- 0:00:21
931500 -- (-2307.400) (-2315.791) (-2317.483) [-2308.028] * [-2297.232] (-2309.797) (-2304.835) (-2305.552) -- 0:00:21
932000 -- [-2312.905] (-2315.263) (-2307.623) (-2311.846) * (-2313.056) [-2304.857] (-2307.257) (-2299.627) -- 0:00:21
932500 -- (-2302.706) (-2316.257) [-2302.205] (-2324.911) * [-2302.929] (-2304.751) (-2296.853) (-2299.192) -- 0:00:21
933000 -- (-2319.427) (-2327.080) (-2307.206) [-2300.376] * (-2327.090) (-2312.893) [-2307.933] (-2305.872) -- 0:00:20
933500 -- (-2304.892) (-2306.047) (-2314.969) [-2302.249] * (-2319.381) (-2301.434) (-2316.264) [-2308.685] -- 0:00:20
934000 -- (-2318.734) (-2306.141) (-2311.594) [-2306.165] * (-2309.465) (-2306.899) [-2306.938] (-2314.571) -- 0:00:20
934500 -- (-2301.991) [-2310.777] (-2308.203) (-2303.107) * [-2296.202] (-2304.841) (-2303.482) (-2314.206) -- 0:00:20
935000 -- (-2311.196) (-2306.867) (-2299.083) [-2303.852] * [-2310.997] (-2301.343) (-2313.228) (-2303.423) -- 0:00:20
Average standard deviation of split frequencies: 0.006648
935500 -- [-2306.240] (-2308.194) (-2301.530) (-2319.750) * [-2304.456] (-2310.534) (-2309.208) (-2306.123) -- 0:00:20
936000 -- (-2311.793) (-2317.028) (-2304.622) [-2301.607] * (-2307.633) [-2305.303] (-2315.228) (-2309.373) -- 0:00:19
936500 -- (-2299.307) [-2304.051] (-2300.627) (-2310.190) * [-2310.133] (-2314.594) (-2310.490) (-2312.333) -- 0:00:19
937000 -- (-2312.588) (-2316.756) (-2299.666) [-2307.431] * (-2319.484) (-2301.089) [-2303.574] (-2314.687) -- 0:00:19
937500 -- (-2300.166) (-2313.642) (-2308.148) [-2299.473] * (-2306.233) (-2317.130) (-2308.138) [-2298.281] -- 0:00:19
938000 -- (-2319.872) (-2317.683) (-2312.945) [-2307.586] * [-2305.801] (-2297.843) (-2313.015) (-2309.184) -- 0:00:19
938500 -- (-2313.748) (-2319.246) [-2307.137] (-2327.305) * (-2308.292) [-2307.363] (-2303.083) (-2307.652) -- 0:00:19
939000 -- [-2306.345] (-2313.501) (-2307.698) (-2312.666) * (-2315.990) [-2311.173] (-2309.759) (-2308.535) -- 0:00:19
939500 -- (-2304.605) (-2300.710) (-2311.250) [-2304.214] * (-2318.781) (-2305.163) (-2297.359) [-2303.005] -- 0:00:18
940000 -- (-2312.467) (-2304.379) [-2304.535] (-2309.404) * (-2315.712) [-2299.243] (-2309.860) (-2304.291) -- 0:00:18
Average standard deviation of split frequencies: 0.007083
940500 -- (-2334.759) [-2301.204] (-2304.197) (-2307.817) * (-2313.052) (-2308.296) [-2307.843] (-2308.386) -- 0:00:18
941000 -- (-2308.277) (-2309.225) [-2304.035] (-2302.346) * (-2308.107) (-2320.169) (-2312.600) [-2303.821] -- 0:00:18
941500 -- [-2308.639] (-2302.160) (-2313.352) (-2307.748) * [-2298.920] (-2321.784) (-2305.958) (-2308.970) -- 0:00:18
942000 -- [-2301.797] (-2312.041) (-2313.249) (-2300.948) * (-2304.290) (-2325.147) [-2314.018] (-2308.567) -- 0:00:18
942500 -- (-2317.675) (-2312.749) (-2305.146) [-2308.350] * [-2306.043] (-2312.822) (-2310.426) (-2304.584) -- 0:00:17
943000 -- (-2303.512) [-2310.345] (-2318.036) (-2313.604) * (-2309.132) (-2310.095) (-2316.651) [-2312.474] -- 0:00:17
943500 -- (-2309.409) (-2312.762) [-2324.394] (-2316.884) * (-2324.796) (-2306.926) [-2304.288] (-2312.090) -- 0:00:17
944000 -- (-2310.668) (-2310.693) (-2314.251) [-2305.844] * (-2314.786) (-2313.609) [-2304.297] (-2300.063) -- 0:00:17
944500 -- (-2311.730) [-2306.453] (-2311.524) (-2308.679) * (-2312.033) (-2311.214) (-2311.035) [-2304.720] -- 0:00:17
945000 -- (-2323.628) (-2303.555) (-2325.442) [-2299.499] * (-2302.762) [-2306.186] (-2321.377) (-2310.310) -- 0:00:17
Average standard deviation of split frequencies: 0.006844
945500 -- (-2306.376) (-2302.483) (-2311.497) [-2300.161] * (-2313.597) (-2305.120) (-2308.152) [-2311.313] -- 0:00:17
946000 -- (-2310.639) (-2303.546) (-2324.847) [-2309.581] * [-2300.914] (-2312.424) (-2315.983) (-2309.601) -- 0:00:16
946500 -- (-2319.015) [-2303.670] (-2314.238) (-2307.396) * (-2301.912) [-2299.989] (-2306.162) (-2316.920) -- 0:00:16
947000 -- (-2305.967) (-2301.392) (-2323.465) [-2314.173] * [-2304.426] (-2305.889) (-2319.864) (-2310.801) -- 0:00:16
947500 -- (-2314.706) (-2306.405) (-2318.953) [-2304.908] * [-2299.662] (-2299.899) (-2316.289) (-2304.887) -- 0:00:16
948000 -- (-2314.967) [-2295.430] (-2309.466) (-2305.061) * (-2299.081) (-2308.369) [-2303.036] (-2310.579) -- 0:00:16
948500 -- (-2303.516) (-2315.584) (-2312.540) [-2294.800] * [-2299.261] (-2306.507) (-2301.318) (-2310.373) -- 0:00:16
949000 -- (-2306.591) [-2306.688] (-2303.555) (-2313.190) * (-2294.213) [-2308.265] (-2309.462) (-2313.094) -- 0:00:15
949500 -- (-2304.151) [-2298.437] (-2325.524) (-2321.773) * [-2306.556] (-2302.602) (-2306.168) (-2325.486) -- 0:00:15
950000 -- [-2298.115] (-2298.105) (-2319.164) (-2306.547) * (-2303.070) (-2303.566) [-2302.268] (-2315.888) -- 0:00:15
Average standard deviation of split frequencies: 0.006678
950500 -- [-2309.649] (-2306.269) (-2307.162) (-2304.709) * (-2319.917) [-2303.813] (-2315.235) (-2313.216) -- 0:00:15
951000 -- [-2303.054] (-2312.896) (-2305.290) (-2311.579) * (-2306.254) [-2298.987] (-2310.258) (-2312.207) -- 0:00:15
951500 -- (-2313.503) [-2303.607] (-2308.722) (-2308.884) * (-2308.186) [-2301.418] (-2310.685) (-2316.829) -- 0:00:15
952000 -- (-2306.100) (-2309.983) (-2304.561) [-2301.637] * (-2306.498) (-2326.625) [-2306.934] (-2315.460) -- 0:00:15
952500 -- (-2308.605) (-2319.787) (-2302.925) [-2301.339] * [-2309.777] (-2308.561) (-2308.365) (-2306.511) -- 0:00:14
953000 -- (-2318.176) (-2317.973) (-2303.285) [-2299.322] * (-2313.190) (-2308.804) (-2303.039) [-2304.202] -- 0:00:14
953500 -- (-2304.168) (-2312.319) (-2303.791) [-2310.072] * (-2320.711) [-2312.840] (-2310.958) (-2333.106) -- 0:00:14
954000 -- (-2303.021) (-2299.213) [-2310.862] (-2315.407) * (-2312.776) [-2304.818] (-2309.634) (-2316.473) -- 0:00:14
954500 -- (-2314.146) (-2309.767) [-2303.236] (-2301.560) * (-2313.623) [-2299.523] (-2305.736) (-2299.006) -- 0:00:14
955000 -- (-2312.363) [-2324.843] (-2325.808) (-2303.158) * [-2305.150] (-2311.707) (-2306.134) (-2307.088) -- 0:00:14
Average standard deviation of split frequencies: 0.006246
955500 -- (-2308.816) (-2314.367) [-2308.837] (-2306.902) * (-2303.753) (-2320.124) [-2310.703] (-2301.942) -- 0:00:13
956000 -- [-2297.678] (-2311.352) (-2305.271) (-2311.809) * (-2314.597) [-2309.705] (-2312.194) (-2308.701) -- 0:00:13
956500 -- [-2293.894] (-2298.004) (-2307.597) (-2303.930) * [-2302.930] (-2321.904) (-2301.384) (-2298.830) -- 0:00:13
957000 -- [-2306.066] (-2302.206) (-2309.442) (-2315.197) * (-2328.387) [-2301.701] (-2319.945) (-2323.391) -- 0:00:13
957500 -- (-2313.091) [-2301.857] (-2315.748) (-2318.330) * (-2302.246) (-2313.500) [-2303.031] (-2318.219) -- 0:00:13
958000 -- (-2307.483) (-2302.100) (-2317.014) [-2305.127] * (-2302.925) [-2308.556] (-2306.079) (-2310.907) -- 0:00:13
958500 -- (-2307.207) [-2302.182] (-2312.798) (-2318.464) * [-2300.435] (-2307.958) (-2312.845) (-2302.411) -- 0:00:12
959000 -- (-2298.034) [-2302.555] (-2306.915) (-2316.557) * (-2304.081) [-2308.461] (-2301.269) (-2308.604) -- 0:00:12
959500 -- [-2303.587] (-2305.866) (-2302.457) (-2322.159) * [-2306.450] (-2302.973) (-2308.152) (-2303.883) -- 0:00:12
960000 -- (-2310.940) (-2316.581) [-2301.991] (-2311.363) * (-2301.986) (-2312.466) (-2309.832) [-2304.664] -- 0:00:12
Average standard deviation of split frequencies: 0.006150
960500 -- (-2318.955) (-2309.198) (-2300.317) [-2309.937] * (-2312.582) (-2306.078) [-2303.249] (-2308.273) -- 0:00:12
961000 -- (-2323.063) (-2307.163) [-2306.543] (-2304.086) * (-2312.572) (-2303.985) [-2309.263] (-2299.228) -- 0:00:12
961500 -- (-2309.489) (-2318.010) [-2306.853] (-2313.359) * [-2298.540] (-2313.252) (-2313.442) (-2304.128) -- 0:00:12
962000 -- (-2306.156) (-2315.908) (-2307.527) [-2303.549] * [-2305.027] (-2303.861) (-2306.104) (-2308.443) -- 0:00:11
962500 -- (-2309.064) (-2319.140) (-2304.229) [-2306.889] * (-2302.737) (-2309.586) [-2304.020] (-2303.891) -- 0:00:11
963000 -- [-2300.351] (-2320.056) (-2307.552) (-2308.294) * [-2302.908] (-2305.740) (-2300.734) (-2314.831) -- 0:00:11
963500 -- [-2309.042] (-2315.292) (-2319.861) (-2304.452) * (-2301.912) (-2303.088) [-2308.694] (-2304.962) -- 0:00:11
964000 -- [-2306.122] (-2306.291) (-2305.101) (-2311.092) * (-2310.729) (-2310.465) (-2311.124) [-2307.013] -- 0:00:11
964500 -- [-2309.437] (-2305.842) (-2297.391) (-2298.155) * (-2308.956) (-2320.470) [-2309.075] (-2312.679) -- 0:00:11
965000 -- (-2313.663) (-2313.013) [-2303.941] (-2298.273) * (-2314.334) (-2306.264) (-2317.645) [-2312.332] -- 0:00:10
Average standard deviation of split frequencies: 0.006507
965500 -- [-2313.417] (-2303.141) (-2310.523) (-2319.273) * [-2304.876] (-2304.973) (-2306.721) (-2311.766) -- 0:00:10
966000 -- (-2302.647) (-2301.145) (-2323.189) [-2311.464] * (-2314.413) (-2314.096) (-2304.014) [-2307.384] -- 0:00:10
966500 -- (-2308.448) (-2310.604) [-2310.603] (-2314.366) * (-2317.602) (-2307.890) [-2309.402] (-2312.150) -- 0:00:10
967000 -- [-2296.415] (-2312.194) (-2304.186) (-2304.544) * (-2307.268) [-2306.591] (-2305.520) (-2312.424) -- 0:00:10
967500 -- (-2312.848) [-2311.277] (-2305.219) (-2305.234) * (-2311.232) (-2312.197) [-2303.177] (-2305.230) -- 0:00:10
968000 -- (-2316.626) (-2316.286) [-2301.585] (-2312.738) * (-2301.103) (-2321.813) [-2300.142] (-2306.599) -- 0:00:09
968500 -- (-2306.997) (-2308.886) [-2310.836] (-2318.823) * (-2310.327) (-2312.143) (-2321.941) [-2308.384] -- 0:00:09
969000 -- (-2316.055) (-2308.405) [-2306.529] (-2322.384) * (-2315.748) (-2311.477) [-2302.014] (-2312.183) -- 0:00:09
969500 -- (-2299.820) (-2306.720) [-2307.882] (-2299.582) * [-2309.651] (-2312.012) (-2310.939) (-2308.400) -- 0:00:09
970000 -- (-2301.494) (-2305.608) (-2314.049) [-2309.468] * (-2318.069) (-2317.898) (-2319.300) [-2306.735] -- 0:00:09
Average standard deviation of split frequencies: 0.006637
970500 -- (-2310.794) [-2305.920] (-2321.451) (-2303.519) * (-2305.609) (-2306.944) (-2317.511) [-2300.452] -- 0:00:09
971000 -- [-2306.323] (-2308.568) (-2308.444) (-2311.037) * (-2314.721) [-2301.159] (-2310.953) (-2302.085) -- 0:00:09
971500 -- (-2322.128) (-2326.486) (-2302.634) [-2301.996] * (-2311.674) [-2309.836] (-2329.622) (-2312.172) -- 0:00:08
972000 -- (-2314.478) (-2300.464) [-2310.141] (-2314.782) * [-2308.308] (-2306.274) (-2300.664) (-2309.184) -- 0:00:08
972500 -- [-2306.891] (-2306.154) (-2301.358) (-2315.250) * (-2311.177) [-2305.644] (-2304.805) (-2309.342) -- 0:00:08
973000 -- (-2306.946) (-2298.075) (-2309.630) [-2307.178] * (-2309.247) [-2309.536] (-2308.490) (-2314.682) -- 0:00:08
973500 -- (-2305.551) (-2308.148) (-2308.664) [-2305.039] * (-2304.468) [-2304.328] (-2309.837) (-2306.388) -- 0:00:08
974000 -- (-2307.181) (-2308.732) [-2296.927] (-2311.348) * (-2306.443) [-2305.471] (-2304.485) (-2304.813) -- 0:00:08
974500 -- [-2315.659] (-2298.302) (-2304.385) (-2323.221) * (-2309.523) [-2306.439] (-2315.968) (-2307.547) -- 0:00:07
975000 -- (-2306.704) (-2311.743) [-2304.734] (-2311.673) * (-2304.132) [-2306.767] (-2302.144) (-2304.986) -- 0:00:07
Average standard deviation of split frequencies: 0.007052
975500 -- (-2316.851) (-2298.104) [-2306.538] (-2307.871) * (-2310.827) (-2309.999) (-2309.245) [-2298.954] -- 0:00:07
976000 -- (-2308.185) [-2303.591] (-2300.411) (-2310.055) * (-2307.954) (-2299.602) [-2308.403] (-2310.577) -- 0:00:07
976500 -- (-2307.825) [-2301.122] (-2298.975) (-2312.114) * (-2309.482) [-2298.958] (-2311.063) (-2307.156) -- 0:00:07
977000 -- (-2305.284) (-2299.831) [-2306.003] (-2315.781) * [-2296.721] (-2324.225) (-2319.432) (-2301.742) -- 0:00:07
977500 -- (-2310.148) [-2296.862] (-2310.085) (-2316.935) * [-2303.832] (-2309.472) (-2320.045) (-2308.724) -- 0:00:07
978000 -- (-2314.674) (-2305.139) [-2307.060] (-2308.597) * (-2303.449) (-2311.861) (-2313.575) [-2302.964] -- 0:00:06
978500 -- [-2314.760] (-2306.577) (-2306.891) (-2305.244) * (-2311.281) (-2312.918) [-2310.809] (-2311.802) -- 0:00:06
979000 -- [-2301.669] (-2312.546) (-2303.790) (-2308.335) * (-2301.220) (-2309.790) [-2307.778] (-2301.732) -- 0:00:06
979500 -- (-2304.999) (-2306.558) (-2304.985) [-2307.786] * (-2307.390) (-2309.413) (-2310.882) [-2303.751] -- 0:00:06
980000 -- (-2315.158) (-2303.409) [-2307.209] (-2318.893) * (-2306.558) (-2303.567) (-2314.204) [-2308.235] -- 0:00:06
Average standard deviation of split frequencies: 0.006313
980500 -- (-2299.199) [-2306.687] (-2314.967) (-2318.742) * (-2312.250) (-2303.262) [-2299.923] (-2317.644) -- 0:00:06
981000 -- [-2305.286] (-2306.763) (-2304.386) (-2325.598) * [-2303.215] (-2308.485) (-2297.226) (-2321.930) -- 0:00:05
981500 -- (-2313.464) (-2321.556) (-2304.321) [-2304.461] * [-2303.899] (-2302.547) (-2296.992) (-2317.037) -- 0:00:05
982000 -- (-2309.921) (-2319.779) [-2311.633] (-2312.994) * (-2313.442) (-2303.069) [-2306.979] (-2327.992) -- 0:00:05
982500 -- (-2320.895) (-2322.002) [-2313.924] (-2313.622) * (-2304.138) (-2311.990) [-2304.099] (-2320.702) -- 0:00:05
983000 -- (-2306.129) (-2320.134) [-2304.682] (-2308.722) * [-2310.520] (-2297.776) (-2297.355) (-2323.414) -- 0:00:05
983500 -- (-2318.879) (-2313.220) (-2297.222) [-2307.569] * (-2309.829) [-2302.994] (-2308.929) (-2316.740) -- 0:00:05
984000 -- [-2310.359] (-2308.385) (-2311.236) (-2314.637) * (-2314.440) (-2297.235) [-2311.971] (-2311.736) -- 0:00:04
984500 -- (-2312.056) (-2302.590) (-2311.690) [-2310.476] * [-2301.528] (-2313.264) (-2311.921) (-2308.693) -- 0:00:04
985000 -- (-2318.295) [-2310.988] (-2307.236) (-2305.528) * (-2306.015) [-2297.903] (-2309.805) (-2308.078) -- 0:00:04
Average standard deviation of split frequencies: 0.006375
985500 -- (-2311.781) (-2304.569) (-2313.004) [-2311.162] * (-2308.724) [-2304.142] (-2312.443) (-2311.140) -- 0:00:04
986000 -- (-2322.082) [-2304.138] (-2310.157) (-2316.541) * (-2301.332) [-2299.162] (-2311.359) (-2309.228) -- 0:00:04
986500 -- (-2310.633) (-2310.314) (-2308.244) [-2309.344] * (-2306.822) (-2310.578) (-2303.613) [-2305.284] -- 0:00:04
987000 -- [-2301.731] (-2307.547) (-2308.609) (-2306.177) * [-2302.256] (-2312.295) (-2309.597) (-2308.891) -- 0:00:04
987500 -- (-2307.990) [-2296.701] (-2307.133) (-2303.362) * [-2306.598] (-2316.750) (-2301.504) (-2314.223) -- 0:00:03
988000 -- (-2317.540) (-2310.449) [-2311.259] (-2321.704) * (-2298.404) [-2318.985] (-2297.304) (-2316.742) -- 0:00:03
988500 -- (-2308.982) (-2304.816) [-2309.186] (-2316.343) * [-2301.020] (-2316.497) (-2303.272) (-2302.421) -- 0:00:03
989000 -- (-2311.911) [-2311.078] (-2313.513) (-2317.583) * (-2303.540) (-2312.347) (-2306.146) [-2302.562] -- 0:00:03
989500 -- (-2312.900) [-2302.285] (-2313.047) (-2303.676) * (-2312.612) (-2311.762) (-2306.138) [-2303.080] -- 0:00:03
990000 -- (-2304.058) (-2314.607) (-2317.245) [-2304.131] * (-2312.633) (-2315.339) [-2309.889] (-2299.421) -- 0:00:03
Average standard deviation of split frequencies: 0.005869
990500 -- (-2314.598) [-2307.013] (-2321.482) (-2302.592) * [-2299.535] (-2308.442) (-2333.497) (-2313.557) -- 0:00:02
991000 -- (-2300.041) (-2308.462) (-2305.110) [-2297.872] * (-2300.748) (-2321.036) [-2311.585] (-2301.922) -- 0:00:02
991500 -- (-2302.347) [-2308.933] (-2304.451) (-2303.376) * [-2302.436] (-2316.688) (-2308.240) (-2305.389) -- 0:00:02
992000 -- (-2302.886) (-2307.543) (-2304.939) [-2297.228] * [-2303.272] (-2308.226) (-2309.797) (-2313.130) -- 0:00:02
992500 -- (-2319.592) (-2307.461) [-2302.885] (-2313.796) * (-2299.712) (-2302.860) [-2311.166] (-2306.611) -- 0:00:02
993000 -- (-2324.858) (-2312.804) [-2298.733] (-2297.082) * [-2296.760] (-2305.244) (-2318.362) (-2305.876) -- 0:00:02
993500 -- [-2302.339] (-2322.281) (-2306.293) (-2308.393) * (-2304.940) [-2307.979] (-2318.954) (-2318.512) -- 0:00:02
994000 -- (-2313.696) [-2309.413] (-2308.013) (-2302.742) * (-2301.031) [-2303.504] (-2322.781) (-2320.897) -- 0:00:01
994500 -- (-2317.016) (-2305.296) (-2306.674) [-2303.084] * (-2306.354) [-2298.982] (-2306.394) (-2321.953) -- 0:00:01
995000 -- (-2315.169) [-2307.831] (-2299.416) (-2304.725) * [-2303.554] (-2308.471) (-2310.493) (-2308.142) -- 0:00:01
Average standard deviation of split frequencies: 0.006342
995500 -- (-2306.718) (-2308.049) [-2293.499] (-2296.331) * (-2308.062) (-2309.247) (-2314.845) [-2308.537] -- 0:00:01
996000 -- [-2304.164] (-2322.444) (-2304.048) (-2310.083) * [-2302.106] (-2304.576) (-2302.917) (-2306.820) -- 0:00:01
996500 -- (-2308.142) [-2302.584] (-2301.187) (-2306.708) * (-2313.730) (-2310.129) (-2303.828) [-2306.271] -- 0:00:01
997000 -- (-2315.371) [-2296.689] (-2306.914) (-2313.024) * (-2315.121) (-2305.812) [-2304.925] (-2302.067) -- 0:00:00
997500 -- (-2317.540) [-2306.345] (-2311.356) (-2311.673) * [-2315.370] (-2310.011) (-2305.228) (-2305.641) -- 0:00:00
998000 -- (-2302.755) (-2310.296) [-2301.335] (-2319.297) * (-2304.496) (-2307.830) (-2306.667) [-2301.716] -- 0:00:00
998500 -- (-2306.706) [-2312.547] (-2316.621) (-2309.815) * (-2324.879) [-2303.849] (-2309.647) (-2297.761) -- 0:00:00
999000 -- [-2302.969] (-2312.200) (-2312.187) (-2313.735) * (-2308.131) [-2298.258] (-2301.384) (-2294.992) -- 0:00:00
999500 -- (-2310.358) (-2324.269) (-2315.829) [-2303.657] * (-2306.928) (-2308.413) [-2300.508] (-2309.483) -- 0:00:00
1000000 -- (-2308.784) (-2300.761) [-2309.097] (-2312.786) * (-2298.239) (-2319.425) (-2301.788) [-2299.525] -- 0:00:00
Average standard deviation of split frequencies: 0.006407
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2308.784064 -- 27.512407
Chain 1 -- -2308.784043 -- 27.512407
Chain 2 -- -2300.760772 -- 21.526420
Chain 2 -- -2300.760772 -- 21.526420
Chain 3 -- -2309.097405 -- 26.428847
Chain 3 -- -2309.097420 -- 26.428847
Chain 4 -- -2312.786153 -- 26.494225
Chain 4 -- -2312.786134 -- 26.494225
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2298.238739 -- 27.079635
Chain 1 -- -2298.238750 -- 27.079635
Chain 2 -- -2319.424532 -- 22.173796
Chain 2 -- -2319.424501 -- 22.173796
Chain 3 -- -2301.787771 -- 29.188268
Chain 3 -- -2301.787773 -- 29.188268
Chain 4 -- -2299.524500 -- 24.433639
Chain 4 -- -2299.524491 -- 24.433639
Analysis completed in 5 mins 12 seconds
Analysis used 311.34 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2289.08
Likelihood of best state for "cold" chain of run 2 was -2289.08
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
48.5 % ( 34 %) Dirichlet(Revmat{all})
64.3 % ( 49 %) Slider(Revmat{all})
24.5 % ( 30 %) Dirichlet(Pi{all})
27.0 % ( 21 %) Slider(Pi{all})
55.5 % ( 32 %) Multiplier(Alpha{1,2})
45.5 % ( 28 %) Multiplier(Alpha{3})
33.4 % ( 22 %) Slider(Pinvar{all})
14.5 % ( 14 %) ExtSPR(Tau{all},V{all})
4.5 % ( 6 %) ExtTBR(Tau{all},V{all})
20.4 % ( 21 %) NNI(Tau{all},V{all})
18.2 % ( 23 %) ParsSPR(Tau{all},V{all})
26.9 % ( 29 %) Multiplier(V{all})
44.4 % ( 48 %) Nodeslider(V{all})
25.9 % ( 28 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
49.8 % ( 34 %) Dirichlet(Revmat{all})
65.1 % ( 53 %) Slider(Revmat{all})
24.4 % ( 25 %) Dirichlet(Pi{all})
27.2 % ( 15 %) Slider(Pi{all})
55.1 % ( 35 %) Multiplier(Alpha{1,2})
45.2 % ( 30 %) Multiplier(Alpha{3})
33.5 % ( 29 %) Slider(Pinvar{all})
14.3 % ( 10 %) ExtSPR(Tau{all},V{all})
4.5 % ( 2 %) ExtTBR(Tau{all},V{all})
20.4 % ( 25 %) NNI(Tau{all},V{all})
18.2 % ( 17 %) ParsSPR(Tau{all},V{all})
26.8 % ( 25 %) Multiplier(V{all})
44.2 % ( 43 %) Nodeslider(V{all})
26.1 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.51 0.35
2 | 166649 0.75 0.55
3 | 166166 166620 0.77
4 | 166773 166770 167022
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.51 0.34
2 | 167136 0.75 0.54
3 | 166296 166686 0.77
4 | 166519 167039 166324
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2302.57
| 2 2 1 |
| |
| 1 1 1 |
| 2 1 2 2 1 2 1 2 |
|2 2 2 1 11 11 22 1 2 1|
| 2 21 2 11 1 22 2 |
| 2 21 1 211 |
| 1 1 1 1 1 22 2 1 222* 2|
| 1 1 1 2 2 21 2 2* 1 11 |
| 1 1 2 2 2 1 2 |
| * 11 2 1 2 2 21 1 |
| 1 1 1 2 2 1 * |
|12 2*2 2 2 1 1 2 |
| 1 1 2 |
| 2 2 22 1 11 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2306.95
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2298.26 -2318.69
2 -2298.43 -2317.24
--------------------------------------
TOTAL -2298.34 -2318.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.385422 0.003186 0.285139 0.501020 0.382228 1256.91 1270.69 1.000
r(A<->C){all} 0.117348 0.001195 0.053253 0.186696 0.114094 777.46 817.87 1.000
r(A<->G){all} 0.260672 0.003090 0.155466 0.363654 0.256585 551.21 719.48 1.000
r(A<->T){all} 0.122000 0.001662 0.051686 0.206977 0.118424 748.03 786.59 1.000
r(C<->G){all} 0.063051 0.000408 0.024987 0.103635 0.060645 843.36 965.71 1.002
r(C<->T){all} 0.426503 0.003724 0.309816 0.545263 0.424279 605.28 705.98 1.000
r(G<->T){all} 0.010426 0.000095 0.000007 0.029784 0.007550 897.68 1025.79 1.001
pi(A){all} 0.239497 0.000153 0.215039 0.262443 0.239234 1234.44 1241.30 1.000
pi(C){all} 0.303275 0.000174 0.278360 0.329285 0.303265 1166.91 1250.79 1.000
pi(G){all} 0.270450 0.000176 0.243600 0.295813 0.270446 1157.68 1165.09 1.000
pi(T){all} 0.186778 0.000117 0.166299 0.208001 0.186486 1178.36 1245.65 1.000
alpha{1,2} 0.046951 0.000666 0.000101 0.087423 0.049117 1057.99 1154.03 1.000
alpha{3} 2.367067 0.660360 1.003678 3.947117 2.222249 1408.85 1454.92 1.000
pinvar{all} 0.765000 0.000593 0.717879 0.811266 0.765715 1366.61 1411.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- ....*******
13 -- .........**
14 -- ...********
15 -- .....**....
16 -- ..*********
17 -- .....**.***
18 -- ........***
19 -- ....*..*...
20 -- .....**..**
21 -- .....******
22 -- ....****.**
23 -- ....***.***
24 -- .....***.**
25 -- .**........
26 -- .*.********
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2999 0.999001 0.001413 0.998001 1.000000 2
13 2995 0.997668 0.000471 0.997335 0.998001 2
14 2977 0.991672 0.002355 0.990007 0.993338 2
15 2423 0.807129 0.008009 0.801466 0.812791 2
16 2313 0.770486 0.009893 0.763491 0.777482 2
17 2168 0.722185 0.010364 0.714857 0.729514 2
18 1682 0.560293 0.017901 0.547635 0.572951 2
19 1084 0.361093 0.008480 0.355097 0.367089 2
20 1067 0.355430 0.007066 0.350433 0.360426 2
21 839 0.279480 0.008951 0.273151 0.285809 2
22 739 0.246169 0.008009 0.240506 0.251832 2
23 563 0.187542 0.002355 0.185876 0.189207 2
24 399 0.132911 0.000471 0.132578 0.133245 2
25 341 0.113591 0.008951 0.107262 0.119920 2
26 339 0.112925 0.001413 0.111925 0.113924 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.017526 0.000039 0.005871 0.029131 0.016732 1.000 2
length{all}[2] 0.003780 0.000008 0.000000 0.009116 0.003144 1.000 2
length{all}[3] 0.002002 0.000004 0.000000 0.006080 0.001355 1.000 2
length{all}[4] 0.005081 0.000013 0.000016 0.012170 0.004290 1.000 2
length{all}[5] 0.027912 0.000112 0.010960 0.049975 0.026535 1.000 2
length{all}[6] 0.019548 0.000053 0.006540 0.033655 0.018576 1.000 2
length{all}[7] 0.006694 0.000017 0.000553 0.014812 0.005896 1.000 2
length{all}[8] 0.077529 0.000426 0.041771 0.118135 0.075209 1.000 2
length{all}[9] 0.098518 0.000657 0.053545 0.150567 0.095634 1.000 2
length{all}[10] 0.008892 0.000028 0.000106 0.018857 0.008040 1.000 2
length{all}[11] 0.017115 0.000050 0.005005 0.031345 0.016126 1.000 2
length{all}[12] 0.031543 0.000172 0.005810 0.056115 0.030522 1.000 2
length{all}[13] 0.022146 0.000100 0.003866 0.041489 0.020808 1.001 2
length{all}[14] 0.008352 0.000020 0.001080 0.017436 0.007636 1.000 2
length{all}[15] 0.006499 0.000022 0.000019 0.015580 0.005481 1.001 2
length{all}[16] 0.003692 0.000008 0.000008 0.009028 0.003024 1.000 2
length{all}[17] 0.012376 0.000042 0.001396 0.025125 0.011490 1.000 2
length{all}[18] 0.011427 0.000059 0.000150 0.025872 0.010069 1.000 2
length{all}[19] 0.005913 0.000029 0.000018 0.015564 0.004381 1.001 2
length{all}[20] 0.010192 0.000044 0.000063 0.023431 0.009342 0.999 2
length{all}[21] 0.005814 0.000027 0.000004 0.016092 0.004457 0.999 2
length{all}[22] 0.017008 0.000091 0.000799 0.034729 0.015974 1.000 2
length{all}[23] 0.005180 0.000025 0.000008 0.015775 0.003618 0.999 2
length{all}[24] 0.007084 0.000028 0.000013 0.017067 0.005878 1.000 2
length{all}[25] 0.002021 0.000004 0.000015 0.005911 0.001458 0.997 2
length{all}[26] 0.001863 0.000003 0.000000 0.005411 0.001343 1.012 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006407
Maximum standard deviation of split frequencies = 0.017901
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.012
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
+ /------------------------------------------------------------ C3 (3)
| |
| | /-------------------------------------------------- C4 (4)
\----77---+ |
| | /---------------------------------------- C5 (5)
| | |
\----99---+ | /---------- C6 (6)
| | /---------81--------+
| | | \---------- C7 (7)
| | |
\---100---+----72---+ /-------------------- C9 (9)
| | |
| \----56---+ /---------- C10 (10)
| \---100---+
| \---------- C11 (11)
|
\---------------------------------------- C8 (8)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
|- C2 (2)
|
+/- C3 (3)
||
|| /-- C4 (4)
\+ |
| | /------------ C5 (5)
| | |
\---+ | /--------- C6 (6)
| | /-+
| | | \--- C7 (7)
| | |
\-------------+----+ /------------------------------------------- C9 (9)
| | |
| \----+ /---- C10 (10)
| \--------+
| \------- C11 (11)
|
\---------------------------------- C8 (8)
|--------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (223 trees sampled):
50 % credible set contains 6 trees
90 % credible set contains 58 trees
95 % credible set contains 100 trees
99 % credible set contains 193 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 1128
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sequences read..
Counting site patterns.. 0:00
139 patterns at 376 / 376 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
135664 bytes for conP
18904 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
542656 bytes for conP, adjusted
0.019951 0.004541 0.001692 0.000981 0.007147 0.005956 0.035219 0.034399 0.006571 0.006303 0.020203 0.009885 0.002623 0.074172 0.024551 0.012550 0.017542 0.073391 0.300000 1.300000
ntime & nrate & np: 18 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 20
lnL0 = -2541.397995
Iterating by ming2
Initial: fx= 2541.397995
x= 0.01995 0.00454 0.00169 0.00098 0.00715 0.00596 0.03522 0.03440 0.00657 0.00630 0.02020 0.00988 0.00262 0.07417 0.02455 0.01255 0.01754 0.07339 0.30000 1.30000
1 h-m-p 0.0000 0.0000 964.6370 ++ 2539.522028 m 0.0000 25 | 1/20
2 h-m-p 0.0000 0.0000 485.4622 +YYYCCC 2537.236565 5 0.0000 56 | 1/20
3 h-m-p 0.0000 0.0000 1140.2913 YCYCCC 2535.835815 5 0.0000 87 | 1/20
4 h-m-p 0.0000 0.0000 882.4833 +YYYYYYC 2531.748962 6 0.0000 117 | 1/20
5 h-m-p 0.0000 0.0000 5073.7350 YCCCC 2529.068129 4 0.0000 147 | 1/20
6 h-m-p 0.0000 0.0001 1458.6996 ++ 2509.909885 m 0.0001 170 | 1/20
7 h-m-p 0.0000 0.0000 69776.7574 +YYYCCC 2502.198612 5 0.0000 201 | 1/20
8 h-m-p 0.0000 0.0000 34138.5113 +YYYCCC 2491.094683 5 0.0000 232 | 1/20
9 h-m-p 0.0000 0.0001 3081.4528 ++ 2478.423065 m 0.0001 255 | 1/20
10 h-m-p 0.0000 0.0001 1282.3534 +YYCYCC 2463.402245 5 0.0001 286 | 1/20
11 h-m-p 0.0000 0.0001 898.0862 YCYCCC 2456.669544 5 0.0001 317 | 1/20
12 h-m-p 0.0001 0.0003 871.9044 CCCC 2453.161267 3 0.0001 346 | 1/20
13 h-m-p 0.0000 0.0001 1259.9990 CYCCC 2447.344719 4 0.0001 376 | 1/20
14 h-m-p 0.0001 0.0006 265.0465 YCCCCC 2443.412638 5 0.0002 408 | 1/20
15 h-m-p 0.0000 0.0004 1541.9976 ++ 2413.477246 m 0.0004 431 | 1/20
16 h-m-p 0.0000 0.0000 23319.5985
h-m-p: 3.30827649e-20 1.65413825e-19 2.33195985e+04 2413.477246
.. | 1/20
17 h-m-p 0.0000 0.0000 861977.3399 --YCYYCYYCCC 2363.386333 9 0.0000 490 | 1/20
18 h-m-p 0.0000 0.0000 2899.1618 +YCCCC 2344.065875 4 0.0000 521 | 1/20
19 h-m-p 0.0000 0.0001 745.7689 +CYYCCC 2325.989782 5 0.0001 553 | 1/20
20 h-m-p 0.0000 0.0000 1920.0139 +YYCCC 2322.188752 4 0.0000 583 | 1/20
21 h-m-p 0.0000 0.0000 2277.8351 +YCYCCC 2315.136740 5 0.0000 615 | 1/20
22 h-m-p 0.0000 0.0000 1057.7161 +YYCYCCC 2309.651088 6 0.0000 648 | 1/20
23 h-m-p 0.0000 0.0000 6052.4973 YCCCC 2305.953758 4 0.0000 678 | 1/20
24 h-m-p 0.0000 0.0001 865.4865 +YYCCCC 2299.132920 5 0.0001 710 | 1/20
25 h-m-p 0.0000 0.0000 2692.8321 ++ 2283.552577 m 0.0000 733 | 1/20
26 h-m-p -0.0000 -0.0000 14565.5622
h-m-p: -2.02690971e-21 -1.01345486e-20 1.45655622e+04 2283.552577
.. | 1/20
27 h-m-p 0.0000 0.0000 2734.4419 YYCYC 2276.747748 4 0.0000 781 | 1/20
28 h-m-p 0.0000 0.0000 748.0725 ++ 2264.911344 m 0.0000 804 | 1/20
29 h-m-p 0.0000 0.0000 12180.4260 +YCYCCC 2255.634479 5 0.0000 836 | 1/20
30 h-m-p 0.0000 0.0000 4001.1706 +YYCYYCCC 2248.842345 7 0.0000 870 | 1/20
31 h-m-p 0.0000 0.0000 1426.5104 +CYCCCCC 2238.848512 6 0.0000 905 | 1/20
32 h-m-p 0.0000 0.0000 61617.2215 +YYCCC 2233.836581 4 0.0000 935 | 1/20
33 h-m-p 0.0000 0.0000 4739.2438 ++ 2224.347686 m 0.0000 958 | 2/20
34 h-m-p 0.0000 0.0001 681.6959 CCC 2224.010527 2 0.0000 985 | 2/20
35 h-m-p 0.0001 0.0004 106.0142 +YYCCC 2218.609551 4 0.0002 1015 | 2/20
36 h-m-p 0.0000 0.0002 231.0942 CCCC 2217.531818 3 0.0001 1044 | 2/20
37 h-m-p 0.0000 0.0002 126.9499 CCCC 2217.106771 3 0.0001 1073 | 2/20
38 h-m-p 0.0001 0.0004 65.6360 YYY 2216.983147 2 0.0001 1098 | 2/20
39 h-m-p 0.0001 0.0016 76.2109 YCC 2216.839492 2 0.0001 1124 | 2/20
40 h-m-p 0.0003 0.0053 28.4475 CC 2216.757067 1 0.0003 1149 | 2/20
41 h-m-p 0.0002 0.0160 50.0956 +CCC 2216.508095 2 0.0007 1177 | 2/20
42 h-m-p 0.0001 0.0045 317.8024 ++YYYC 2213.000524 3 0.0016 1205 | 2/20
43 h-m-p 0.0001 0.0003 1001.6957 CCC 2212.597729 2 0.0001 1232 | 2/20
44 h-m-p 0.0008 0.0040 39.4194 CCC 2212.524672 2 0.0003 1259 | 2/20
45 h-m-p 0.0044 0.0326 2.5831 --CC 2212.524217 1 0.0001 1286 | 2/20
46 h-m-p 0.0095 4.7668 0.1340 ++++YCCC 2209.711243 3 1.5724 1318 | 2/20
47 h-m-p 1.6000 8.0000 0.0548 CCCC 2208.593812 3 2.4762 1365 | 2/20
48 h-m-p 1.2198 6.0992 0.0270 CCC 2208.183160 2 1.3981 1410 | 2/20
49 h-m-p 1.5407 7.7033 0.0227 CCCC 2208.019859 3 1.7005 1457 | 2/20
50 h-m-p 0.7995 8.0000 0.0483 YC 2207.916676 1 1.8229 1499 | 2/20
51 h-m-p 1.6000 8.0000 0.0030 CC 2207.902180 1 1.3101 1542 | 2/20
52 h-m-p 0.3185 8.0000 0.0123 +YC 2207.886034 1 2.7899 1585 | 2/20
53 h-m-p 1.6000 8.0000 0.0108 C 2207.875527 0 1.6528 1626 | 2/20
54 h-m-p 1.6000 8.0000 0.0028 YC 2207.864235 1 2.9925 1668 | 2/20
55 h-m-p 0.8004 8.0000 0.0103 +C 2207.838932 0 3.3771 1710 | 2/20
56 h-m-p 1.6000 8.0000 0.0009 CC 2207.830965 1 1.3892 1753 | 2/20
57 h-m-p 0.2314 8.0000 0.0053 ++YC 2207.823059 1 2.9371 1797 | 2/20
58 h-m-p 1.6000 8.0000 0.0007 YC 2207.821012 1 1.0879 1839 | 2/20
59 h-m-p 1.6000 8.0000 0.0003 C 2207.820767 0 1.3840 1880 | 2/20
60 h-m-p 1.6000 8.0000 0.0001 +YC 2207.820576 1 4.1925 1923 | 2/20
61 h-m-p 1.5738 8.0000 0.0003 YC 2207.820234 1 3.2894 1965 | 2/20
62 h-m-p 1.6000 8.0000 0.0002 Y 2207.820223 0 1.0985 2006 | 2/20
63 h-m-p 1.6000 8.0000 0.0000 +C 2207.820217 0 6.1485 2048 | 2/20
64 h-m-p 0.4272 8.0000 0.0001 +Y 2207.820215 0 1.2694 2090 | 2/20
65 h-m-p 1.6000 8.0000 0.0000 C 2207.820215 0 1.6000 2131 | 2/20
66 h-m-p 1.6000 8.0000 0.0000 -Y 2207.820215 0 0.1925 2173 | 2/20
67 h-m-p 0.2215 8.0000 0.0000 Y 2207.820215 0 0.0400 2214 | 2/20
68 h-m-p 0.0401 8.0000 0.0000 -------C 2207.820215 0 0.0000 2262
Out..
lnL = -2207.820215
2263 lfun, 2263 eigenQcodon, 40734 P(t)
Time used: 0:13
Model 1: NearlyNeutral
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
0.019951 0.004541 0.001692 0.000981 0.007147 0.005956 0.035219 0.034399 0.006571 0.006303 0.020203 0.009885 0.002623 0.074172 0.024551 0.012550 0.017542 0.073391 2.044293 0.652999 0.498354
ntime & nrate & np: 18 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.216266
np = 21
lnL0 = -2374.523610
Iterating by ming2
Initial: fx= 2374.523610
x= 0.01995 0.00454 0.00169 0.00098 0.00715 0.00596 0.03522 0.03440 0.00657 0.00630 0.02020 0.00988 0.00262 0.07417 0.02455 0.01255 0.01754 0.07339 2.04429 0.65300 0.49835
1 h-m-p 0.0000 0.0000 904.3001 ++ 2372.810427 m 0.0000 26 | 1/21
2 h-m-p 0.0000 0.0000 383.2548 YCYCCC 2371.640084 5 0.0000 58 | 1/21
3 h-m-p 0.0000 0.0000 635.3991 CCC 2371.238753 2 0.0000 86 | 1/21
4 h-m-p 0.0000 0.0001 393.3400 YCYC 2370.666535 3 0.0000 114 | 1/21
5 h-m-p 0.0000 0.0001 494.5464 +YYCCC 2368.871540 4 0.0000 145 | 1/21
6 h-m-p 0.0000 0.0002 624.6198 +YYCCC 2362.679777 4 0.0001 176 | 1/21
7 h-m-p 0.0000 0.0001 3954.7437 ++ 2334.224749 m 0.0001 200 | 1/21
8 h-m-p -0.0000 -0.0000 73761.6828
h-m-p: -9.03273270e-22 -4.51636635e-21 7.37616828e+04 2334.224749
.. | 1/21
9 h-m-p 0.0000 0.0001 76734.7320 -CYCYYYCC 2319.718092 7 0.0000 256 | 1/21
10 h-m-p 0.0000 0.0001 594.0059 +YCCC 2312.565378 3 0.0001 286 | 1/21
11 h-m-p 0.0000 0.0001 895.0398 +CCCCC 2298.604343 4 0.0001 320 | 1/21
12 h-m-p 0.0000 0.0000 3541.0166 +YCCCC 2292.464436 4 0.0000 352 | 1/21
13 h-m-p 0.0000 0.0000 1865.8388 +YYCCC 2281.338290 4 0.0000 383 | 1/21
14 h-m-p 0.0000 0.0000 4326.8737 +YYCCCC 2268.454365 5 0.0000 416 | 1/21
15 h-m-p 0.0000 0.0000 4542.5340 ++ 2252.420485 m 0.0000 440 | 2/21
16 h-m-p 0.0000 0.0000 1046.3666 ++ 2250.967296 m 0.0000 464 | 3/21
17 h-m-p 0.0000 0.0000 1001.6972 CYCCC 2249.169304 4 0.0000 495 | 3/21
18 h-m-p 0.0000 0.0000 266.5792 +YYCYCCC 2244.528659 6 0.0000 529 | 3/21
19 h-m-p 0.0000 0.0000 1342.4578 +YYCCCC 2240.995586 5 0.0000 562 | 3/21
20 h-m-p 0.0000 0.0001 1231.3366 CCC 2236.775578 2 0.0000 590 | 3/21
21 h-m-p 0.0000 0.0002 191.1540 YCCCC 2235.288520 4 0.0001 621 | 3/21
22 h-m-p 0.0001 0.0006 34.6785 CCCCC 2234.907437 4 0.0002 653 | 3/21
23 h-m-p 0.0001 0.0003 39.3915 +YCYCCC 2233.356184 5 0.0002 686 | 3/21
24 h-m-p 0.0001 0.0003 116.0269 YYC 2233.015664 2 0.0000 712 | 3/21
25 h-m-p 0.0000 0.0002 51.0682 YCC 2232.974366 2 0.0000 739 | 3/21
26 h-m-p 0.0004 0.0042 4.3743 CYC 2232.962196 2 0.0003 766 | 3/21
27 h-m-p 0.0001 0.0132 24.8604 +CCC 2232.884114 2 0.0003 795 | 3/21
28 h-m-p 0.0003 0.0266 27.2513 +++CYYYC 2223.192418 4 0.0216 827 | 3/21
29 h-m-p 0.1517 0.7586 0.7744 +YYCCC 2213.808904 4 0.4801 858 | 3/21
30 h-m-p 0.2308 1.4302 1.6108 CCCCC 2212.732456 4 0.2982 908 | 3/21
31 h-m-p 0.5286 2.6429 0.3105 YCCC 2210.539267 3 0.9416 937 | 3/21
32 h-m-p 0.3335 1.6674 0.0625 YCYCCC 2209.490504 5 0.8474 987 | 3/21
33 h-m-p 0.4091 2.0455 0.1138 CCCC 2208.620781 3 0.6297 1035 | 3/21
34 h-m-p 1.3592 6.7962 0.0447 CCCC 2208.359641 3 1.0440 1083 | 3/21
35 h-m-p 1.6000 8.0000 0.0257 CCC 2208.164351 2 2.3567 1129 | 3/21
36 h-m-p 1.6000 8.0000 0.0263 YCC 2208.001563 2 3.0555 1174 | 3/21
37 h-m-p 1.6000 8.0000 0.0020 CC 2207.907065 1 2.4112 1218 | 3/21
38 h-m-p 0.3307 8.0000 0.0146 +CCC 2207.837325 2 2.0813 1265 | 3/21
39 h-m-p 1.6000 8.0000 0.0036 YC 2207.810327 1 3.2923 1308 | 3/21
40 h-m-p 1.6000 8.0000 0.0013 YC 2207.790751 1 2.8269 1351 | 3/21
41 h-m-p 1.6000 8.0000 0.0011 YC 2207.780329 1 2.5858 1394 | 3/21
42 h-m-p 1.6000 8.0000 0.0013 C 2207.777365 0 1.6000 1436 | 3/21
43 h-m-p 1.6000 8.0000 0.0002 C 2207.776732 0 1.6446 1478 | 3/21
44 h-m-p 0.6333 8.0000 0.0006 +C 2207.776425 0 2.5313 1521 | 3/21
45 h-m-p 1.6000 8.0000 0.0007 C 2207.776330 0 1.9079 1563 | 3/21
46 h-m-p 1.6000 8.0000 0.0003 Y 2207.776297 0 3.8310 1605 | 3/21
47 h-m-p 1.6000 8.0000 0.0004 Y 2207.776259 0 3.3821 1647 | 3/21
48 h-m-p 1.6000 8.0000 0.0002 Y 2207.776233 0 3.5277 1689 | 3/21
49 h-m-p 1.6000 8.0000 0.0000 +C 2207.776183 0 6.1395 1732 | 3/21
50 h-m-p 1.3727 8.0000 0.0001 Y 2207.776140 0 3.2822 1774 | 3/21
51 h-m-p 1.3921 8.0000 0.0003 +Y 2207.776047 0 6.1576 1817 | 3/21
52 h-m-p 1.6000 8.0000 0.0002 +YC 2207.775830 1 4.3235 1861 | 3/21
53 h-m-p 1.6000 8.0000 0.0004 C 2207.775792 0 1.6917 1903 | 3/21
54 h-m-p 1.6000 8.0000 0.0003 Y 2207.775789 0 1.2356 1945 | 3/21
55 h-m-p 1.6000 8.0000 0.0000 C 2207.775789 0 1.2944 1987 | 3/21
56 h-m-p 1.6000 8.0000 0.0000 Y 2207.775789 0 0.7705 2029 | 3/21
57 h-m-p 1.6000 8.0000 0.0000 --Y 2207.775789 0 0.0250 2073
Out..
lnL = -2207.775789
2074 lfun, 6222 eigenQcodon, 74664 P(t)
Time used: 0:38
Model 2: PositiveSelection
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
initial w for M2:NSpselection reset.
0.019951 0.004541 0.001692 0.000981 0.007147 0.005956 0.035219 0.034399 0.006571 0.006303 0.020203 0.009885 0.002623 0.074172 0.024551 0.012550 0.017542 0.073391 2.043678 1.001601 0.301958 0.109127 2.014820
ntime & nrate & np: 18 3 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.923918
np = 23
lnL0 = -2370.520827
Iterating by ming2
Initial: fx= 2370.520827
x= 0.01995 0.00454 0.00169 0.00098 0.00715 0.00596 0.03522 0.03440 0.00657 0.00630 0.02020 0.00988 0.00262 0.07417 0.02455 0.01255 0.01754 0.07339 2.04368 1.00160 0.30196 0.10913 2.01482
1 h-m-p 0.0000 0.0000 990.1527 ++ 2368.196957 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0000 467.4814 +YYCCC 2365.980668 4 0.0000 61 | 1/23
3 h-m-p 0.0000 0.0000 1435.8289 CCC 2365.209465 2 0.0000 91 | 1/23
4 h-m-p 0.0000 0.0005 428.2490 +YYCCC 2362.919117 4 0.0001 124 | 1/23
5 h-m-p 0.0000 0.0002 478.0117 +YYCCC 2357.681870 4 0.0001 157 | 1/23
6 h-m-p 0.0000 0.0001 602.8565 ++ 2347.952062 m 0.0001 183 | 2/23
7 h-m-p 0.0001 0.0004 779.0651 CYCCC 2346.921128 4 0.0000 216 | 2/23
8 h-m-p 0.0000 0.0002 361.4385 YCCCC 2345.849220 4 0.0001 249 | 2/23
9 h-m-p 0.0000 0.0002 480.3671 YCYCCC 2344.042076 5 0.0001 283 | 2/23
10 h-m-p 0.0001 0.0004 835.7465 +YYYCCCC 2336.994795 6 0.0003 319 | 2/23
11 h-m-p 0.0000 0.0000 8797.8372 +YYCCC 2332.409756 4 0.0000 352 | 2/23
12 h-m-p 0.0001 0.0004 967.5350 +YYYYC 2322.204220 4 0.0003 383 | 2/23
13 h-m-p 0.0000 0.0002 596.4142 +YCCC 2320.472847 3 0.0001 415 | 2/23
14 h-m-p 0.0001 0.0005 128.3023 +CYC 2318.774078 2 0.0004 445 | 2/23
15 h-m-p 0.0002 0.0012 194.0407 YCYCCC 2313.971592 5 0.0006 479 | 2/23
16 h-m-p 0.0001 0.0006 537.7668 YCYCCC 2307.152769 5 0.0003 513 | 2/23
17 h-m-p 0.0002 0.0008 413.7150 CYCCC 2301.475133 4 0.0003 546 | 2/23
18 h-m-p 0.0001 0.0007 103.4523 CYCCC 2300.030908 4 0.0003 579 | 2/23
19 h-m-p 0.0001 0.0007 250.3219 YCYCCC 2296.369743 5 0.0003 613 | 2/23
20 h-m-p 0.0203 1.6717 4.1511 ++YYCCCC 2276.331427 5 0.5162 649 | 2/23
21 h-m-p 0.0101 0.0503 16.3797 +YCYCCC 2269.670005 5 0.0275 684 | 2/23
22 h-m-p 0.0041 0.0207 29.5825 +YYCCC 2264.840009 4 0.0142 717 | 2/23
23 h-m-p 0.0697 0.3487 4.0406 YCYCCC 2254.208826 5 0.1763 751 | 2/23
24 h-m-p 0.0487 0.2435 3.9120 +CYYCC 2245.209741 4 0.2124 784 | 2/23
25 h-m-p 0.0633 0.3164 8.8020 CYCCCC 2235.548578 5 0.1217 819 | 2/23
26 h-m-p 0.1272 0.6362 3.7973 YCCCCC 2227.844514 5 0.2567 854 | 2/23
27 h-m-p 0.1603 0.8014 0.8623 +YYCCCC 2221.984277 5 0.5117 889 | 2/23
28 h-m-p 0.6866 3.6260 0.6427 CCC 2218.522629 2 0.6718 940 | 2/23
29 h-m-p 0.4294 2.6137 1.0056 CCC 2215.498081 2 0.6674 991 | 2/23
30 h-m-p 0.2455 1.2276 0.8931 +YCCCC 2211.671953 4 0.6933 1025 | 2/23
31 h-m-p 0.4673 2.3367 0.3377 YCCCC 2210.478280 4 0.9359 1079 | 2/23
32 h-m-p 0.5626 2.8130 0.3379 CCC 2209.850074 2 0.5755 1130 | 2/23
33 h-m-p 0.4953 8.0000 0.3926 +CYC 2209.080038 2 1.7128 1181 | 2/23
34 h-m-p 1.1895 8.0000 0.5653 CCC 2208.431067 2 1.6593 1232 | 2/23
35 h-m-p 1.1650 5.8250 0.3006 CCCC 2208.194728 3 1.6811 1285 | 2/23
36 h-m-p 0.7354 7.9719 0.6872 YCCC 2208.088091 3 0.4677 1337 | 2/23
37 h-m-p 0.6144 8.0000 0.5232 YCCC 2207.956846 3 1.0484 1389 | 2/23
38 h-m-p 1.4910 8.0000 0.3679 C 2207.886143 0 1.4899 1436 | 2/23
39 h-m-p 1.6000 8.0000 0.2403 CC 2207.858703 1 1.6810 1485 | 2/23
40 h-m-p 1.6000 8.0000 0.1609 CC 2207.847417 1 1.3722 1534 | 2/23
41 h-m-p 1.6000 8.0000 0.0914 CC 2207.842474 1 1.3633 1583 | 2/23
42 h-m-p 1.6000 8.0000 0.0325 CC 2207.839645 1 1.8510 1632 | 2/23
43 h-m-p 1.6000 8.0000 0.0059 CC 2207.838064 1 2.1376 1681 | 2/23
44 h-m-p 0.7121 8.0000 0.0176 +CC 2207.836407 1 3.2385 1731 | 2/23
45 h-m-p 1.3558 8.0000 0.0420 ++ 2207.829825 m 8.0000 1778 | 2/23
46 h-m-p 1.6000 8.0000 0.0641 +YC 2207.814588 1 4.1011 1827 | 2/23
47 h-m-p 1.6000 8.0000 0.1508 YC 2207.800979 1 3.0041 1875 | 2/23
48 h-m-p 1.6000 8.0000 0.1264 YC 2207.788678 1 3.3917 1923 | 2/23
49 h-m-p 1.6000 8.0000 0.2281 YC 2207.780880 1 3.5522 1971 | 2/23
50 h-m-p 1.6000 8.0000 0.2964 CC 2207.778420 1 2.1369 2020 | 2/23
51 h-m-p 1.6000 8.0000 0.2462 +YC 2207.776072 1 4.8083 2069 | 2/23
52 h-m-p 1.6000 8.0000 0.3948 YC 2207.774091 1 2.8133 2117 | 2/23
53 h-m-p 1.6000 8.0000 0.4236 CC 2207.773517 1 2.0578 2166 | 2/23
54 h-m-p 1.6000 8.0000 0.2638 C 2207.773412 0 2.4053 2213 | 2/23
55 h-m-p 1.6000 8.0000 0.2518 +Y 2207.773279 0 4.7263 2261 | 2/23
56 h-m-p 1.6000 8.0000 0.4256 C 2207.773233 0 1.9551 2308 | 2/23
57 h-m-p 1.6000 8.0000 0.3495 Y 2207.773212 0 3.3413 2355 | 2/23
58 h-m-p 1.6000 8.0000 0.4247 Y 2207.773200 0 2.6582 2402 | 2/23
59 h-m-p 1.6000 8.0000 0.4352 C 2207.773195 0 2.3976 2449 | 2/23
60 h-m-p 1.6000 8.0000 0.3734 C 2207.773193 0 2.1001 2496 | 2/23
61 h-m-p 1.6000 8.0000 0.2247 Y 2207.773193 0 2.9387 2543 | 2/23
62 h-m-p 1.5874 8.0000 0.4159 +Y 2207.773192 0 4.2176 2591 | 2/23
63 h-m-p 1.6000 8.0000 0.3668 C 2207.773192 0 1.8181 2638 | 2/23
64 h-m-p 1.5779 8.0000 0.4226 +C 2207.773192 0 5.6663 2686 | 2/23
65 h-m-p 1.6000 8.0000 0.3102 Y 2207.773192 0 1.1048 2733 | 2/23
66 h-m-p 0.8658 8.0000 0.3958 Y 2207.773192 0 0.4448 2780 | 2/23
67 h-m-p 0.1999 8.0000 0.8809 +Y 2207.773192 0 0.6697 2828 | 2/23
68 h-m-p 0.4315 8.0000 1.3671 Y 2207.773192 0 0.8504 2875 | 2/23
69 h-m-p 0.1951 8.0000 5.9576 +C 2207.773192 0 0.7805 2902 | 2/23
70 h-m-p 0.6628 8.0000 7.0158 C 2207.773192 0 0.5692 2928 | 2/23
71 h-m-p 0.5902 8.0000 6.7661 Y 2207.773192 0 0.2955 2954 | 2/23
72 h-m-p 0.4027 8.0000 4.9649 C 2207.773192 0 0.1537 2980 | 2/23
73 h-m-p 0.1885 8.0000 4.0489 C 2207.773192 0 0.0471 3006 | 2/23
74 h-m-p 0.0406 8.0000 4.6965 Y 2207.773192 0 0.0230 3032 | 2/23
75 h-m-p 0.0253 8.0000 4.2645 --C 2207.773192 0 0.0004 3060 | 2/23
76 h-m-p 0.0046 2.2832 30.6975 Y 2207.773192 0 0.0025 3086 | 2/23
77 h-m-p 0.0180 8.0000 4.2408 --Y 2207.773192 0 0.0005 3114 | 2/23
78 h-m-p 0.0160 8.0000 5.2699 +C 2207.773192 0 0.0640 3141 | 2/23
79 h-m-p 0.1221 8.0000 2.7617 ------------C 2207.773192 0 0.0000 3179 | 2/23
80 h-m-p 0.0001 0.0354 1970.1860 ---------.. | 2/23
81 h-m-p 0.0002 0.0971 0.0326 ---------- | 2/23
82 h-m-p 0.0160 8.0000 0.0850 -----Y 2207.773192 0 0.0000 3298 | 2/23
83 h-m-p 0.0016 0.8187 0.0229 --Y 2207.773192 0 0.0000 3347 | 2/23
84 h-m-p 0.0046 2.3109 0.0079 --Y 2207.773192 0 0.0000 3396 | 2/23
85 h-m-p 0.0079 3.9527 0.0041 ------Y 2207.773192 0 0.0000 3449 | 2/23
86 h-m-p 0.0034 1.7117 0.0072 --Y 2207.773192 0 0.0000 3498 | 2/23
87 h-m-p 0.0160 8.0000 0.0024 ---C 2207.773192 0 0.0001 3548 | 2/23
88 h-m-p 0.0160 8.0000 0.0017 ----Y 2207.773192 0 0.0000 3599 | 2/23
89 h-m-p 0.0160 8.0000 0.0011 --Y 2207.773192 0 0.0001 3648 | 2/23
90 h-m-p 0.0160 8.0000 0.0005 ----C 2207.773192 0 0.0000 3699
Out..
lnL = -2207.773192
3700 lfun, 14800 eigenQcodon, 199800 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2259.095127 S = -2231.506680 -19.030709
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 139 patterns 1:42
did 20 / 139 patterns 1:42
did 30 / 139 patterns 1:42
did 40 / 139 patterns 1:42
did 50 / 139 patterns 1:42
did 60 / 139 patterns 1:42
did 70 / 139 patterns 1:42
did 80 / 139 patterns 1:42
did 90 / 139 patterns 1:42
did 100 / 139 patterns 1:42
did 110 / 139 patterns 1:42
did 120 / 139 patterns 1:42
did 130 / 139 patterns 1:42
did 139 / 139 patterns 1:42
Time used: 1:42
Model 3: discrete
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
0.019951 0.004541 0.001692 0.000981 0.007147 0.005956 0.035219 0.034399 0.006571 0.006303 0.020203 0.009885 0.002623 0.074172 0.024551 0.012550 0.017542 0.073391 2.043662 0.898262 0.025525 0.000050 0.000113 0.000175
ntime & nrate & np: 18 4 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.895239
np = 24
lnL0 = -2212.502964
Iterating by ming2
Initial: fx= 2212.502964
x= 0.01995 0.00454 0.00169 0.00098 0.00715 0.00596 0.03522 0.03440 0.00657 0.00630 0.02020 0.00988 0.00262 0.07417 0.02455 0.01255 0.01754 0.07339 2.04366 0.89826 0.02553 0.00005 0.00011 0.00017
1 h-m-p 0.0000 0.0000 842.2485 ++ 2212.368759 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0000 840.5067 ++ 2212.151704 m 0.0000 104 | 2/24
3 h-m-p 0.0000 0.0000 2206.9267 ++ 2212.032370 m 0.0000 154 | 3/24
4 h-m-p 0.0000 0.0000 2157.4395 ++ 2211.868481 m 0.0000 203 | 4/24
5 h-m-p 0.0000 0.0002 133.0321 +CC 2211.621513 1 0.0000 254 | 4/24
6 h-m-p 0.0001 0.0009 107.0529 CCC 2211.495524 2 0.0000 305 | 4/24
7 h-m-p 0.0001 0.0003 82.6529 YYC 2211.416141 2 0.0000 354 | 4/24
8 h-m-p 0.0001 0.0011 34.1857 YC 2211.394327 1 0.0001 402 | 4/24
9 h-m-p 0.0000 0.0010 35.0499 CC 2211.375031 1 0.0001 451 | 4/24
10 h-m-p 0.0003 0.0015 6.9623 C 2211.370772 0 0.0001 498 | 4/24
11 h-m-p 0.0001 0.0028 8.7376 +YC 2211.346854 1 0.0002 547 | 4/24
12 h-m-p 0.0001 0.0032 11.1267 +CYC 2211.107244 2 0.0005 598 | 4/24
13 h-m-p 0.0002 0.0008 29.9485 YCCC 2210.237266 3 0.0004 650 | 4/24
14 h-m-p 0.0001 0.0004 71.0990 YCCC 2210.119368 3 0.0000 702 | 4/24
15 h-m-p 0.0002 0.0039 21.5731 CC 2210.079438 1 0.0002 751 | 4/24
16 h-m-p 0.0002 0.0047 21.7836 CC 2210.069881 1 0.0001 800 | 4/24
17 h-m-p 0.0010 0.0323 1.4530 CC 2210.068968 1 0.0003 849 | 4/24
18 h-m-p 0.0027 0.4133 0.1681 ++CCC 2209.776550 2 0.0601 902 | 4/24
19 h-m-p 0.0001 0.0006 119.1517 +YYYC 2208.407230 3 0.0003 953 | 4/24
20 h-m-p 0.1317 2.6187 0.2883 +CCC 2208.049470 2 0.4464 1005 | 4/24
21 h-m-p 0.2308 3.4774 0.5576 CYC 2207.960073 2 0.2473 1055 | 4/24
22 h-m-p 0.9758 4.8790 0.0861 YC 2207.856015 1 0.7426 1103 | 4/24
23 h-m-p 0.5629 2.8146 0.0345 CCCC 2207.797137 3 0.5895 1156 | 4/24
24 h-m-p 1.2071 8.0000 0.0169 CC 2207.780218 1 1.4666 1205 | 4/24
25 h-m-p 1.6000 8.0000 0.0086 CC 2207.774791 1 1.7328 1254 | 4/24
26 h-m-p 1.6000 8.0000 0.0053 CC 2207.773634 1 1.4040 1303 | 4/24
27 h-m-p 1.6000 8.0000 0.0031 C 2207.773233 0 2.0400 1350 | 4/24
28 h-m-p 1.6000 8.0000 0.0015 C 2207.773193 0 1.3638 1397 | 4/24
29 h-m-p 1.6000 8.0000 0.0001 Y 2207.773192 0 1.1652 1444 | 4/24
30 h-m-p 1.6000 8.0000 0.0000 Y 2207.773192 0 0.8122 1491 | 4/24
31 h-m-p 1.6000 8.0000 0.0000 C 2207.773192 0 0.5123 1538 | 4/24
32 h-m-p 1.0737 8.0000 0.0000 C 2207.773192 0 0.2684 1585 | 4/24
33 h-m-p 0.3842 8.0000 0.0000 C 2207.773192 0 0.1137 1632 | 4/24
34 h-m-p 0.1286 8.0000 0.0000 Y 2207.773192 0 0.1286 1679 | 4/24
35 h-m-p 0.1517 8.0000 0.0000 Y 2207.773192 0 0.0379 1726 | 4/24
36 h-m-p 0.0432 8.0000 0.0000 Y 2207.773192 0 0.0108 1773
Out..
lnL = -2207.773192
1774 lfun, 7096 eigenQcodon, 95796 P(t)
Time used: 2:12
Model 7: beta
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
0.019951 0.004541 0.001692 0.000981 0.007147 0.005956 0.035219 0.034399 0.006571 0.006303 0.020203 0.009885 0.002623 0.074172 0.024551 0.012550 0.017542 0.073391 2.043661 0.649633 1.679063
ntime & nrate & np: 18 1 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.271304
np = 21
lnL0 = -2299.515877
Iterating by ming2
Initial: fx= 2299.515877
x= 0.01995 0.00454 0.00169 0.00098 0.00715 0.00596 0.03522 0.03440 0.00657 0.00630 0.02020 0.00988 0.00262 0.07417 0.02455 0.01255 0.01754 0.07339 2.04366 0.64963 1.67906
1 h-m-p 0.0000 0.0000 874.8341 ++ 2297.797618 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 383.5575 +YCYCC 2296.790590 4 0.0000 99 | 1/21
3 h-m-p 0.0000 0.0000 792.8610 CCC 2296.344707 2 0.0000 147 | 1/21
4 h-m-p 0.0000 0.0001 310.8428 YCCC 2295.884197 3 0.0000 196 | 1/21
5 h-m-p 0.0000 0.0002 318.3328 +YYC 2294.632876 2 0.0001 243 | 1/21
6 h-m-p 0.0001 0.0003 234.4367 YCCCC 2293.359283 4 0.0001 294 | 1/21
7 h-m-p 0.0000 0.0003 808.7945 +CCCC 2290.084968 3 0.0001 345 | 1/21
8 h-m-p 0.0000 0.0001 873.5085 +YYYYCC 2285.423951 5 0.0001 396 | 1/21
9 h-m-p 0.0000 0.0002 2363.1823 ++ 2237.593828 m 0.0002 440 | 2/21
10 h-m-p 0.0001 0.0004 149.7386 YYC 2237.453843 2 0.0001 486 | 2/21
11 h-m-p 0.0000 0.0006 442.4678 ++YCCC 2235.408191 3 0.0002 536 | 2/21
12 h-m-p 0.0000 0.0002 747.6824 CCCCC 2234.584619 4 0.0000 587 | 2/21
13 h-m-p 0.0001 0.0005 45.9326 CCCC 2234.368614 3 0.0001 636 | 2/21
14 h-m-p 0.0000 0.0006 158.3220 +YC 2233.945733 1 0.0001 681 | 2/21
15 h-m-p 0.0001 0.0004 290.4771 CCC 2233.444381 2 0.0001 728 | 2/21
16 h-m-p 0.0001 0.0043 211.9825 +
QuantileBeta(0.15, 0.00500, 2.13679) = 1.238896e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.69111) = 9.316529e-161 2000 rounds
YY
QuantileBeta(0.15, 0.00500, 2.13573) = 1.239678e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.41395) = 1.063735e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14351) = 1.233977e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.27873) = 1.142617e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14450) = 1.233261e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.21162) = 1.186229e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
C 2227.946468 5 0.0016 781
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14474) = 1.233087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14486) = 1.232999e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14461) = 1.233175e-160 2000 rounds
| 2/21
17 h-m-p 0.0000 0.0002 3392.8452
QuantileBeta(0.15, 0.00500, 2.26108) = 1.153774e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.61013) = 9.667530e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.72648) = 9.171038e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44407) = 1.047612e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.46607) = 1.036137e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.53810) = 1.000254e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48747) = 1.025214e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.48857) = 1.024662e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.51333) = 1.012312e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48965) = 1.024114e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.50149) = 1.018179e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
C 2219.718199 5 0.0001 833
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.024083e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48971) = 1.059834e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48984) = 1.024018e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.48958) = 1.024148e-160 2000 rounds
| 2/21
18 h-m-p 0.0001 0.0006 1052.9389
QuantileBeta(0.15, 0.00500, 2.60919) = 9.671755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96764) = 8.287842e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63911) = 9.538954e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.80338) = 8.869798e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63139) = 9.572891e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.63094) = 9.574871e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.62007) = 9.623071e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
C 2217.129544 3 0.0001 881
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.575154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63087) = 9.909419e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63101) = 9.574568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63074) = 9.575739e-161 2000 rounds
| 2/21
19 h-m-p 0.0001 0.0007 390.4652
QuantileBeta(0.15, 0.00500, 2.68238) = 9.353170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83689) = 8.744573e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68244) = 9.352898e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.75967) = 9.038585e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68768) = 9.330900e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.72367) = 9.182434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68794) = 9.329817e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.70581) = 9.255543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
C 2215.982937 3 0.0002 930
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.329572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68800) = 9.655264e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68813) = 9.329010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.68786) = 9.330134e-161 2000 rounds
| 2/21
20 h-m-p 0.0571 0.8540 1.0880
QuantileBeta(0.15, 0.00500, 2.71055) = 9.236000e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77823) = 8.966140e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.02567) = 8.100004e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77863) = 8.964589e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.90215) = 8.510535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80550) = 8.861763e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.80663) = 8.857493e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.85439) = 8.680571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80850) = 8.850444e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.83144) = 8.764690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
C 2212.855683 4 0.3051 981
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 8.850011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80861) = 9.158962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80875) = 8.849494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.80847) = 8.850528e-161 2000 rounds
| 2/21
21 h-m-p 0.1427 0.7134 0.2918
QuantileBeta(0.15, 0.00500, 2.84898) = 8.700264e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.97008) = 8.279786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.89245) = 8.544519e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.89614) = 8.531550e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.93311) = 8.403795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90338) = 8.506249e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.91824) = 8.454713e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90411) = 8.503686e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.91118) = 8.479129e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
C 2210.492983 4 0.3383 1031
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.502939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90433) = 8.799774e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90447) = 8.502454e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90419) = 8.503425e-161 2000 rounds
| 2/21
22 h-m-p 0.2293 1.1466 0.2505
QuantileBeta(0.15, 0.00500, 2.94681) = 8.357417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.07425) = 7.949119e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.95311) = 8.336247e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.01368) = 8.138109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96062) = 8.311162e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.98715) = 8.223731e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96134) = 8.308783e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.97424) = 8.266039e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
C 2209.526234 3 0.3085 1080
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.308340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96147) = 8.598381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96161) = 8.307871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96133) = 8.308808e-161 2000 rounds
| 2/21
23 h-m-p 0.4286 8.0000 0.1803
QuantileBeta(0.15, 0.00500, 3.00268) = 8.173396e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.12632) = 7.793509e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.62087) = 6.570573e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.07373) = 7.950711e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.07064) = 7.960157e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.03666) = 8.065376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06861) = 7.966356e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.05264) = 8.015562e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
C 2208.588319 3 1.1131 1129
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 7.966679e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06851) = 8.244793e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06865) = 7.966241e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06836) = 7.967117e-161 2000 rounds
| 2/21
24 h-m-p 0.2876 3.4634 0.6979
QuantileBeta(0.15, 0.00500, 3.15456) = 7.711619e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41272) = 7.035446e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15261) = 7.717219e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.28364) = 7.358107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16312) = 7.687130e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.22338) = 7.519039e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16395) = 7.684777e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.19366) = 7.601009e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
C 2208.395606 3 0.3199 1178
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.684021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16421) = 7.952268e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16436) = 7.683607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16407) = 7.684436e-161 2000 rounds
| 2/21
25 h-m-p 0.9784 4.8918 0.1844
QuantileBeta(0.15, 0.00500, 3.30637) = 7.299161e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73285) = 6.344939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.25491) = 7.433966e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.26573) = 7.405219e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
C 2208.085138 2 0.7030 1223
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.403543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26636) = 7.661999e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26651) = 7.403152e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26621) = 7.403935e-161 2000 rounds
| 2/21
26 h-m-p 1.4710 7.3550 0.0338
QuantileBeta(0.15, 0.00500, 3.30171) = 7.311161e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40777) = 7.047286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29048) = 7.340265e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.29204) = 7.336203e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.29688) = 7.323660e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
C 2207.912673 2 1.0691 1269
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.336170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29206) = 7.592273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29220) = 7.335785e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29191) = 7.336556e-161 2000 rounds
| 2/21
27 h-m-p 1.6000 8.0000 0.0064
QuantileBeta(0.15, 0.00500, 3.28288) = 7.360079e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.25537) = 7.432745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28067) = 7.365877e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.26802) = 7.399161e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28021) = 7.367078e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.27411) = 7.383085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
C 2207.823745 2 2.0757 1316
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.367217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28016) = 7.624404e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28031) = 7.366829e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28001) = 7.367605e-161 2000 rounds
| 2/21
28 h-m-p 1.4600 8.0000 0.0092
QuantileBeta(0.15, 0.00500, 3.26754) = 7.400426e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22969) = 7.501866e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26071) = 7.418521e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.24520) = 7.459962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
C 2207.794357 1 2.2711 1361
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.419005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26053) = 7.678000e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26068) = 7.418612e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26038) = 7.419397e-161 2000 rounds
| 2/21
29 h-m-p 1.6000 8.0000 0.0098
QuantileBeta(0.15, 0.00500, 3.27618) = 7.377658e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.32312) = 7.256325e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27742) = 7.374410e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.30027) = 7.314893e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
C 2207.779770 1 1.7322 1406
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.374261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27747) = 7.631694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27762) = 7.373872e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27732) = 7.374650e-161 2000 rounds
| 2/21
30 h-m-p 1.6000 8.0000 0.0095
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33356) = 7.229875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29155) = 7.337482e-161 2000 rounds
C 2207.775902 0 1.6000 1449
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.337629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29149) = 7.593783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29164) = 7.337243e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29135) = 7.338015e-161 2000 rounds
| 2/21
31 h-m-p 1.6000 8.0000 0.0029
QuantileBeta(0.15, 0.00500, 3.29513) = 7.328192e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30604) = 7.300025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326731e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.30086) = 7.313354e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
C 2207.774022 1 1.8447 1494
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.326751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29569) = 7.582526e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29583) = 7.326366e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29554) = 7.327136e-161 2000 rounds
| 2/21
32 h-m-p 1.6000 8.0000 0.0010
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30209) = 7.310199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29728) = 7.322630e-161 2000 rounds
C 2207.773244 0 1.6000 1537
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.578236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29743) = 7.322222e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322991e-161 2000 rounds
| 2/21
33 h-m-p 1.6000 8.0000 0.0010
QuantileBeta(0.15, 0.00500, 3.29827) = 7.320072e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30120) = 7.312478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
C 2207.773074 0 1.4774 1580
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.320266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29819) = 7.575814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29834) = 7.319881e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29804) = 7.320650e-161 2000 rounds
| 2/21
34 h-m-p 1.6000 8.0000 0.0008
QuantileBeta(0.15, 0.00500, 3.29716) = 7.322933e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29407) = 7.330946e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
C 2207.773053 0 1.4510 1623
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.578317e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29740) = 7.322300e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29711) = 7.323069e-161 2000 rounds
| 2/21
35 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29660) = 7.324387e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
C 2207.773051 0 1.5913 1666
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.323108e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29709) = 7.578755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29724) = 7.322723e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29694) = 7.323492e-161 2000 rounds
| 2/21
36 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323308e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29678) = 7.323908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
C 2207.773050 0 1.8465 1709
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.578994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29685) = 7.323723e-161 2000 rounds
| 2/21
37 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
C 2207.773050 0 1.6000 1752
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.323307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29702) = 7.578961e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29716) = 7.322922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323691e-161 2000 rounds
| 2/21
38 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29708) = 7.323129e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
C 2207.773050 0 1.5894 1795
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.323263e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29703) = 7.578915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29718) = 7.322878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29688) = 7.323647e-161 2000 rounds
| 2/21
39 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29710) = 7.323097e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
C 2207.773050 0 1.6879 1838
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.578870e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29720) = 7.322834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29690) = 7.323604e-161 2000 rounds
| 2/21
40 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29707) = 7.323168e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
C 2207.773050 0 1.3089 1881
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.323209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29705) = 7.578859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29720) = 7.322824e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29691) = 7.323593e-161 2000 rounds
| 2/21
41 h-m-p 0.4454 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.29706) = 7.323193e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29708) = 7.323148e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.29716) = 7.322935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322962e-161 2000 rounds
C 2207.773050 0 7.1269 1926
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29715) = 7.578607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29730) = 7.322581e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29700) = 7.323350e-161 2000 rounds
| 2/21
42 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29711) = 7.323053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
C 2207.773050 0 1.2881 1969
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.322983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29714) = 7.578626e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29729) = 7.322598e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29699) = 7.323368e-161 2000 rounds
| 2/21
43 h-m-p 0.1498 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 3.29715) = 7.322962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29717) = 7.322901e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.29727) = 7.322655e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.29756) = 7.321888e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
Y 2207.773050 0 5.0518 2014
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.322291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29741) = 7.577910e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29756) = 7.321907e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29726) = 7.322676e-161 2000 rounds
| 2/21
44 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 3.29764) = 7.321685e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29834) = 7.319867e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
+ 2207.773050 m 8.0000 2057
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.319262e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29858) = 7.574775e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29873) = 7.318877e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29843) = 7.319646e-161 2000 rounds
| 2/21
45 h-m-p 1.0794 8.0000 0.0011
QuantileBeta(0.15, 0.00500, 3.29975) = 7.316234e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30326) = 7.307167e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
+ 2207.773049 m 8.0000 2100
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.296883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30726) = 7.551615e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30741) = 7.296501e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30711) = 7.297266e-161 2000 rounds
| 2/21
46 h-m-p 0.3286 8.0000 0.0264
QuantileBeta(0.15, 0.00500, 3.31594) = 7.274641e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34197) = 7.208716e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.44612) = 6.956498e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.51854) = 6.791211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
Y 2207.773045 0 3.5075 2145
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.066242e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39989) = 7.312922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40004) = 7.065878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.39974) = 7.066606e-161 2000 rounds
| 2/21
47 h-m-p 1.6000 8.0000 0.0442
QuantileBeta(0.15, 0.00500, 3.47056) = 6.899814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68258) = 6.444298e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
+ 2207.773006 m 8.0000 2188
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.305489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75325) = 6.525612e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75341) = 6.305184e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.75309) = 6.305795e-161 2000 rounds
| 2/21
48 h-m-p 0.2594 8.0000 1.3625
QuantileBeta(0.15, 0.00500, 4.10661) = 5.692179e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.16670) = 4.405393e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 14.65295) = 1.455582e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.80261) = 2.213708e-161 2000 rounds
C 2207.772852 0 4.1497 2233
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.311894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40704) = 2.392602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40730) = 2.311825e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.40677) = 2.311964e-161 2000 rounds
| 2/21
49 h-m-p 1.6000 8.0000 0.6747
QuantileBeta(0.15, 0.00500, 10.48663) = 2.062253e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.72539) = 1.557602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
C 2207.772812 0 1.4546 2276
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.082687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38854) = 2.155393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38882) = 2.082627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.38825) = 2.082747e-161 2000 rounds
| 2/21
50 h-m-p 1.2205 8.0000 0.8042
QuantileBeta(0.15, 0.00500, 11.37004) = 1.894814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.31455) = 1.491216e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
+ 2207.772776 m 8.0000 2319
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.262226e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82221) = 1.306290e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82259) = 1.262196e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.82182) = 1.262256e-161 2000 rounds
| 2/21
51 h-m-p 1.6000 8.0000 3.4578
QuantileBeta(0.15, 0.00500, 22.35464) = 9.427993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.95194) = 4.317545e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 44.48438) = 3.774533e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
Y 2207.772752 0 4.1899 2363
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.688107e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31009) = 6.921587e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.31067) = 6.687983e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.30952) = 6.688232e-162 2000 rounds
| 2/21
52 h-m-p 1.6000 8.0000 3.3500
QuantileBeta(0.15, 0.00500, 36.67010) = 4.589888e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 52.75012) = 1.901339e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
C 2207.772743 0 2.0069 2406
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.423217e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03320) = 4.574475e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03385) = 4.423141e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 38.03255) = 4.423294e-162 2000 rounds
| 2/21
53 h-m-p 1.4307 8.0000 4.6991
QuantileBeta(0.15, 0.00500, 44.75631) = 3.751342e-162 2000 rounds
+C 2207.772733 0 6.1130 2450 | 2/21
54 h-m-p 0.7856 3.9279 8.2081 +Y 2207.772728 0 2.1896 2494 | 2/21
55 h-m-p 0.2449 1.2245 11.6524 ++ 2207.772726 m 1.2245 2537 | 3/21
56 h-m-p 0.4201 8.0000 0.0000 +Y 2207.772726 0 1.1746 2581 | 3/21
57 h-m-p 1.6000 8.0000 0.0000 -C 2207.772726 0 0.1322 2624
Out..
lnL = -2207.772726
2625 lfun, 28875 eigenQcodon, 472500 P(t)
Time used: 5:17
Model 8: beta&w>1
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
initial w for M8:NSbetaw>1 reset.
0.019951 0.004541 0.001692 0.000981 0.007147 0.005956 0.035219 0.034399 0.006571 0.006303 0.020203 0.009885 0.002623 0.074172 0.024551 0.012550 0.017542 0.073391 2.043654 0.900000 0.578325 1.546757 2.928793
ntime & nrate & np: 18 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 7.196973
np = 23
lnL0 = -2336.571232
Iterating by ming2
Initial: fx= 2336.571232
x= 0.01995 0.00454 0.00169 0.00098 0.00715 0.00596 0.03522 0.03440 0.00657 0.00630 0.02020 0.00988 0.00262 0.07417 0.02455 0.01255 0.01754 0.07339 2.04365 0.90000 0.57833 1.54676 2.92879
1 h-m-p 0.0000 0.0000 1092.3784 ++ 2333.375728 m 0.0000 51 | 1/23
2 h-m-p 0.0000 0.0000 804.5899 +YCYYCCC 2326.603571 6 0.0000 110 | 1/23
3 h-m-p 0.0000 0.0000 9299.9691 +YYYCC 2321.539972 4 0.0000 164 | 1/23
4 h-m-p 0.0000 0.0001 1237.1127 ++ 2303.703064 m 0.0001 212 | 2/23
5 h-m-p 0.0000 0.0002 257.9459 CYCCC 2301.838072 4 0.0001 267 | 2/23
6 h-m-p 0.0000 0.0002 354.4158 CCCC 2301.010190 3 0.0000 320 | 2/23
7 h-m-p 0.0000 0.0003 355.7151 +YYYC 2297.327701 3 0.0002 371 | 2/23
8 h-m-p 0.0000 0.0001 1864.3302 CCCC 2295.428584 3 0.0000 424 | 2/23
9 h-m-p 0.0000 0.0002 956.8172 YCCCC 2290.123716 4 0.0001 478 | 2/23
10 h-m-p 0.0000 0.0002 1641.7273 ++ 2257.924536 m 0.0002 525 | 3/23
11 h-m-p 0.0000 0.0000 1192.9232 CCCC 2257.522963 3 0.0000 578 | 3/23
12 h-m-p 0.0000 0.0001 386.1648 YCYCCC 2256.721822 5 0.0000 632 | 2/23
13 h-m-p 0.0000 0.0002 1278.0913 +YCCC 2248.074514 3 0.0001 684 | 2/23
14 h-m-p 0.0001 0.0003 716.3474 +CYCCC 2239.691509 4 0.0002 739 | 2/23
15 h-m-p 0.0000 0.0002 221.9831 YCYCCC 2238.356450 5 0.0001 794 | 2/23
16 h-m-p 0.0000 0.0002 344.7237 +YCCC 2237.333198 3 0.0001 847 | 2/23
17 h-m-p 0.0000 0.0002 118.2889 ++ 2235.963561 m 0.0002 894 | 3/23
18 h-m-p 0.0001 0.0006 238.2438 CYCCC 2234.251005 4 0.0002 948 | 3/23
19 h-m-p 0.0013 0.0105 29.5579 CCCC 2233.079001 3 0.0018 1000 | 3/23
20 h-m-p 0.0001 0.0007 138.4746 YCC 2232.802948 2 0.0001 1049 | 3/23
21 h-m-p 0.0003 0.0828 37.1111 ++
QuantileBeta(0.15, 0.00500, 2.26917) = 1.148638e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.49816) = 5.138068e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.14389) = 1.233702e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.13758) = 1.238317e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
C 2227.729060 3 0.0179 1102
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13690) = 1.238819e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13666) = 1.238996e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.13678) = 1.238907e-160 2000 rounds
| 3/23
22 h-m-p 0.1557 0.7787 2.5627
QuantileBeta(0.15, 0.00500, 2.23365) = 1.171556e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52425) = 1.006961e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.62112) = 9.618375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39923) = 1.071796e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.41177) = 1.064922e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.46801) = 1.035138e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42431) = 1.058137e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.42491) = 1.057813e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.44646) = 1.046354e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42538) = 1.057559e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.43592) = 1.051927e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
C 2221.529092 5 0.4640 1157
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.094466e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42553) = 1.057478e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42528) = 1.057616e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.42541) = 1.057547e-160 2000 rounds
| 3/23
23 h-m-p 0.0661 0.3305 3.1719
QuantileBeta(0.15, 0.00500, 2.49688) = 1.020483e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71130) = 9.232921e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58326) = 9.789897e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.58777) = 9.769127e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.64954) = 9.493518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60309) = 9.699302e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.60386) = 9.695838e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.62670) = 9.593620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60490) = 9.691135e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.61580) = 9.642133e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
C 2217.167555 5 0.1660 1211
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 1.002913e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60510) = 9.690231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60483) = 9.691424e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.60496) = 9.690828e-161 2000 rounds
| 3/23
24 h-m-p 0.2418 2.0880 2.1776
QuantileBeta(0.15, 0.00500, 2.50674) = 1.015573e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21205) = 1.185936e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43789) = 1.050879e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.46106) = 1.038732e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.46360) = 1.037414e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.48517) = 1.026378e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46443) = 1.036986e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.47480) = 1.031655e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
C 2214.978061 4 0.3459 1263
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.073155e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46462) = 1.036889e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46436) = 1.037022e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46449) = 1.036956e-160 2000 rounds
| 3/23
25 h-m-p 0.2078 1.0392 0.5171
QuantileBeta(0.15, 0.00500, 2.41806) = 1.061508e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.27877) = 1.142591e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38025) = 1.082368e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.37747) = 1.083936e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.32812) = 1.112499e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37227) = 1.086878e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.35019) = 1.099541e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37182) = 1.087133e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.36101) = 1.093302e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
C 2212.177934 4 0.4153 1316
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.125146e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37184) = 1.087121e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37159) = 1.087265e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37171) = 1.087193e-160 2000 rounds
| 3/23
26 h-m-p 0.3626 1.8129 0.3758
QuantileBeta(0.15, 0.00500, 2.42208) = 1.059335e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.57320) = 9.836499e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45250) = 1.043185e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.45688) = 1.040901e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.51504) = 1.011473e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46045) = 1.039047e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.48774) = 1.025076e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46084) = 1.038845e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.47429) = 1.031915e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
C 2210.888602 4 0.6421 1369
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.075069e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46104) = 1.038738e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46079) = 1.038872e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.46092) = 1.038805e-160 2000 rounds
| 3/23
27 h-m-p 0.4985 2.4926 0.2885
QuantileBeta(0.15, 0.00500, 2.52440) = 1.006888e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71487) = 9.218321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.58416) = 9.785750e-161 2000 rounds
C 2209.917685 1 0.9695 1416
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 1.012632e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58451) = 9.784129e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58425) = 9.785341e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.58438) = 9.784735e-161 2000 rounds
| 3/23
28 h-m-p 0.6432 3.2160 0.1311
QuantileBeta(0.15, 0.00500, 2.65948) = 9.450579e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.88480) = 8.571534e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.95990) = 8.313552e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78948) = 8.922777e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.79233) = 8.911865e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.83856) = 8.738409e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79587) = 8.898345e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.81722) = 8.817657e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
C 2209.180810 3 1.8122 1468
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 9.208526e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79612) = 8.897382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79585) = 8.898424e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79598) = 8.897903e-161 2000 rounds
| 3/23
29 h-m-p 1.0790 8.0000 0.2202
QuantileBeta(0.15, 0.00500, 2.94877) = 8.350812e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40713) = 7.048826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.01524) = 8.133130e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.21119) = 7.552456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98976) = 8.215240e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
C 2208.559749 2 1.3621 1517
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.505082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98899) = 8.217728e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98871) = 8.218648e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98885) = 8.218188e-161 2000 rounds
| 3/23
30 h-m-p 0.4402 2.2012 0.1994
QuantileBeta(0.15, 0.00500, 3.06446) = 7.979096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29127) = 7.338218e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.36687) = 7.146771e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20516) = 7.569092e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
C 2208.205802 1 1.2648 1565
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.830750e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20620) = 7.566197e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20591) = 7.567007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20606) = 7.566602e-161 2000 rounds
| 3/23
31 h-m-p 0.2088 1.0441 0.1348
QuantileBeta(0.15, 0.00500, 3.22488) = 7.514960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28133) = 7.364159e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
+ 2208.051720 m 1.0441 1611
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.570593e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30029) = 7.314837e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29999) = 7.315605e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30014) = 7.315221e-161 2000 rounds
| 4/23
32 h-m-p 1.0815 8.0000 0.1012
QuantileBeta(0.15, 0.00500, 3.40930) = 7.043623e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73678) = 6.337307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41348) = 7.033623e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.57513) = 6.667408e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41800) = 7.022830e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.49657) = 6.840525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
C 2207.926133 2 1.1696 1661
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.267538e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41834) = 7.022028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41804) = 7.022749e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41819) = 7.022388e-161 2000 rounds
| 4/23
33 h-m-p 1.6000 8.0000 0.0507
QuantileBeta(0.15, 0.00500, 3.49825) = 6.836716e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73844) = 6.334080e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49103) = 6.853056e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.61835) = 6.575845e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49516) = 6.843715e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
C 2207.854397 2 1.5387 1709
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 7.082559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49534) = 6.843303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49503) = 6.843996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.49519) = 6.843649e-161 2000 rounds
| 4/23
34 h-m-p 1.6000 8.0000 0.0203
QuantileBeta(0.15, 0.00500, 3.48481) = 6.867199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45370) = 6.938827e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48654) = 6.863275e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.49086) = 6.853448e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863819e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.48556) = 6.865509e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
C 2207.809800 2 1.3715 1758
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 7.103440e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48645) = 6.863478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48614) = 6.864174e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.48630) = 6.863826e-161 2000 rounds
| 4/23
35 h-m-p 1.6000 8.0000 0.0130
QuantileBeta(0.15, 0.00500, 3.47492) = 6.889820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44078) = 6.968992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47666) = 6.885835e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.48148) = 6.874813e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
C 2207.784188 1 1.3723 1805
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 7.126501e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47669) = 6.885760e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47638) = 6.886459e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.47654) = 6.886109e-161 2000 rounds
| 4/23
36 h-m-p 0.8624 8.0000 0.0207
QuantileBeta(0.15, 0.00500, 3.49375) = 6.846910e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.54538) = 6.731932e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50844) = 6.813782e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
C 2207.778600 1 1.5929 1851
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 7.051922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50848) = 6.813702e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50817) = 6.814390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.50833) = 6.814046e-161 2000 rounds
| 4/23
37 h-m-p 1.6000 8.0000 0.0106
QuantileBeta(0.15, 0.00500, 3.52512) = 6.776586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.57549) = 6.666627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
C 2207.777510 0 1.7956 1896
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 7.008445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52733) = 6.771694e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52702) = 6.772376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52717) = 6.772035e-161 2000 rounds
| 4/23
38 h-m-p 1.6000 8.0000 0.0020
QuantileBeta(0.15, 0.00500, 3.52999) = 6.765798e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53844) = 6.747157e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
C 2207.776695 1 2.7186 1942
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.997485e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53211) = 6.761105e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53180) = 6.761785e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53196) = 6.761445e-161 2000 rounds
| 4/23
39 h-m-p 1.6000 8.0000 0.0024
QuantileBeta(0.15, 0.00500, 3.53059) = 6.764463e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.52650) = 6.773533e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
C 2207.775866 0 1.7164 1987
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 7.000835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53065) = 6.764342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53034) = 6.765023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53049) = 6.764683e-161 2000 rounds
| 4/23
40 h-m-p 1.6000 8.0000 0.0010
QuantileBeta(0.15, 0.00500, 3.53040) = 6.764883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53013) = 6.765485e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
Y 2207.775703 0 1.2023 2032
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 7.000991e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53058) = 6.764493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53027) = 6.765174e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53043) = 6.764833e-161 2000 rounds
| 4/23
41 h-m-p 1.6000 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 3.53105) = 6.763464e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53290) = 6.759357e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
C 2207.775653 0 2.5069 2077
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.998770e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53155) = 6.762347e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53124) = 6.763027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53140) = 6.762687e-161 2000 rounds
| 4/23
42 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 3.53185) = 6.761696e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53319) = 6.758724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
C 2207.775636 0 1.9330 2122
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.997531e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53209) = 6.761150e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761490e-161 2000 rounds
| 4/23
43 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 3.53211) = 6.761111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53262) = 6.759974e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
Y 2207.775626 0 3.0074 2167
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.996794e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53241) = 6.760438e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53211) = 6.761118e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53226) = 6.760778e-161 2000 rounds
| 4/23
44 h-m-p 1.2518 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 3.53194) = 6.761492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53097) = 6.763637e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
C 2207.775622 0 1.9997 2212
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.997976e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761579e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53159) = 6.762259e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761919e-161 2000 rounds
| 4/23
45 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761889e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53180) = 6.761798e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
Y 2207.775622 0 1.0690 2257
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.997955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53191) = 6.761559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53160) = 6.762239e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53175) = 6.761899e-161 2000 rounds
| 4/23
46 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761880e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761894e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
Y 2207.775622 0 0.7152 2302
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.997946e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53191) = 6.761550e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53160) = 6.762231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761890e-161 2000 rounds
| 4/23
47 h-m-p 0.2756 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.53176) = 6.761882e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53177) = 6.761855e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.53182) = 6.761751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
C 2207.775622 0 1.3176 2348
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.997903e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53193) = 6.761509e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53162) = 6.762189e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53178) = 6.761849e-161 2000 rounds
| 4/23
48 h-m-p 0.4945 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.53179) = 6.761807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53185) = 6.761682e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.53208) = 6.761181e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
C 2207.775622 0 3.1482 2394
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.997627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53205) = 6.761243e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53174) = 6.761923e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53190) = 6.761583e-161 2000 rounds
| 4/23
49 h-m-p 0.8532 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 3.53202) = 6.761317e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53238) = 6.760520e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
+ 2207.775622 m 8.0000 2439
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.995049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53318) = 6.758752e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53287) = 6.759431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53302) = 6.759091e-161 2000 rounds
| 4/23
50 h-m-p 0.5065 8.0000 0.0022
QuantileBeta(0.15, 0.00500, 3.53415) = 6.756602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.53754) = 6.749143e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
+ 2207.775622 m 8.0000 2484
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.954573e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55100) = 6.719644e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55069) = 6.720318e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.55085) = 6.719981e-161 2000 rounds
| 4/23
51 h-m-p 1.6000 8.0000 0.0047
QuantileBeta(0.15, 0.00500, 3.55839) = 6.703564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58102) = 6.654788e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
+ 2207.775617 m 8.0000 2529
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.870440e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58872) = 6.638355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58841) = 6.639016e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58856) = 6.638686e-161 2000 rounds
| 4/23
52 h-m-p 0.3785 8.0000 0.0996
QuantileBeta(0.15, 0.00500, 3.62627) = 6.559326e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73942) = 6.332197e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.19198) = 5.561443e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
+ 2207.775573 m 8.0000 2575
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.470546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38578) = 5.285780e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38544) = 5.286247e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.38561) = 5.286013e-161 2000 rounds
| 4/23
53 h-m-p 1.0970 8.0000 0.7266
QuantileBeta(0.15, 0.00500, 5.18266) = 4.390439e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57381) = 2.909935e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
+ 2207.775436 m 8.0000 2620
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.197597e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19870) = 2.123406e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19814) = 2.123529e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.19842) = 2.123467e-161 2000 rounds
| 4/23
54 h-m-p 1.6000 8.0000 0.5444
QuantileBeta(0.15, 0.00500, 11.06950) = 1.948641e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.68273) = 1.562640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
C 2207.775403 0 1.6820 2665
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 2.008197e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11442) = 1.940402e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11383) = 1.940510e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.11412) = 1.940456e-161 2000 rounds
| 4/23
55 h-m-p 0.9366 8.0000 0.9776
QuantileBeta(0.15, 0.00500, 12.02983) = 1.786478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.77693) = 1.442949e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
+ 2207.775366 m 8.0000 2710
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.156623e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93566) = 1.117583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93483) = 1.117633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 18.93525) = 1.117608e-161 2000 rounds
| 4/23
56 h-m-p 1.6000 8.0000 3.7940
QuantileBeta(0.15, 0.00500, 25.00563) = 8.408339e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.21678) = 3.886528e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 49.28717) = 2.036286e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
Y 2207.775346 0 4.5898 2756
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.789356e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34964) = 4.630911e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34838) = 4.631075e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.34901) = 4.630993e-162 2000 rounds
| 4/23
57 h-m-p 1.6000 8.0000 3.9968
QuantileBeta(0.15, 0.00500, 42.74395) = 3.930025e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
C 2207.775336 0 1.8429 2801
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.973130e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71538) = 3.841692e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71395) = 3.841819e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.71466) = 3.841755e-162 2000 rounds
| 4/23
58 h-m-p 1.4087 8.0000 5.2287
QuantileBeta(0.15, 0.00500, 51.08032) = 1.964103e-162 2000 rounds
++ 2207.775327 m 8.0000 2846 | 4/23
59 h-m-p 0.2732 1.3658 9.8516 ++ 2207.775324 m 1.3658 2891 | 5/23
60 h-m-p 1.6000 8.0000 0.0000 C 2207.775324 0 1.3171 2936 | 5/23
61 h-m-p 1.6000 8.0000 0.0000 C 2207.775324 0 1.6000 2980 | 5/23
62 h-m-p 1.6000 8.0000 0.0000 -Y 2207.775324 0 0.1000 3025
Out..
lnL = -2207.775324
3026 lfun, 36312 eigenQcodon, 599148 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2269.313247 S = -2231.506609 -29.031217
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 139 patterns 9:06
did 20 / 139 patterns 9:06
did 30 / 139 patterns 9:06
did 40 / 139 patterns 9:06
did 50 / 139 patterns 9:06
did 60 / 139 patterns 9:06
did 70 / 139 patterns 9:07
did 80 / 139 patterns 9:07
did 90 / 139 patterns 9:07
did 100 / 139 patterns 9:07
did 110 / 139 patterns 9:07
did 120 / 139 patterns 9:08
did 130 / 139 patterns 9:08
did 139 / 139 patterns 9:08
Time used: 9:08
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=376
D_melanogaster_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_sechellia_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_simulans_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_erecta_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_takahashii_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_biarmipes_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_suzukii_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_eugracilis_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_ficusphila_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_rhopaloa_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
D_elegans_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS
**************************************************
D_melanogaster_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_sechellia_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_simulans_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_erecta_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_takahashii_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_biarmipes_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_suzukii_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_eugracilis_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_ficusphila_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_rhopaloa_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
D_elegans_acj6-PL LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI
**************************************************
D_melanogaster_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_sechellia_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_simulans_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_erecta_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_takahashii_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_biarmipes_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_suzukii_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_eugracilis_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_ficusphila_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_rhopaloa_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
D_elegans_acj6-PL KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP
**************************************************
D_melanogaster_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_sechellia_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_simulans_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_erecta_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_takahashii_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_biarmipes_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_suzukii_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_eugracilis_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_ficusphila_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_rhopaloa_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
D_elegans_acj6-PL THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG
**************************************************
D_melanogaster_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_sechellia_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_simulans_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_erecta_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_takahashii_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_biarmipes_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_suzukii_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_eugracilis_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_ficusphila_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_rhopaloa_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
D_elegans_acj6-PL LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ
**************************************************
D_melanogaster_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_sechellia_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_simulans_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_erecta_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_takahashii_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_biarmipes_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_suzukii_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_eugracilis_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_ficusphila_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_rhopaloa_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
D_elegans_acj6-PL STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG
**************************************************
D_melanogaster_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_sechellia_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_simulans_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_erecta_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_takahashii_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_biarmipes_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_suzukii_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_eugracilis_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_ficusphila_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_rhopaloa_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
D_elegans_acj6-PL EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN
**************************************************
D_melanogaster_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_sechellia_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_simulans_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_erecta_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_takahashii_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_biarmipes_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_suzukii_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_eugracilis_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_ficusphila_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_rhopaloa_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
D_elegans_acj6-PL QRQKQKRIVSSVTPSMTGHGSAGFGY
**************************
>D_melanogaster_acj6-PL ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATT AAGCACGACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCG TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTAACGCCC ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCATACGGGGGGACATCATGGAC ACTCGGCGGTACATCATCCTGTTATCACGGCGGCAGTGGCTGCCGCTGGC CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT CGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGC CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_sechellia_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCG TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAATATGAT CGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGC CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_simulans_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCG TCCGTTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT CGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_erecta_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCG TCCGTTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAA CGGGCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGAC ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGAT CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_takahashii_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG TCCACTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA CGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTAGCTGCCGCTGGC CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAG AGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCGCACAACAACATGAT CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCCGAAAAGCGTTCTTTGGAAGC CTACTTTGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_biarmipes_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG TCCTCTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA CGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGTCGCCGCTGACGCCC ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGAC ACTCGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC CTGCATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG AGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGCTCCCTGGAAGC CTACTTCGCCGTCCAGCCGAGGCCGTCCGGTGAGAAAATCGCTGCCATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_suzukii_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG TCCACTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGA CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGAC ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC CTGCATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAG AGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCGCACAACAACATGAT CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_eugracilis_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA TGCGTCGCTGTATGCCAAATCCATCTAGTCGTTTGTTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACA TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACG TCCATTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAA CGGGCTCAATGACCACGTTGGCGCCCATATCGGAGTCGCCTCTAACGCCA ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGCCACCATGGAC ACTCAGCGGTACATCATCCTGTTATCACAGCGGCAGTGGCAGCCGCTGGC CTGCATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTACGCAGGCGGACGTGG GCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCACAG AGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGG CGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC CTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGAC TGGCCACGGTTCAGCGGGATTTGGATAC >D_ficusphila_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA TGCGCCGCTGCATGCCAAATCCGTCGAGTCGTTTGTTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACA TCCAGAAGCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATC AAGCACGACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCG TCCCCTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGA CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCC ACACACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGC CTGCATCCCGACACAGACACCGATCCCCGCGAGCTGGAGGCCTTCGCGGA GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAG AGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCGCACAACAACATGAT CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC CTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_rhopaloa_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG TCCATTGCAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGA CGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGTCCCCACTGACGCCC ACACACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGAC ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC CTGCATCCCGACACCGACACCGATCCCCGCGAGCTGGAGGCGTTTGCGGA GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAG AGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC CTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC >D_elegans_acj6-PL ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTAGTCGTTTATTAGAAGATGCTTCC CTATTATGCAATTCGTGGTCAGCACGTCAGAATGGTGATATCTTCGCGGG CATCAACGATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACA TCCAGAAGCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATC AAGCACGACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACG TCCATTGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGA CGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGTCCCCTCTGACGCCC ACACACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAG CCACCACCATCCGGGCACGCTAAGTGGCCACACGGGGGGACACCATGGAC ACTCAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGC CTGCATCCCGACACCGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGA GCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGG GCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCACTGTCGCAG AGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGAT CGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGG CGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGC GAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGC CTACTTTGCCGTGCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTG CCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAAT CAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGAC TGGCCACGGTTCGGCGGGATTTGGATAC
>D_melanogaster_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_sechellia_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_simulans_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_erecta_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_takahashii_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_biarmipes_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_suzukii_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_eugracilis_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_ficusphila_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_rhopaloa_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY >D_elegans_acj6-PL MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSSRLLEDAS LLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQI KHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTLAPISESPLTP THQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAG LHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQ STICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAG EKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCN QRQKQKRIVSSVTPSMTGHGSAGFGY
#NEXUS
[ID: 5769907107]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_acj6-PL
D_sechellia_acj6-PL
D_simulans_acj6-PL
D_erecta_acj6-PL
D_takahashii_acj6-PL
D_biarmipes_acj6-PL
D_suzukii_acj6-PL
D_eugracilis_acj6-PL
D_ficusphila_acj6-PL
D_rhopaloa_acj6-PL
D_elegans_acj6-PL
;
end;
begin trees;
translate
1 D_melanogaster_acj6-PL,
2 D_sechellia_acj6-PL,
3 D_simulans_acj6-PL,
4 D_erecta_acj6-PL,
5 D_takahashii_acj6-PL,
6 D_biarmipes_acj6-PL,
7 D_suzukii_acj6-PL,
8 D_eugracilis_acj6-PL,
9 D_ficusphila_acj6-PL,
10 D_rhopaloa_acj6-PL,
11 D_elegans_acj6-PL
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01673162,2:0.003144049,(3:0.00135521,(4:0.004289708,(5:0.02653512,((6:0.01857646,7:0.005895727)0.807:0.005480969,(9:0.09563427,(10:0.008039666,11:0.01612633)0.998:0.02080799)0.560:0.0100693)0.722:0.01148968,8:0.07520899)0.999:0.03052227)0.992:0.007636011)0.770:0.003024347);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01673162,2:0.003144049,(3:0.00135521,(4:0.004289708,(5:0.02653512,((6:0.01857646,7:0.005895727):0.005480969,(9:0.09563427,(10:0.008039666,11:0.01612633):0.02080799):0.0100693):0.01148968,8:0.07520899):0.03052227):0.007636011):0.003024347);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2298.26 -2318.69
2 -2298.43 -2317.24
--------------------------------------
TOTAL -2298.34 -2318.21
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PL/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.385422 0.003186 0.285139 0.501020 0.382228 1256.91 1270.69 1.000
r(A<->C){all} 0.117348 0.001195 0.053253 0.186696 0.114094 777.46 817.87 1.000
r(A<->G){all} 0.260672 0.003090 0.155466 0.363654 0.256585 551.21 719.48 1.000
r(A<->T){all} 0.122000 0.001662 0.051686 0.206977 0.118424 748.03 786.59 1.000
r(C<->G){all} 0.063051 0.000408 0.024987 0.103635 0.060645 843.36 965.71 1.002
r(C<->T){all} 0.426503 0.003724 0.309816 0.545263 0.424279 605.28 705.98 1.000
r(G<->T){all} 0.010426 0.000095 0.000007 0.029784 0.007550 897.68 1025.79 1.001
pi(A){all} 0.239497 0.000153 0.215039 0.262443 0.239234 1234.44 1241.30 1.000
pi(C){all} 0.303275 0.000174 0.278360 0.329285 0.303265 1166.91 1250.79 1.000
pi(G){all} 0.270450 0.000176 0.243600 0.295813 0.270446 1157.68 1165.09 1.000
pi(T){all} 0.186778 0.000117 0.166299 0.208001 0.186486 1178.36 1245.65 1.000
alpha{1,2} 0.046951 0.000666 0.000101 0.087423 0.049117 1057.99 1154.03 1.000
alpha{3} 2.367067 0.660360 1.003678 3.947117 2.222249 1408.85 1454.92 1.000
pinvar{all} 0.765000 0.000593 0.717879 0.811266 0.765715 1366.61 1411.82 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/acj6-PL/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 376
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 4 3 | Ser TCT 2 2 1 1 2 1 | Tyr TAT 3 2 2 3 2 2 | Cys TGT 2 2 2 2 2 2
TTC 5 5 5 5 4 5 | TCC 8 8 9 9 7 8 | TAC 4 5 5 4 5 5 | TGC 3 3 3 3 3 3
Leu TTA 4 4 4 4 5 4 | TCA 3 3 3 3 4 3 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 3 3 3 3 2 2 | TCG 11 11 11 11 11 12 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 0 0 0 | Pro CCT 5 5 5 5 3 5 | His CAT 11 9 9 9 9 9 | Arg CGT 7 7 7 7 6 5
CTC 3 4 4 3 3 3 | CCC 9 9 9 10 12 10 | CAC 15 17 17 17 17 17 | CGC 6 7 7 7 8 8
CTA 2 1 1 1 1 1 | CCA 5 5 5 5 5 3 | Gln CAA 9 9 9 8 9 9 | CGA 3 2 2 2 2 3
CTG 16 17 17 18 18 19 | CCG 7 7 7 6 6 8 | CAG 11 11 11 12 11 11 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 2 2 3 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 6 7 6 6 6 6 | Ser AGT 9 9 9 9 9 9
ATC 11 12 12 12 11 12 | ACC 3 3 3 3 2 2 | AAC 5 4 5 5 5 5 | AGC 6 6 6 6 6 6
ATA 1 1 1 1 1 1 | ACA 5 5 5 5 4 4 | Lys AAA 9 9 9 9 9 9 | Arg AGA 1 1 1 1 1 1
Met ATG 19 19 19 19 19 19 | ACG 9 9 9 9 11 11 | AAG 11 11 11 11 11 11 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 10 10 10 10 8 5 | Gly GGT 5 5 5 5 6 6
GTC 7 7 7 7 7 7 | GCC 12 12 12 12 12 13 | GAC 6 6 6 6 8 11 | GGC 9 9 9 9 10 10
GTA 3 3 3 3 4 3 | GCA 4 3 3 3 3 3 | Glu GAA 5 5 5 5 5 5 | GGA 7 7 7 7 5 5
GTG 4 4 4 4 3 4 | GCG 18 19 19 19 19 18 | GAG 11 11 11 11 11 11 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 2 3 4 | Ser TCT 1 1 0 1 1 | Tyr TAT 2 2 1 2 2 | Cys TGT 2 3 1 2 2
TTC 5 5 6 5 4 | TCC 8 8 8 9 9 | TAC 5 5 6 5 5 | TGC 3 2 4 3 3
Leu TTA 4 4 4 5 4 | TCA 4 7 4 4 4 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 3 5 4 3 3 | TCG 11 8 12 10 10 | TAG 0 0 0 0 0 | Trp TGG 3 3 3 3 3
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 | Pro CCT 4 5 4 3 5 | His CAT 9 10 5 9 9 | Arg CGT 6 7 6 7 7
CTC 3 3 2 3 3 | CCC 10 9 12 11 10 | CAC 17 16 21 17 17 | CGC 7 6 7 6 6
CTA 1 2 2 1 2 | CCA 5 8 3 6 5 | Gln CAA 9 8 6 9 8 | CGA 3 1 1 2 3
CTG 18 15 17 17 17 | CCG 7 4 7 6 6 | CAG 11 12 14 11 12 | CGG 2 2 3 2 2
----------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 3 3 2 | Thr ACT 2 2 2 2 2 | Asn AAT 6 6 6 6 6 | Ser AGT 9 9 9 9 9
ATC 11 10 11 11 12 | ACC 3 2 2 3 3 | AAC 5 5 5 5 5 | AGC 6 6 6 6 6
ATA 1 3 1 1 1 | ACA 4 5 4 3 3 | Lys AAA 9 9 8 8 8 | Arg AGA 1 2 1 2 1
Met ATG 19 19 19 19 19 | ACG 10 10 11 11 11 | AAG 11 11 12 12 12 | AGG 2 3 3 2 2
----------------------------------------------------------------------------------------------------------------------
Val GTT 2 3 2 2 2 | Ala GCT 3 3 4 3 3 | Asp GAT 8 11 7 7 7 | Gly GGT 6 4 5 5 5
GTC 7 5 7 7 6 | GCC 13 11 13 13 13 | GAC 8 5 9 9 9 | GGC 9 12 10 11 11
GTA 3 4 3 3 3 | GCA 3 5 3 3 4 | Glu GAA 5 5 5 5 5 | GGA 5 5 6 5 5
GTG 4 4 4 4 5 | GCG 18 18 17 18 17 | GAG 11 11 11 11 11 | GGG 3 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_acj6-PL
position 1: T:0.14362 C:0.29787 A:0.27128 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.19681 C:0.29787 A:0.16223 G:0.34309
Average T:0.19060 C:0.29255 A:0.24734 G:0.26950
#2: D_sechellia_acj6-PL
position 1: T:0.14362 C:0.29787 A:0.27128 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.18617 C:0.31117 A:0.15426 G:0.34840
Average T:0.18706 C:0.29699 A:0.24468 G:0.27128
#3: D_simulans_acj6-PL
position 1: T:0.14362 C:0.29787 A:0.27128 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.18085 C:0.31649 A:0.15426 G:0.34840
Average T:0.18528 C:0.29876 A:0.24468 G:0.27128
#4: D_erecta_acj6-PL
position 1: T:0.14362 C:0.29787 A:0.27128 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.18351 C:0.31383 A:0.15160 G:0.35106
Average T:0.18617 C:0.29787 A:0.24379 G:0.27216
#5: D_takahashii_acj6-PL
position 1: T:0.14362 C:0.29787 A:0.27128 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.17819 C:0.31915 A:0.15426 G:0.34840
Average T:0.18440 C:0.29965 A:0.24468 G:0.27128
#6: D_biarmipes_acj6-PL
position 1: T:0.14096 C:0.30053 A:0.27128 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.16489 C:0.33245 A:0.14362 G:0.35904
Average T:0.17908 C:0.30496 A:0.24113 G:0.27482
#7: D_suzukii_acj6-PL
position 1: T:0.14362 C:0.29787 A:0.27128 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.17553 C:0.31915 A:0.15160 G:0.35372
Average T:0.18351 C:0.29965 A:0.24379 G:0.27305
#8: D_eugracilis_acj6-PL
position 1: T:0.14894 C:0.28723 A:0.27660 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.18883 C:0.29255 A:0.18085 G:0.33777
Average T:0.18972 C:0.28723 A:0.25532 G:0.26773
#9: D_ficusphila_acj6-PL
position 1: T:0.14628 C:0.29255 A:0.27394 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.15160 C:0.34309 A:0.13564 G:0.36968
Average T:0.17642 C:0.30585 A:0.23936 G:0.27837
#10: D_rhopaloa_acj6-PL
position 1: T:0.14628 C:0.29255 A:0.27394 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.17021 C:0.32979 A:0.15160 G:0.34840
Average T:0.18262 C:0.30142 A:0.24468 G:0.27128
#11: D_elegans_acj6-PL
position 1: T:0.14362 C:0.29787 A:0.27128 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.17553 C:0.32447 A:0.14894 G:0.35106
Average T:0.18351 C:0.30142 A:0.24291 G:0.27216
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 34 | Ser S TCT 13 | Tyr Y TAT 23 | Cys C TGT 22
TTC 54 | TCC 91 | TAC 54 | TGC 33
Leu L TTA 46 | TCA 42 | *** * TAA 0 | *** * TGA 0
TTG 34 | TCG 118 | TAG 0 | Trp W TGG 33
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 49 | His H CAT 98 | Arg R CGT 72
CTC 34 | CCC 111 | CAC 188 | CGC 75
CTA 15 | CCA 55 | Gln Q CAA 93 | CGA 24
CTG 189 | CCG 71 | CAG 127 | CGG 23
------------------------------------------------------------------------------
Ile I ATT 27 | Thr T ACT 22 | Asn N AAT 67 | Ser S AGT 99
ATC 125 | ACC 29 | AAC 54 | AGC 66
ATA 13 | ACA 47 | Lys K AAA 96 | Arg R AGA 13
Met M ATG 209 | ACG 111 | AAG 124 | AGG 24
------------------------------------------------------------------------------
Val V GTT 23 | Ala A GCT 34 | Asp D GAT 93 | Gly G GGT 57
GTC 74 | GCC 136 | GAC 83 | GGC 109
GTA 35 | GCA 37 | Glu E GAA 55 | GGA 64
GTG 44 | GCG 200 | GAG 121 | GGG 23
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14434 C:0.29618 A:0.27224 G:0.28723
position 2: T:0.23138 C:0.28191 A:0.30851 G:0.17819
position 3: T:0.17747 C:0.31818 A:0.15353 G:0.35082
Average T:0.18440 C:0.29876 A:0.24476 G:0.27208
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_acj6-PL
D_sechellia_acj6-PL -1.0000 (0.0000 0.0345)
D_simulans_acj6-PL -1.0000 (0.0000 0.0345)-1.0000 (0.0000 0.0075)
D_erecta_acj6-PL -1.0000 (0.0000 0.0504)-1.0000 (0.0000 0.0267)-1.0000 (0.0000 0.0190)
D_takahashii_acj6-PL -1.0000 (0.0000 0.1397)-1.0000 (0.0000 0.1132)-1.0000 (0.0000 0.1132)-1.0000 (0.0000 0.1087)
D_biarmipes_acj6-PL -1.0000 (0.0000 0.1394)-1.0000 (0.0000 0.1130)-1.0000 (0.0000 0.1043)-1.0000 (0.0000 0.0999)-1.0000 (0.0000 0.0830)
D_suzukii_acj6-PL -1.0000 (0.0000 0.1262)-1.0000 (0.0000 0.1001)-1.0000 (0.0000 0.0916)-1.0000 (0.0000 0.0873)-1.0000 (0.0000 0.0789)-1.0000 (0.0000 0.0423)
D_eugracilis_acj6-PL -1.0000 (0.0000 0.1727)-1.0000 (0.0000 0.1776)-1.0000 (0.0000 0.1682)-1.0000 (0.0000 0.1633) 0.0073 (0.0012 0.1586)-1.0000 (0.0000 0.1677)-1.0000 (0.0000 0.1402)
D_ficusphila_acj6-PL -1.0000 (0.0000 0.2011)-1.0000 (0.0000 0.1771)-1.0000 (0.0000 0.1676)-1.0000 (0.0000 0.1628) 0.0067 (0.0012 0.1722)-1.0000 (0.0000 0.1579)-1.0000 (0.0000 0.1443)-1.0000 (0.0000 0.2270)
D_rhopaloa_acj6-PL -1.0000 (0.0000 0.1629)-1.0000 (0.0000 0.1401)-1.0000 (0.0000 0.1311)-1.0000 (0.0000 0.1355) 0.0111 (0.0012 0.1046)-1.0000 (0.0000 0.0916)-1.0000 (0.0000 0.0708)-1.0000 (0.0000 0.1590)-1.0000 (0.0000 0.1538)
D_elegans_acj6-PL -1.0000 (0.0000 0.1719)-1.0000 (0.0000 0.1488)-1.0000 (0.0000 0.1397)-1.0000 (0.0000 0.1351)-1.0000 (0.0000 0.1174)-1.0000 (0.0000 0.0914)-1.0000 (0.0000 0.0789)-1.0000 (0.0000 0.1632)-1.0000 (0.0000 0.1674)-1.0000 (0.0000 0.0425)
Model 0: one-ratio
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
lnL(ntime: 18 np: 20): -2207.820215 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.022753 0.002760 0.002864 0.000004 0.008710 0.005477 0.040684 0.040585 0.013427 0.008036 0.025986 0.005724 0.008840 0.094540 0.018872 0.012451 0.020267 0.080098 2.044293 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41208
(1: 0.022753, 2: 0.002760, (3: 0.000004, (4: 0.005477, (5: 0.040585, ((6: 0.025986, 7: 0.005724): 0.008036, (9: 0.094540, (10: 0.012451, 11: 0.020267): 0.018872): 0.008840): 0.013427, 8: 0.080098): 0.040684): 0.008710): 0.002864);
(D_melanogaster_acj6-PL: 0.022753, D_sechellia_acj6-PL: 0.002760, (D_simulans_acj6-PL: 0.000004, (D_erecta_acj6-PL: 0.005477, (D_takahashii_acj6-PL: 0.040585, ((D_biarmipes_acj6-PL: 0.025986, D_suzukii_acj6-PL: 0.005724): 0.008036, (D_ficusphila_acj6-PL: 0.094540, (D_rhopaloa_acj6-PL: 0.012451, D_elegans_acj6-PL: 0.020267): 0.018872): 0.008840): 0.013427, D_eugracilis_acj6-PL: 0.080098): 0.040684): 0.008710): 0.002864);
Detailed output identifying parameters
kappa (ts/tv) = 2.04429
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 848.4 279.6 0.0001 0.0000 0.0306 0.0 8.6
12..2 0.003 848.4 279.6 0.0001 0.0000 0.0037 0.0 1.0
12..13 0.003 848.4 279.6 0.0001 0.0000 0.0038 0.0 1.1
13..3 0.000 848.4 279.6 0.0001 0.0000 0.0000 0.0 0.0
13..14 0.009 848.4 279.6 0.0001 0.0000 0.0117 0.0 3.3
14..4 0.005 848.4 279.6 0.0001 0.0000 0.0074 0.0 2.1
14..15 0.041 848.4 279.6 0.0001 0.0000 0.0547 0.0 15.3
15..5 0.041 848.4 279.6 0.0001 0.0000 0.0546 0.0 15.3
15..16 0.013 848.4 279.6 0.0001 0.0000 0.0180 0.0 5.0
16..17 0.008 848.4 279.6 0.0001 0.0000 0.0108 0.0 3.0
17..6 0.026 848.4 279.6 0.0001 0.0000 0.0349 0.0 9.8
17..7 0.006 848.4 279.6 0.0001 0.0000 0.0077 0.0 2.2
16..18 0.009 848.4 279.6 0.0001 0.0000 0.0119 0.0 3.3
18..9 0.095 848.4 279.6 0.0001 0.0000 0.1271 0.0 35.5
18..19 0.019 848.4 279.6 0.0001 0.0000 0.0254 0.0 7.1
19..10 0.012 848.4 279.6 0.0001 0.0000 0.0167 0.0 4.7
19..11 0.020 848.4 279.6 0.0001 0.0000 0.0272 0.0 7.6
15..8 0.080 848.4 279.6 0.0001 0.0000 0.1077 0.0 30.1
tree length for dN: 0.0001
tree length for dS: 0.5539
Time used: 0:13
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
lnL(ntime: 18 np: 21): -2207.775789 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.022754 0.002760 0.002864 0.000004 0.008711 0.005478 0.040687 0.040587 0.013428 0.008036 0.025988 0.005725 0.008840 0.094551 0.018874 0.012452 0.020268 0.080105 2.043678 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41211
(1: 0.022754, 2: 0.002760, (3: 0.000004, (4: 0.005478, (5: 0.040587, ((6: 0.025988, 7: 0.005725): 0.008036, (9: 0.094551, (10: 0.012452, 11: 0.020268): 0.018874): 0.008840): 0.013428, 8: 0.080105): 0.040687): 0.008711): 0.002864);
(D_melanogaster_acj6-PL: 0.022754, D_sechellia_acj6-PL: 0.002760, (D_simulans_acj6-PL: 0.000004, (D_erecta_acj6-PL: 0.005478, (D_takahashii_acj6-PL: 0.040587, ((D_biarmipes_acj6-PL: 0.025988, D_suzukii_acj6-PL: 0.005725): 0.008036, (D_ficusphila_acj6-PL: 0.094551, (D_rhopaloa_acj6-PL: 0.012452, D_elegans_acj6-PL: 0.020268): 0.018874): 0.008840): 0.013428, D_eugracilis_acj6-PL: 0.080105): 0.040687): 0.008711): 0.002864);
Detailed output identifying parameters
kappa (ts/tv) = 2.04368
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 848.4 279.6 0.0000 0.0000 0.0306 0.0 8.6
12..2 0.003 848.4 279.6 0.0000 0.0000 0.0037 0.0 1.0
12..13 0.003 848.4 279.6 0.0000 0.0000 0.0039 0.0 1.1
13..3 0.000 848.4 279.6 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 848.4 279.6 0.0000 0.0000 0.0117 0.0 3.3
14..4 0.005 848.4 279.6 0.0000 0.0000 0.0074 0.0 2.1
14..15 0.041 848.4 279.6 0.0000 0.0000 0.0547 0.0 15.3
15..5 0.041 848.4 279.6 0.0000 0.0000 0.0546 0.0 15.3
15..16 0.013 848.4 279.6 0.0000 0.0000 0.0181 0.0 5.0
16..17 0.008 848.4 279.6 0.0000 0.0000 0.0108 0.0 3.0
17..6 0.026 848.4 279.6 0.0000 0.0000 0.0349 0.0 9.8
17..7 0.006 848.4 279.6 0.0000 0.0000 0.0077 0.0 2.2
16..18 0.009 848.4 279.6 0.0000 0.0000 0.0119 0.0 3.3
18..9 0.095 848.4 279.6 0.0000 0.0000 0.1271 0.0 35.5
18..19 0.019 848.4 279.6 0.0000 0.0000 0.0254 0.0 7.1
19..10 0.012 848.4 279.6 0.0000 0.0000 0.0167 0.0 4.7
19..11 0.020 848.4 279.6 0.0000 0.0000 0.0273 0.0 7.6
15..8 0.080 848.4 279.6 0.0000 0.0000 0.1077 0.0 30.1
Time used: 0:38
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
lnL(ntime: 18 np: 23): -2207.773192 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.022753 0.002759 0.002864 0.000004 0.008711 0.005477 0.040686 0.040586 0.013428 0.008036 0.025987 0.005724 0.008840 0.094549 0.018874 0.012452 0.020268 0.080103 2.043662 1.000000 0.000000 0.000001 20.154839
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41210
(1: 0.022753, 2: 0.002759, (3: 0.000004, (4: 0.005477, (5: 0.040586, ((6: 0.025987, 7: 0.005724): 0.008036, (9: 0.094549, (10: 0.012452, 11: 0.020268): 0.018874): 0.008840): 0.013428, 8: 0.080103): 0.040686): 0.008711): 0.002864);
(D_melanogaster_acj6-PL: 0.022753, D_sechellia_acj6-PL: 0.002759, (D_simulans_acj6-PL: 0.000004, (D_erecta_acj6-PL: 0.005477, (D_takahashii_acj6-PL: 0.040586, ((D_biarmipes_acj6-PL: 0.025987, D_suzukii_acj6-PL: 0.005724): 0.008036, (D_ficusphila_acj6-PL: 0.094549, (D_rhopaloa_acj6-PL: 0.012452, D_elegans_acj6-PL: 0.020268): 0.018874): 0.008840): 0.013428, D_eugracilis_acj6-PL: 0.080103): 0.040686): 0.008711): 0.002864);
Detailed output identifying parameters
kappa (ts/tv) = 2.04366
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 20.15484
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 848.4 279.6 0.0000 0.0000 0.0306 0.0 8.6
12..2 0.003 848.4 279.6 0.0000 0.0000 0.0037 0.0 1.0
12..13 0.003 848.4 279.6 0.0000 0.0000 0.0039 0.0 1.1
13..3 0.000 848.4 279.6 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 848.4 279.6 0.0000 0.0000 0.0117 0.0 3.3
14..4 0.005 848.4 279.6 0.0000 0.0000 0.0074 0.0 2.1
14..15 0.041 848.4 279.6 0.0000 0.0000 0.0547 0.0 15.3
15..5 0.041 848.4 279.6 0.0000 0.0000 0.0546 0.0 15.3
15..16 0.013 848.4 279.6 0.0000 0.0000 0.0181 0.0 5.0
16..17 0.008 848.4 279.6 0.0000 0.0000 0.0108 0.0 3.0
17..6 0.026 848.4 279.6 0.0000 0.0000 0.0349 0.0 9.8
17..7 0.006 848.4 279.6 0.0000 0.0000 0.0077 0.0 2.2
16..18 0.009 848.4 279.6 0.0000 0.0000 0.0119 0.0 3.3
18..9 0.095 848.4 279.6 0.0000 0.0000 0.1271 0.0 35.6
18..19 0.019 848.4 279.6 0.0000 0.0000 0.0254 0.0 7.1
19..10 0.012 848.4 279.6 0.0000 0.0000 0.0167 0.0 4.7
19..11 0.020 848.4 279.6 0.0000 0.0000 0.0273 0.0 7.6
15..8 0.080 848.4 279.6 0.0000 0.0000 0.1077 0.0 30.1
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_acj6-PL)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.521 0.110 0.063 0.050 0.046 0.043 0.042 0.042 0.041 0.041
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:42
Model 3: discrete (3 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
lnL(ntime: 18 np: 24): -2207.773192 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.022754 0.002760 0.002864 0.000004 0.008711 0.005478 0.040686 0.040586 0.013428 0.008036 0.025988 0.005725 0.008840 0.094549 0.018874 0.012452 0.020268 0.080103 2.043661 0.552072 0.214059 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41210
(1: 0.022754, 2: 0.002760, (3: 0.000004, (4: 0.005478, (5: 0.040586, ((6: 0.025988, 7: 0.005725): 0.008036, (9: 0.094549, (10: 0.012452, 11: 0.020268): 0.018874): 0.008840): 0.013428, 8: 0.080103): 0.040686): 0.008711): 0.002864);
(D_melanogaster_acj6-PL: 0.022754, D_sechellia_acj6-PL: 0.002760, (D_simulans_acj6-PL: 0.000004, (D_erecta_acj6-PL: 0.005478, (D_takahashii_acj6-PL: 0.040586, ((D_biarmipes_acj6-PL: 0.025988, D_suzukii_acj6-PL: 0.005725): 0.008036, (D_ficusphila_acj6-PL: 0.094549, (D_rhopaloa_acj6-PL: 0.012452, D_elegans_acj6-PL: 0.020268): 0.018874): 0.008840): 0.013428, D_eugracilis_acj6-PL: 0.080103): 0.040686): 0.008711): 0.002864);
Detailed output identifying parameters
kappa (ts/tv) = 2.04366
dN/dS (w) for site classes (K=3)
p: 0.55207 0.21406 0.23387
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 848.4 279.6 0.0000 0.0000 0.0306 0.0 8.6
12..2 0.003 848.4 279.6 0.0000 0.0000 0.0037 0.0 1.0
12..13 0.003 848.4 279.6 0.0000 0.0000 0.0039 0.0 1.1
13..3 0.000 848.4 279.6 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 848.4 279.6 0.0000 0.0000 0.0117 0.0 3.3
14..4 0.005 848.4 279.6 0.0000 0.0000 0.0074 0.0 2.1
14..15 0.041 848.4 279.6 0.0000 0.0000 0.0547 0.0 15.3
15..5 0.041 848.4 279.6 0.0000 0.0000 0.0546 0.0 15.3
15..16 0.013 848.4 279.6 0.0000 0.0000 0.0181 0.0 5.0
16..17 0.008 848.4 279.6 0.0000 0.0000 0.0108 0.0 3.0
17..6 0.026 848.4 279.6 0.0000 0.0000 0.0349 0.0 9.8
17..7 0.006 848.4 279.6 0.0000 0.0000 0.0077 0.0 2.2
16..18 0.009 848.4 279.6 0.0000 0.0000 0.0119 0.0 3.3
18..9 0.095 848.4 279.6 0.0000 0.0000 0.1271 0.0 35.6
18..19 0.019 848.4 279.6 0.0000 0.0000 0.0254 0.0 7.1
19..10 0.012 848.4 279.6 0.0000 0.0000 0.0167 0.0 4.7
19..11 0.020 848.4 279.6 0.0000 0.0000 0.0273 0.0 7.6
15..8 0.080 848.4 279.6 0.0000 0.0000 0.1077 0.0 30.1
Naive Empirical Bayes (NEB) analysis
Time used: 2:12
Model 7: beta (10 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
lnL(ntime: 18 np: 21): -2207.772726 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.022753 0.002760 0.002864 0.000004 0.008711 0.005478 0.040686 0.040587 0.013428 0.008036 0.025987 0.005725 0.008840 0.094549 0.018874 0.012452 0.020268 0.080103 2.043654 0.005000 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41210
(1: 0.022753, 2: 0.002760, (3: 0.000004, (4: 0.005478, (5: 0.040587, ((6: 0.025987, 7: 0.005725): 0.008036, (9: 0.094549, (10: 0.012452, 11: 0.020268): 0.018874): 0.008840): 0.013428, 8: 0.080103): 0.040686): 0.008711): 0.002864);
(D_melanogaster_acj6-PL: 0.022753, D_sechellia_acj6-PL: 0.002760, (D_simulans_acj6-PL: 0.000004, (D_erecta_acj6-PL: 0.005478, (D_takahashii_acj6-PL: 0.040587, ((D_biarmipes_acj6-PL: 0.025987, D_suzukii_acj6-PL: 0.005725): 0.008036, (D_ficusphila_acj6-PL: 0.094549, (D_rhopaloa_acj6-PL: 0.012452, D_elegans_acj6-PL: 0.020268): 0.018874): 0.008840): 0.013428, D_eugracilis_acj6-PL: 0.080103): 0.040686): 0.008711): 0.002864);
Detailed output identifying parameters
kappa (ts/tv) = 2.04365
Parameters in M7 (beta):
p = 0.00500 q = 99.00000
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 848.4 279.6 0.0000 0.0000 0.0306 0.0 8.6
12..2 0.003 848.4 279.6 0.0000 0.0000 0.0037 0.0 1.0
12..13 0.003 848.4 279.6 0.0000 0.0000 0.0039 0.0 1.1
13..3 0.000 848.4 279.6 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 848.4 279.6 0.0000 0.0000 0.0117 0.0 3.3
14..4 0.005 848.4 279.6 0.0000 0.0000 0.0074 0.0 2.1
14..15 0.041 848.4 279.6 0.0000 0.0000 0.0547 0.0 15.3
15..5 0.041 848.4 279.6 0.0000 0.0000 0.0546 0.0 15.3
15..16 0.013 848.4 279.6 0.0000 0.0000 0.0181 0.0 5.0
16..17 0.008 848.4 279.6 0.0000 0.0000 0.0108 0.0 3.0
17..6 0.026 848.4 279.6 0.0000 0.0000 0.0349 0.0 9.8
17..7 0.006 848.4 279.6 0.0000 0.0000 0.0077 0.0 2.2
16..18 0.009 848.4 279.6 0.0000 0.0000 0.0119 0.0 3.3
18..9 0.095 848.4 279.6 0.0000 0.0000 0.1271 0.0 35.6
18..19 0.019 848.4 279.6 0.0000 0.0000 0.0254 0.0 7.1
19..10 0.012 848.4 279.6 0.0000 0.0000 0.0167 0.0 4.7
19..11 0.020 848.4 279.6 0.0000 0.0000 0.0273 0.0 7.6
15..8 0.080 848.4 279.6 0.0000 0.0000 0.1077 0.0 30.1
Time used: 5:17
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 138
lnL(ntime: 18 np: 23): -2207.775324 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.022754 0.002760 0.002864 0.000004 0.008711 0.005478 0.040687 0.040587 0.013428 0.008036 0.025988 0.005725 0.008840 0.094551 0.018874 0.012452 0.020268 0.080105 2.043673 0.999990 0.005000 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41211
(1: 0.022754, 2: 0.002760, (3: 0.000004, (4: 0.005478, (5: 0.040587, ((6: 0.025988, 7: 0.005725): 0.008036, (9: 0.094551, (10: 0.012452, 11: 0.020268): 0.018874): 0.008840): 0.013428, 8: 0.080105): 0.040687): 0.008711): 0.002864);
(D_melanogaster_acj6-PL: 0.022754, D_sechellia_acj6-PL: 0.002760, (D_simulans_acj6-PL: 0.000004, (D_erecta_acj6-PL: 0.005478, (D_takahashii_acj6-PL: 0.040587, ((D_biarmipes_acj6-PL: 0.025988, D_suzukii_acj6-PL: 0.005725): 0.008036, (D_ficusphila_acj6-PL: 0.094551, (D_rhopaloa_acj6-PL: 0.012452, D_elegans_acj6-PL: 0.020268): 0.018874): 0.008840): 0.013428, D_eugracilis_acj6-PL: 0.080105): 0.040687): 0.008711): 0.002864);
Detailed output identifying parameters
kappa (ts/tv) = 2.04367
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 99.00000
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 848.4 279.6 0.0000 0.0000 0.0306 0.0 8.6
12..2 0.003 848.4 279.6 0.0000 0.0000 0.0037 0.0 1.0
12..13 0.003 848.4 279.6 0.0000 0.0000 0.0039 0.0 1.1
13..3 0.000 848.4 279.6 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 848.4 279.6 0.0000 0.0000 0.0117 0.0 3.3
14..4 0.005 848.4 279.6 0.0000 0.0000 0.0074 0.0 2.1
14..15 0.041 848.4 279.6 0.0000 0.0000 0.0547 0.0 15.3
15..5 0.041 848.4 279.6 0.0000 0.0000 0.0546 0.0 15.3
15..16 0.013 848.4 279.6 0.0000 0.0000 0.0181 0.0 5.0
16..17 0.008 848.4 279.6 0.0000 0.0000 0.0108 0.0 3.0
17..6 0.026 848.4 279.6 0.0000 0.0000 0.0349 0.0 9.8
17..7 0.006 848.4 279.6 0.0000 0.0000 0.0077 0.0 2.2
16..18 0.009 848.4 279.6 0.0000 0.0000 0.0119 0.0 3.3
18..9 0.095 848.4 279.6 0.0000 0.0000 0.1271 0.0 35.6
18..19 0.019 848.4 279.6 0.0000 0.0000 0.0254 0.0 7.1
19..10 0.012 848.4 279.6 0.0000 0.0000 0.0167 0.0 4.7
19..11 0.020 848.4 279.6 0.0000 0.0000 0.0273 0.0 7.6
15..8 0.080 848.4 279.6 0.0000 0.0000 0.1077 0.0 30.1
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_acj6-PL)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.018 0.149 0.832
ws: 0.778 0.071 0.030 0.021 0.018 0.017 0.016 0.016 0.016 0.016
Time used: 9:08
Model 1: NearlyNeutral -2207.775789 Model 2: PositiveSelection -2207.773192 Model 0: one-ratio -2207.820215 Model 3: discrete -2207.773192 Model 7: beta -2207.772726 Model 8: beta&w>1 -2207.775324 Model 0 vs 1 0.0888520000007702 Model 2 vs 1 0.005193999999391963 Model 8 vs 7 0.005196000000069034
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
