--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 08:45:27 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/acj6-PI/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2266.17 -2284.86
2 -2265.95 -2284.74
--------------------------------------
TOTAL -2266.06 -2284.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.388850 0.003261 0.282135 0.497652 0.384365 1312.29 1397.93 1.000
r(A<->C){all} 0.118751 0.001152 0.060245 0.190239 0.115789 848.97 932.21 1.000
r(A<->G){all} 0.247701 0.002851 0.148755 0.355528 0.245181 471.46 516.19 1.000
r(A<->T){all} 0.111127 0.001423 0.041648 0.184680 0.107305 777.09 799.93 1.000
r(C<->G){all} 0.065652 0.000415 0.029946 0.107426 0.063244 844.44 944.36 1.000
r(C<->T){all} 0.445810 0.003740 0.322958 0.563454 0.446044 672.17 746.40 1.000
r(G<->T){all} 0.010958 0.000105 0.000022 0.031156 0.007902 782.15 813.64 1.000
pi(A){all} 0.241819 0.000149 0.217424 0.265722 0.241292 1266.11 1281.69 1.000
pi(C){all} 0.306077 0.000175 0.280298 0.331841 0.306253 1162.05 1280.55 1.000
pi(G){all} 0.270149 0.000173 0.244127 0.295796 0.270271 1262.34 1311.24 1.000
pi(T){all} 0.181955 0.000121 0.160300 0.202828 0.181911 1185.48 1279.24 1.000
alpha{1,2} 0.045390 0.000683 0.000112 0.086819 0.047038 1048.01 1140.40 1.000
alpha{3} 2.455511 0.675468 1.067352 4.100930 2.337238 1389.62 1445.31 1.000
pinvar{all} 0.746716 0.000690 0.694248 0.797080 0.747571 1285.60 1323.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2168.428845
Model 2: PositiveSelection -2168.426242
Model 0: one-ratio -2168.474962
Model 3: discrete -2168.426242
Model 7: beta -2168.42576
Model 8: beta&w>1 -2168.428362
Model 0 vs 1 0.0922339999997348
Model 2 vs 1 0.005205999999816413
Model 8 vs 7 0.005204000000048836
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=366
C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
**************************************************
C1 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C2 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C3 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C4 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C5 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C6 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C7 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C8 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C9 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C10 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C11 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
**************************************************
C1 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C2 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C3 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C4 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C5 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C6 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C7 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C8 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C9 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C10 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C11 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
**************************************************
C1 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C2 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C3 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C4 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C5 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C6 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C7 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C8 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C9 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C10 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C11 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
**************************************************
C1 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C2 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C3 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C4 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C5 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C6 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C7 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C8 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C9 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C10 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C11 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
**************************************************
C1 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C2 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C3 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C4 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C5 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C6 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C7 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C8 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C9 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C10 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
C11 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
**************************************************
C1 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C2 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C3 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C4 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C5 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C6 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C7 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C8 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C9 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C10 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
C11 EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
**************************************************
C1 SVTPSMTGHGSAGFGY
C2 SVTPSMTGHGSAGFGY
C3 SVTPSMTGHGSAGFGY
C4 SVTPSMTGHGSAGFGY
C5 SVTPSMTGHGSAGFGY
C6 SVTPSMTGHGSAGFGY
C7 SVTPSMTGHGSAGFGY
C8 SVTPSMTGHGSAGFGY
C9 SVTPSMTGHGSAGFGY
C10 SVTPSMTGHGSAGFGY
C11 SVTPSMTGHGSAGFGY
****************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 366 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 366 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40260]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [40260]--->[40260]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/acj6-PI/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.676 Mb, Max= 31.818 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
FORMAT of file /tmp/tmp4043846865502735703aln Not Supported[FATAL:T-COFFEE]
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:366 S:100 BS:366
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 100.00 C1 C8 100.00
TOP 7 0 100.00 C8 C1 100.00
BOT 0 8 100.00 C1 C9 100.00
TOP 8 0 100.00 C9 C1 100.00
BOT 0 9 100.00 C1 C10 100.00
TOP 9 0 100.00 C10 C1 100.00
BOT 0 10 100.00 C1 C11 100.00
TOP 10 0 100.00 C11 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 1 6 100.00 C2 C7 100.00
TOP 6 1 100.00 C7 C2 100.00
BOT 1 7 100.00 C2 C8 100.00
TOP 7 1 100.00 C8 C2 100.00
BOT 1 8 100.00 C2 C9 100.00
TOP 8 1 100.00 C9 C2 100.00
BOT 1 9 100.00 C2 C10 100.00
TOP 9 1 100.00 C10 C2 100.00
BOT 1 10 100.00 C2 C11 100.00
TOP 10 1 100.00 C11 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 100.00 C3 C8 100.00
TOP 7 2 100.00 C8 C3 100.00
BOT 2 8 100.00 C3 C9 100.00
TOP 8 2 100.00 C9 C3 100.00
BOT 2 9 100.00 C3 C10 100.00
TOP 9 2 100.00 C10 C3 100.00
BOT 2 10 100.00 C3 C11 100.00
TOP 10 2 100.00 C11 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 100.00 C4 C7 100.00
TOP 6 3 100.00 C7 C4 100.00
BOT 3 7 100.00 C4 C8 100.00
TOP 7 3 100.00 C8 C4 100.00
BOT 3 8 100.00 C4 C9 100.00
TOP 8 3 100.00 C9 C4 100.00
BOT 3 9 100.00 C4 C10 100.00
TOP 9 3 100.00 C10 C4 100.00
BOT 3 10 100.00 C4 C11 100.00
TOP 10 3 100.00 C11 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 100.00 C5 C8 100.00
TOP 7 4 100.00 C8 C5 100.00
BOT 4 8 100.00 C5 C9 100.00
TOP 8 4 100.00 C9 C5 100.00
BOT 4 9 100.00 C5 C10 100.00
TOP 9 4 100.00 C10 C5 100.00
BOT 4 10 100.00 C5 C11 100.00
TOP 10 4 100.00 C11 C5 100.00
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
AVG 6 C7 * 100.00
AVG 7 C8 * 100.00
AVG 8 C9 * 100.00
AVG 9 C10 * 100.00
AVG 10 C11 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
C2 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C3 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C4 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C5 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C6 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C7 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C8 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C9 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C10 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C11 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
***************** ********************************
C1 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C2 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C3 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C4 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C5 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C6 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C7 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C8 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
C9 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA
C10 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C11 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
********************************* **************.*
C1 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C2 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C3 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C4 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C5 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C6 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C7 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C8 TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C9 TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC
C10 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C11 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
**** ***** ***********.** ************************
C1 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C2 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C3 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C4 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C5 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C6 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C7 GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C8 GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA
C9 GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA
C10 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C11 GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
** ** **.****************** ****.*****************
C1 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG
C2 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C3 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C4 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C5 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C6 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C7 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C8 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C9 GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG
C10 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C11 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
*** *********** **.** *****************.** *******
C1 ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C2 ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C3 ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C4 ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C5 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
C6 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG
C7 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
C8 ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
C9 ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG
C10 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
C11 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
* ******** ** ** ***************** ** **.***** **
C1 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
C2 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
C3 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
C4 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C5 CAGGAAAATCCCTTTTCCCGGCAGATGCACCACTCGATGGACCAGCTGGA
C6 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C7 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C8 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C9 CAGGAAAATCCTTTCTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C10 CAGGAAAATCCTTTTTCCCGACAGATGCACCACTCGATGGACCAACTGGA
C11 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
*********** ** ** **.***********************.*****
C1 CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
C2 CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
C3 CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
C4 CATGCTGGATCCAACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
C5 CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGT
C6 CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGT
C7 CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
C8 CATGCTGGATCCAACGGGCTCAATGACCACGTTGGCGCCCATATCGGAGT
C9 CATGCTGGACCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
C10 CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
C11 CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGT
********* **.********.********. ********** *******
C1 CGCCGCTAACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C2 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C3 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C4 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C5 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C6 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C7 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C8 CGCCTCTAACGCCAACACACCAACACCTGCACGGTTCCTATCACAGCATG
C9 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C10 CCCCACTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG
C11 CCCCTCTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG
* ** **.*****.********.***************************
C1 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCATACGGG
C2 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C3 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C4 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C5 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C6 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C7 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C8 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C9 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C10 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C11 AATCACATGATGAGCCACCACCATCCGGGCACGCTAAGTGGCCACACGGG
********************************* ********** *****
C1 GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCAG
C2 GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
C3 GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
C4 GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
C5 GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
C6 GGGTCACCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
C7 GGGTCACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
C8 GGGCCACCATGGACACTCAGCGGTACATCATCCTGTTATCACAGCGGCAG
C9 GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
C10 GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
C11 GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
*** ** ***********.***********************.*****.*
C1 TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C2 TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C3 TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C4 TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C5 TAGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C6 TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG
C7 TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG
C8 TGGCAGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C9 TGGCTGCCGCTGGCCTGCATCCCGACACAGACACCGATCCCCGCGAGCTG
C10 TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCCCGCGAGCTG
C11 TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCTCGCGAGCTG
*.**:***********************.** ******** *********
C1 GAGGCGTTTGCGGAGCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C2 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C3 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C4 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C5 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C6 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C7 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C8 GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTAC
C9 GAGGCCTTCGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C10 GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C11 GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
***** ** ******** ************************** ** **
C1 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C2 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C3 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C4 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C5 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C6 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C7 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C8 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C9 GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCG
C10 GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C11 GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
******************.**************.****************
C1 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
C2 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
C3 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
C4 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
C5 GTGCGCTGTCGCAGAGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCG
C6 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG
C7 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCG
C8 GAGCGCTGTCACAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG
C9 GCGCGCTGTCGCAGAGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCG
C10 GCGCGCTGTCGCAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG
C11 GCGCACTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG
* **.*****.************** .* ************** *****
C1 CACAACAACATGATCGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C2 CACAACAATATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C3 CACAACAACATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C4 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C5 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C6 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C7 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C8 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C9 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C10 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C11 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
******** *********** *****************************
C1 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
C2 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
C3 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
C4 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
C5 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTG
C6 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTG
C7 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTG
C8 GGCTGAGGCGCAGGCGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTG
C9 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTG
C10 GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTG
C11 GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTG
*** *********************.*.***** ** ** **********
C1 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C2 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C3 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C4 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C5 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCC
C6 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C7 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C8 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C9 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C10 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
C11 TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
*************************************************
C1 GAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
C2 GAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
C3 GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
C4 GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
C5 GAAAAGCGTTCTTTGGAAGCCTACTTTGCCGTCCAGCCGAGGCCATCCGG
C6 GAAAAGCGCTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCGTCCGG
C7 GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
C8 GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGG
C9 GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGG
C10 GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
C11 GAAAAGCGTTCCCTGGAAGCCTACTTTGCCGTGCAGCCGAGGCCATCCGG
******** ** ************* ***** ***********.*****
C1 TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C2 TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C3 TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C4 TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C5 TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C6 TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C7 TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C8 TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C9 TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C10 TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
C11 TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
************:** **********************************
C1 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C2 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C3 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C4 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C5 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C6 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C7 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C8 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C9 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C10 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
C11 TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
**************************************************
C1 AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C2 AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C3 AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C4 AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C5 AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C6 AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C7 AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C8 AGTGTAACACCATCAATGACTGGCCACGGTTCAGCGGGATTTGGATAC
C9 AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C10 AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C11 AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
***********.********************.***************
>C1
ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG
ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
CGCCGCTAACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCATACGGG
GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCAG
TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
CACAACAACATGATCGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C2
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
CACAACAATATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C3
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
CACAACAACATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C4
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGATCCAACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C5
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
CAGGAAAATCCCTTTTCCCGGCAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TAGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GTGCGCTGTCGCAGAGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCC
GAAAAGCGTTCTTTGGAAGCCTACTTTGCCGTCCAGCCGAGGCCATCCGG
TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C6
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGTCACCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGCTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCGTCCGG
TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C7
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGTCACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C8
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGATCCAACGGGCTCAATGACCACGTTGGCGCCCATATCGGAGT
CGCCTCTAACGCCAACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGCCACCATGGACACTCAGCGGTACATCATCCTGTTATCACAGCGGCAG
TGGCAGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCACAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCTGAGGCGCAGGCGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGG
TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCATCAATGACTGGCCACGGTTCAGCGGGATTTGGATAC
>C9
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA
TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA
GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG
ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG
CAGGAAAATCCTTTCTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGACCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCTGCCGCTGGCCTGCATCCCGACACAGACACCGATCCCCGCGAGCTG
GAGGCCTTCGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCG
GCGCGCTGTCGCAGAGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGG
TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C10
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGGAAAATCCTTTTTCCCGACAGATGCACCACTCGATGGACCAACTGGA
CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
CCCCACTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCCCGCGAGCTG
GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GCGCGCTGTCGCAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG
TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C11
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGT
CCCCTCTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGCTAAGTGGCCACACGGG
GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GCGCACTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT
GAAAAGCGTTCCCTGGAAGCCTACTTTGCCGTGCAGCCGAGGCCATCCGG
TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG
TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT
AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
SVTPSMTGHGSAGFGY
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 1098 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479803447
Setting output file names to "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 82198966
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4331362082
Seed = 1673763385
Swapseed = 1479803447
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 67 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -4057.534603 -- -24.640631
Chain 2 -- -4038.165282 -- -24.640631
Chain 3 -- -3981.167106 -- -24.640631
Chain 4 -- -4092.372532 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -4008.557080 -- -24.640631
Chain 2 -- -4065.718957 -- -24.640631
Chain 3 -- -4070.777339 -- -24.640631
Chain 4 -- -4072.677213 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-4057.535] (-4038.165) (-3981.167) (-4092.373) * [-4008.557] (-4065.719) (-4070.777) (-4072.677)
500 -- [-2415.656] (-2434.817) (-2450.796) (-2435.458) * (-2426.204) (-2415.219) [-2418.822] (-2443.414) -- 0:00:00
1000 -- [-2390.436] (-2385.060) (-2395.074) (-2398.594) * (-2369.124) [-2356.999] (-2390.344) (-2382.759) -- 0:00:00
1500 -- (-2358.564) [-2342.899] (-2367.384) (-2330.892) * (-2362.801) (-2341.695) [-2355.901] (-2355.347) -- 0:00:00
2000 -- (-2350.935) (-2317.103) (-2340.172) [-2300.146] * (-2343.521) [-2318.953] (-2345.261) (-2315.609) -- 0:08:19
2500 -- (-2336.131) [-2290.065] (-2319.040) (-2291.205) * (-2332.657) [-2284.912] (-2320.687) (-2296.523) -- 0:06:39
3000 -- (-2321.971) (-2274.821) (-2301.787) [-2275.675] * (-2307.289) [-2276.298] (-2297.146) (-2286.890) -- 0:05:32
3500 -- (-2315.043) [-2274.321] (-2279.574) (-2266.672) * (-2294.094) (-2268.908) [-2278.134] (-2286.036) -- 0:04:44
4000 -- (-2289.050) (-2280.494) [-2289.889] (-2274.458) * (-2294.097) (-2271.810) (-2283.378) [-2281.160] -- 0:04:09
4500 -- [-2273.962] (-2273.609) (-2279.890) (-2274.291) * (-2283.507) [-2269.650] (-2268.501) (-2277.485) -- 0:03:41
5000 -- [-2269.853] (-2277.261) (-2273.899) (-2271.994) * (-2277.772) [-2274.586] (-2280.741) (-2267.463) -- 0:06:38
Average standard deviation of split frequencies: 0.101675
5500 -- (-2277.053) (-2281.238) [-2270.927] (-2264.126) * (-2282.329) (-2282.610) (-2272.810) [-2270.780] -- 0:06:01
6000 -- (-2277.356) (-2279.021) (-2278.328) [-2276.752] * (-2283.782) [-2277.680] (-2284.226) (-2274.933) -- 0:05:31
6500 -- (-2284.323) (-2277.086) (-2274.353) [-2273.589] * (-2279.222) (-2284.264) [-2274.161] (-2282.187) -- 0:05:05
7000 -- (-2275.659) (-2282.896) (-2282.431) [-2268.474] * (-2270.155) [-2269.742] (-2277.596) (-2273.655) -- 0:04:43
7500 -- (-2296.664) (-2272.182) (-2277.339) [-2272.180] * (-2283.839) (-2280.916) (-2272.174) [-2274.876] -- 0:04:24
8000 -- (-2278.794) (-2282.480) (-2275.714) [-2266.036] * (-2278.487) (-2274.284) (-2285.488) [-2275.264] -- 0:04:08
8500 -- (-2278.112) [-2273.391] (-2281.138) (-2281.662) * (-2270.147) [-2269.270] (-2269.646) (-2279.867) -- 0:05:49
9000 -- (-2275.391) (-2273.251) (-2274.389) [-2287.007] * (-2294.829) [-2278.271] (-2278.203) (-2281.980) -- 0:05:30
9500 -- (-2277.061) [-2270.283] (-2286.025) (-2271.473) * [-2275.316] (-2277.658) (-2273.507) (-2276.464) -- 0:05:12
10000 -- (-2266.311) (-2275.249) (-2285.222) [-2264.355] * (-2279.182) (-2286.930) (-2272.483) [-2268.535] -- 0:04:57
Average standard deviation of split frequencies: 0.115585
10500 -- [-2265.885] (-2273.680) (-2275.660) (-2265.958) * (-2273.049) (-2289.912) (-2270.957) [-2273.355] -- 0:04:42
11000 -- [-2269.650] (-2264.463) (-2275.182) (-2265.883) * [-2276.257] (-2285.315) (-2275.991) (-2272.503) -- 0:04:29
11500 -- (-2275.712) [-2272.938] (-2276.928) (-2276.542) * (-2275.652) [-2272.147] (-2278.508) (-2282.464) -- 0:04:17
12000 -- (-2287.730) (-2290.397) [-2275.321] (-2278.659) * [-2269.501] (-2281.356) (-2274.363) (-2269.965) -- 0:05:29
12500 -- (-2274.924) (-2280.725) [-2265.590] (-2275.802) * (-2278.147) (-2285.073) [-2273.006] (-2268.925) -- 0:05:16
13000 -- (-2275.657) [-2273.570] (-2273.393) (-2274.683) * (-2268.345) (-2277.423) [-2278.598] (-2277.739) -- 0:05:03
13500 -- [-2272.029] (-2268.561) (-2276.133) (-2273.341) * (-2286.706) (-2288.633) [-2276.645] (-2279.499) -- 0:04:52
14000 -- (-2271.471) (-2279.487) [-2275.615] (-2282.205) * (-2271.259) (-2278.729) [-2268.365] (-2271.664) -- 0:04:41
14500 -- (-2281.402) (-2270.852) (-2273.506) [-2271.573] * (-2269.737) (-2281.744) [-2269.815] (-2272.661) -- 0:04:31
15000 -- (-2274.374) (-2278.208) [-2267.276] (-2286.139) * (-2272.568) (-2270.598) [-2271.076] (-2276.435) -- 0:04:22
Average standard deviation of split frequencies: 0.072675
15500 -- (-2269.734) (-2277.211) (-2279.698) [-2275.920] * (-2280.918) (-2276.688) [-2266.654] (-2287.040) -- 0:05:17
16000 -- (-2274.349) (-2269.232) (-2288.837) [-2270.402] * (-2275.016) (-2281.481) [-2275.721] (-2278.626) -- 0:05:07
16500 -- (-2283.268) (-2271.753) [-2271.419] (-2291.346) * [-2275.356] (-2286.255) (-2277.491) (-2273.557) -- 0:04:58
17000 -- (-2282.165) (-2275.053) [-2273.733] (-2292.315) * (-2273.939) (-2279.285) (-2282.943) [-2276.290] -- 0:04:49
17500 -- (-2283.599) (-2267.998) (-2277.751) [-2275.940] * (-2265.346) (-2266.499) (-2270.978) [-2275.278] -- 0:04:40
18000 -- (-2275.635) [-2270.010] (-2288.970) (-2290.857) * (-2268.340) [-2272.930] (-2279.972) (-2270.097) -- 0:04:32
18500 -- (-2275.496) (-2284.344) [-2272.279] (-2285.258) * (-2273.225) [-2268.681] (-2282.335) (-2279.414) -- 0:04:25
19000 -- [-2270.030] (-2275.009) (-2280.027) (-2279.884) * (-2281.739) (-2275.103) (-2280.786) [-2276.538] -- 0:05:09
19500 -- (-2278.111) (-2272.359) [-2273.929] (-2283.820) * (-2284.665) (-2277.586) (-2281.350) [-2267.500] -- 0:05:01
20000 -- (-2271.275) [-2273.014] (-2269.168) (-2280.923) * (-2275.418) (-2274.558) [-2280.313] (-2273.368) -- 0:04:54
Average standard deviation of split frequencies: 0.032586
20500 -- (-2273.031) (-2283.023) (-2286.762) [-2270.545] * (-2276.449) [-2277.198] (-2280.927) (-2272.662) -- 0:04:46
21000 -- (-2278.850) (-2275.578) (-2270.810) [-2275.509] * (-2276.911) [-2271.814] (-2279.903) (-2278.649) -- 0:05:26
21500 -- (-2289.394) (-2275.476) (-2262.786) [-2272.073] * (-2279.806) (-2276.507) (-2282.591) [-2277.975] -- 0:05:18
22000 -- (-2275.829) (-2271.162) [-2267.487] (-2274.497) * [-2281.674] (-2266.992) (-2274.642) (-2283.284) -- 0:05:11
22500 -- (-2280.259) [-2267.997] (-2268.503) (-2275.114) * (-2277.446) (-2272.618) (-2273.210) [-2272.694] -- 0:05:04
23000 -- (-2286.088) [-2270.082] (-2276.966) (-2279.007) * (-2279.886) [-2286.701] (-2280.125) (-2274.485) -- 0:04:57
23500 -- (-2279.322) (-2280.946) (-2281.121) [-2275.819] * (-2264.013) (-2270.127) [-2270.013] (-2281.411) -- 0:05:32
24000 -- (-2280.643) (-2282.232) [-2274.136] (-2270.077) * (-2271.564) [-2278.661] (-2288.552) (-2283.848) -- 0:05:25
24500 -- (-2281.043) [-2272.302] (-2279.965) (-2296.376) * (-2273.842) (-2275.926) (-2271.170) [-2280.925] -- 0:05:18
25000 -- (-2276.290) (-2276.878) [-2269.096] (-2274.854) * (-2273.028) (-2293.467) [-2267.594] (-2278.907) -- 0:05:12
Average standard deviation of split frequencies: 0.038528
25500 -- (-2267.462) [-2269.830] (-2279.816) (-2281.934) * [-2271.475] (-2274.778) (-2267.149) (-2289.919) -- 0:05:05
26000 -- (-2271.715) [-2271.286] (-2278.037) (-2277.341) * (-2277.666) [-2277.610] (-2280.146) (-2274.370) -- 0:05:37
26500 -- [-2273.209] (-2281.087) (-2281.128) (-2285.722) * (-2283.866) (-2279.949) [-2273.938] (-2275.290) -- 0:05:30
27000 -- (-2272.634) [-2273.135] (-2274.052) (-2274.377) * [-2264.301] (-2286.360) (-2280.115) (-2272.693) -- 0:05:24
27500 -- (-2279.114) (-2280.300) [-2267.889] (-2290.468) * [-2270.402] (-2287.234) (-2286.285) (-2280.133) -- 0:05:18
28000 -- (-2283.538) (-2266.863) (-2269.097) [-2283.506] * (-2275.455) [-2269.076] (-2288.136) (-2280.439) -- 0:05:12
28500 -- (-2279.392) [-2274.110] (-2269.250) (-2278.435) * (-2283.049) (-2264.079) [-2279.937] (-2279.580) -- 0:05:06
29000 -- (-2283.418) (-2265.287) [-2280.532] (-2272.811) * (-2296.207) [-2271.833] (-2276.611) (-2287.661) -- 0:05:01
29500 -- (-2281.396) [-2281.479] (-2278.015) (-2285.700) * (-2295.271) (-2269.305) [-2271.518] (-2277.426) -- 0:05:28
30000 -- (-2287.188) (-2279.095) [-2268.495] (-2276.493) * (-2279.620) [-2269.145] (-2292.671) (-2272.843) -- 0:05:23
Average standard deviation of split frequencies: 0.035136
30500 -- (-2277.699) (-2273.776) (-2273.325) [-2271.557] * (-2289.057) (-2266.873) (-2284.756) [-2273.729] -- 0:05:17
31000 -- [-2280.992] (-2271.190) (-2277.904) (-2269.387) * (-2282.101) (-2280.377) (-2286.230) [-2276.918] -- 0:05:12
31500 -- [-2276.096] (-2283.845) (-2277.767) (-2271.489) * (-2282.788) (-2272.899) [-2279.314] (-2271.953) -- 0:05:07
32000 -- (-2284.631) (-2278.748) (-2284.181) [-2277.157] * [-2282.491] (-2278.074) (-2282.581) (-2291.157) -- 0:05:02
32500 -- (-2283.932) [-2270.651] (-2277.942) (-2278.081) * (-2272.039) (-2273.329) [-2272.030] (-2272.795) -- 0:05:27
33000 -- (-2293.405) (-2271.766) [-2269.789] (-2273.077) * (-2282.859) (-2284.555) (-2279.117) [-2274.400] -- 0:05:22
33500 -- (-2273.528) (-2281.174) [-2267.650] (-2278.450) * (-2284.679) (-2282.775) [-2281.703] (-2292.581) -- 0:05:17
34000 -- (-2279.043) (-2287.885) (-2274.839) [-2274.410] * (-2276.490) (-2280.518) [-2281.712] (-2296.215) -- 0:05:12
34500 -- (-2286.612) (-2283.798) (-2279.347) [-2267.185] * [-2280.159] (-2275.057) (-2275.094) (-2286.064) -- 0:05:35
35000 -- [-2284.086] (-2292.221) (-2279.165) (-2268.132) * (-2276.175) (-2269.563) (-2273.073) [-2273.572] -- 0:05:30
Average standard deviation of split frequencies: 0.030218
35500 -- (-2289.419) [-2273.011] (-2272.324) (-2274.817) * (-2269.982) (-2277.631) [-2268.347] (-2272.404) -- 0:05:26
36000 -- [-2279.352] (-2297.797) (-2278.165) (-2277.163) * (-2286.914) [-2277.314] (-2273.292) (-2272.772) -- 0:05:21
36500 -- [-2282.260] (-2278.500) (-2274.235) (-2283.618) * [-2276.627] (-2271.754) (-2283.466) (-2268.211) -- 0:05:16
37000 -- (-2277.108) (-2284.580) (-2270.324) [-2280.847] * (-2269.806) [-2276.678] (-2266.375) (-2281.134) -- 0:05:12
37500 -- (-2283.639) (-2280.761) [-2272.372] (-2271.701) * [-2268.186] (-2272.040) (-2288.819) (-2277.011) -- 0:05:33
38000 -- (-2279.982) (-2275.634) [-2272.678] (-2274.518) * (-2283.901) [-2281.629] (-2274.186) (-2274.928) -- 0:05:29
38500 -- (-2279.367) (-2277.074) (-2267.886) [-2276.268] * (-2277.467) (-2282.390) [-2274.471] (-2278.564) -- 0:05:24
39000 -- (-2270.258) (-2276.716) (-2278.829) [-2270.807] * (-2268.603) (-2271.630) (-2271.839) [-2275.900] -- 0:05:20
39500 -- [-2272.476] (-2283.274) (-2272.586) (-2270.051) * [-2266.794] (-2283.591) (-2278.745) (-2279.800) -- 0:05:16
40000 -- [-2269.264] (-2277.770) (-2278.089) (-2280.740) * (-2282.113) [-2275.155] (-2275.996) (-2281.712) -- 0:05:12
Average standard deviation of split frequencies: 0.031464
40500 -- (-2286.399) [-2264.794] (-2283.691) (-2279.326) * [-2267.739] (-2279.893) (-2268.249) (-2282.677) -- 0:05:07
41000 -- (-2279.133) (-2274.630) [-2273.558] (-2268.924) * (-2266.731) [-2269.075] (-2277.994) (-2270.740) -- 0:05:04
41500 -- (-2270.192) (-2281.424) [-2274.518] (-2271.410) * [-2268.887] (-2275.710) (-2269.440) (-2292.598) -- 0:05:23
42000 -- [-2269.738] (-2280.358) (-2272.055) (-2279.529) * (-2267.180) (-2290.660) (-2274.569) [-2274.894] -- 0:05:19
42500 -- (-2271.832) [-2266.731] (-2290.691) (-2276.618) * (-2285.296) (-2276.701) [-2268.615] (-2270.811) -- 0:05:15
43000 -- [-2272.363] (-2284.995) (-2279.852) (-2275.987) * (-2266.927) (-2277.295) [-2266.495] (-2276.091) -- 0:05:11
43500 -- (-2278.144) [-2279.369] (-2279.588) (-2283.696) * (-2274.435) [-2274.436] (-2277.558) (-2288.060) -- 0:05:07
44000 -- (-2294.630) [-2275.196] (-2268.244) (-2273.451) * (-2276.846) (-2276.383) (-2295.273) [-2278.269] -- 0:05:04
44500 -- [-2277.100] (-2276.584) (-2284.236) (-2261.689) * [-2272.006] (-2279.370) (-2275.856) (-2280.227) -- 0:05:00
45000 -- (-2291.935) (-2280.113) [-2276.174] (-2278.593) * [-2270.882] (-2285.079) (-2270.363) (-2287.083) -- 0:05:18
Average standard deviation of split frequencies: 0.018446
45500 -- (-2285.309) [-2277.093] (-2282.262) (-2273.250) * (-2275.169) (-2279.527) [-2269.833] (-2281.910) -- 0:05:14
46000 -- [-2276.572] (-2287.794) (-2273.850) (-2273.844) * (-2275.885) [-2274.859] (-2278.703) (-2277.626) -- 0:05:11
46500 -- (-2271.627) (-2276.585) [-2273.995] (-2269.502) * [-2272.964] (-2272.701) (-2269.292) (-2273.131) -- 0:05:07
47000 -- (-2266.122) (-2273.032) (-2284.445) [-2268.882] * [-2271.703] (-2287.232) (-2281.405) (-2269.761) -- 0:05:04
47500 -- (-2274.144) (-2275.580) (-2276.537) [-2277.770] * (-2275.118) (-2282.789) (-2273.893) [-2266.756] -- 0:05:00
48000 -- (-2281.077) (-2278.014) [-2273.538] (-2279.688) * [-2272.411] (-2284.539) (-2276.472) (-2271.910) -- 0:05:17
48500 -- (-2291.393) (-2276.678) [-2264.922] (-2283.485) * [-2269.809] (-2286.397) (-2280.274) (-2280.255) -- 0:05:13
49000 -- (-2280.277) (-2279.448) [-2269.991] (-2280.941) * [-2271.693] (-2280.666) (-2274.090) (-2274.891) -- 0:05:10
49500 -- (-2276.444) (-2282.949) [-2275.174] (-2274.242) * (-2269.366) (-2281.264) (-2267.746) [-2270.766] -- 0:05:07
50000 -- [-2285.325] (-2273.895) (-2279.904) (-2283.120) * (-2283.742) (-2277.296) [-2273.644] (-2276.224) -- 0:05:04
Average standard deviation of split frequencies: 0.023925
50500 -- (-2271.045) (-2279.847) [-2280.617] (-2284.402) * [-2273.299] (-2295.071) (-2273.585) (-2272.114) -- 0:05:19
51000 -- (-2268.506) (-2280.864) (-2284.608) [-2267.820] * (-2275.990) (-2277.573) [-2272.066] (-2287.401) -- 0:05:16
51500 -- [-2280.649] (-2271.950) (-2286.893) (-2263.254) * (-2282.463) (-2288.480) [-2272.767] (-2295.800) -- 0:05:13
52000 -- (-2283.457) [-2278.169] (-2272.545) (-2269.329) * [-2272.856] (-2272.868) (-2275.195) (-2270.931) -- 0:05:09
52500 -- [-2279.156] (-2290.151) (-2285.940) (-2288.221) * (-2278.078) (-2272.079) [-2265.987] (-2280.307) -- 0:05:06
53000 -- (-2280.286) (-2274.126) [-2283.252] (-2278.319) * (-2274.725) [-2274.498] (-2283.964) (-2275.797) -- 0:05:03
53500 -- (-2270.425) (-2284.171) (-2274.467) [-2269.917] * (-2273.296) (-2291.240) [-2272.904] (-2277.389) -- 0:05:18
54000 -- [-2276.190] (-2277.487) (-2279.201) (-2282.839) * (-2278.214) (-2281.040) (-2278.841) [-2269.191] -- 0:05:15
54500 -- (-2280.125) (-2276.432) (-2267.550) [-2277.483] * (-2274.642) [-2271.744] (-2271.540) (-2271.507) -- 0:05:12
55000 -- (-2272.783) (-2275.840) (-2270.459) [-2272.112] * (-2281.274) [-2270.423] (-2274.843) (-2277.429) -- 0:05:09
Average standard deviation of split frequencies: 0.020764
55500 -- (-2276.217) (-2267.796) [-2267.294] (-2271.092) * [-2288.178] (-2279.219) (-2279.463) (-2276.602) -- 0:05:06
56000 -- (-2276.636) (-2278.071) [-2270.203] (-2267.795) * [-2271.831] (-2274.894) (-2285.601) (-2270.526) -- 0:05:03
56500 -- (-2281.380) (-2301.697) (-2276.152) [-2268.219] * (-2279.680) (-2278.283) [-2278.490] (-2285.224) -- 0:05:00
57000 -- (-2284.667) (-2283.516) (-2269.845) [-2276.535] * [-2270.899] (-2275.531) (-2275.366) (-2274.650) -- 0:05:14
57500 -- (-2275.773) (-2270.805) (-2283.396) [-2272.432] * (-2281.520) (-2282.715) (-2274.311) [-2273.595] -- 0:05:11
58000 -- [-2278.108] (-2283.506) (-2279.027) (-2281.272) * [-2282.558] (-2282.349) (-2277.846) (-2277.630) -- 0:05:08
58500 -- (-2278.001) (-2280.684) (-2275.642) [-2270.458] * (-2284.031) (-2273.600) [-2273.465] (-2271.191) -- 0:05:05
59000 -- [-2274.269] (-2289.881) (-2274.986) (-2280.358) * (-2279.054) (-2276.255) [-2278.331] (-2279.800) -- 0:05:03
59500 -- (-2275.586) (-2284.691) [-2277.043] (-2272.234) * (-2274.886) [-2272.225] (-2275.337) (-2278.242) -- 0:05:00
60000 -- (-2275.246) (-2275.401) [-2266.440] (-2268.430) * (-2275.512) [-2273.126] (-2270.382) (-2276.932) -- 0:05:13
Average standard deviation of split frequencies: 0.019981
60500 -- (-2275.927) (-2282.717) (-2270.772) [-2275.115] * (-2278.616) (-2283.649) [-2277.299] (-2279.248) -- 0:05:10
61000 -- (-2273.322) (-2276.480) [-2285.832] (-2272.839) * (-2277.097) [-2270.503] (-2275.105) (-2278.206) -- 0:05:07
61500 -- [-2266.013] (-2280.385) (-2275.175) (-2280.370) * (-2277.182) (-2271.015) (-2268.790) [-2270.921] -- 0:05:05
62000 -- (-2267.517) (-2274.874) [-2267.466] (-2274.560) * (-2284.694) (-2271.901) [-2276.548] (-2273.474) -- 0:05:02
62500 -- (-2268.012) (-2276.561) (-2280.138) [-2267.847] * (-2283.880) [-2273.225] (-2276.081) (-2283.473) -- 0:05:15
63000 -- [-2282.225] (-2281.956) (-2278.357) (-2279.017) * [-2281.631] (-2273.955) (-2272.637) (-2287.583) -- 0:05:12
63500 -- (-2276.099) (-2280.114) (-2280.847) [-2269.129] * [-2264.765] (-2266.533) (-2267.257) (-2284.991) -- 0:05:09
64000 -- [-2268.556] (-2275.642) (-2274.301) (-2265.738) * (-2267.391) (-2287.352) (-2274.617) [-2270.482] -- 0:05:07
64500 -- (-2272.551) (-2279.420) (-2279.314) [-2269.469] * [-2278.350] (-2282.142) (-2276.171) (-2277.819) -- 0:05:04
65000 -- (-2274.463) (-2273.294) [-2269.295] (-2281.592) * [-2274.307] (-2287.357) (-2270.025) (-2278.337) -- 0:05:02
Average standard deviation of split frequencies: 0.016666
65500 -- (-2279.670) (-2279.843) [-2273.744] (-2276.862) * (-2273.898) (-2297.998) (-2269.179) [-2268.429] -- 0:05:13
66000 -- (-2282.002) (-2285.001) (-2270.342) [-2277.432] * (-2283.626) (-2283.861) [-2269.562] (-2271.443) -- 0:05:11
66500 -- (-2279.436) (-2279.332) (-2281.506) [-2277.190] * [-2268.027] (-2275.239) (-2283.096) (-2271.889) -- 0:05:08
67000 -- [-2280.990] (-2272.462) (-2273.442) (-2282.425) * [-2269.225] (-2293.212) (-2281.628) (-2282.135) -- 0:05:06
67500 -- (-2275.834) (-2266.422) (-2278.702) [-2278.079] * (-2270.571) (-2286.908) (-2277.757) [-2277.108] -- 0:05:03
68000 -- (-2277.892) (-2277.650) (-2277.123) [-2271.245] * (-2273.511) (-2284.478) [-2275.217] (-2289.072) -- 0:05:01
68500 -- (-2268.361) [-2265.550] (-2276.024) (-2265.532) * (-2286.006) [-2277.006] (-2277.048) (-2276.044) -- 0:04:59
69000 -- (-2279.862) [-2272.333] (-2276.373) (-2279.080) * [-2265.683] (-2277.628) (-2280.232) (-2272.867) -- 0:05:10
69500 -- (-2272.869) (-2284.958) (-2274.746) [-2274.794] * (-2278.146) (-2275.849) (-2272.715) [-2272.931] -- 0:05:07
70000 -- (-2273.594) (-2286.963) (-2276.395) [-2279.451] * (-2276.149) [-2269.742] (-2279.301) (-2285.512) -- 0:05:05
Average standard deviation of split frequencies: 0.021791
70500 -- [-2280.173] (-2287.265) (-2276.963) (-2284.833) * [-2273.586] (-2277.908) (-2288.769) (-2280.173) -- 0:05:03
71000 -- (-2285.764) [-2282.761] (-2280.128) (-2274.138) * (-2267.208) [-2278.760] (-2292.851) (-2280.348) -- 0:05:00
71500 -- [-2282.938] (-2285.891) (-2286.157) (-2278.687) * [-2273.265] (-2286.857) (-2273.117) (-2273.502) -- 0:04:58
72000 -- (-2272.689) (-2281.821) [-2266.682] (-2271.097) * (-2277.340) (-2296.487) (-2271.756) [-2273.903] -- 0:05:09
72500 -- (-2272.740) (-2283.278) [-2262.606] (-2277.655) * [-2270.047] (-2282.611) (-2269.213) (-2269.229) -- 0:05:07
73000 -- [-2273.489] (-2282.213) (-2277.697) (-2271.518) * (-2277.919) (-2283.762) (-2285.862) [-2270.110] -- 0:05:04
73500 -- (-2271.824) (-2293.730) [-2269.800] (-2266.885) * (-2278.452) (-2278.921) [-2273.079] (-2276.002) -- 0:05:02
74000 -- [-2268.109] (-2287.367) (-2275.894) (-2277.680) * (-2285.130) (-2277.826) [-2268.762] (-2270.363) -- 0:05:00
74500 -- (-2274.970) [-2282.833] (-2288.695) (-2286.408) * (-2295.239) (-2278.329) (-2267.917) [-2277.819] -- 0:05:10
75000 -- (-2271.157) (-2275.837) (-2273.808) [-2274.652] * (-2284.327) (-2275.886) [-2276.140] (-2276.205) -- 0:05:08
Average standard deviation of split frequencies: 0.026051
75500 -- [-2275.336] (-2274.694) (-2285.152) (-2281.339) * (-2286.572) (-2269.363) (-2275.877) [-2265.942] -- 0:05:06
76000 -- (-2272.437) (-2288.971) (-2284.177) [-2275.475] * (-2278.265) (-2269.820) (-2287.869) [-2268.976] -- 0:05:03
76500 -- (-2277.317) [-2272.702] (-2271.843) (-2274.745) * (-2274.698) (-2268.995) [-2274.177] (-2286.750) -- 0:05:01
77000 -- (-2277.738) [-2273.937] (-2272.240) (-2274.984) * (-2287.634) (-2279.158) (-2276.715) [-2262.826] -- 0:05:11
77500 -- [-2274.365] (-2280.551) (-2286.032) (-2290.922) * (-2268.526) (-2278.231) [-2273.705] (-2268.218) -- 0:05:09
78000 -- [-2273.531] (-2277.148) (-2281.673) (-2277.549) * [-2268.672] (-2276.989) (-2275.155) (-2268.926) -- 0:05:07
78500 -- [-2263.984] (-2281.201) (-2286.991) (-2281.513) * (-2267.932) (-2283.109) [-2267.531] (-2277.283) -- 0:05:05
79000 -- (-2269.297) [-2272.584] (-2282.852) (-2279.107) * (-2297.453) (-2281.442) [-2264.321] (-2271.088) -- 0:05:03
79500 -- (-2284.569) (-2279.268) [-2278.895] (-2274.514) * (-2279.927) (-2283.631) (-2270.386) [-2270.920] -- 0:05:01
80000 -- (-2280.575) (-2279.543) [-2269.227] (-2272.512) * (-2284.723) (-2272.943) (-2273.107) [-2267.106] -- 0:04:59
Average standard deviation of split frequencies: 0.027271
80500 -- (-2281.702) (-2279.953) [-2273.410] (-2271.337) * (-2275.750) (-2283.747) [-2274.697] (-2272.674) -- 0:05:08
81000 -- (-2285.978) (-2275.370) (-2276.171) [-2267.717] * (-2270.299) (-2282.321) [-2267.823] (-2275.806) -- 0:05:06
81500 -- (-2277.802) (-2279.651) (-2278.192) [-2268.170] * (-2288.091) (-2270.140) [-2268.677] (-2274.828) -- 0:05:04
82000 -- (-2284.927) (-2282.815) (-2281.401) [-2269.584] * (-2271.128) [-2272.352] (-2273.212) (-2278.725) -- 0:05:02
82500 -- (-2274.660) (-2282.030) [-2269.547] (-2276.417) * (-2280.680) (-2275.390) [-2270.191] (-2284.509) -- 0:05:00
83000 -- (-2295.632) [-2273.659] (-2274.039) (-2285.629) * (-2303.595) [-2285.614] (-2271.861) (-2268.668) -- 0:04:58
83500 -- (-2274.118) (-2265.045) [-2275.696] (-2278.979) * [-2279.825] (-2272.515) (-2271.493) (-2275.964) -- 0:04:56
84000 -- (-2273.281) (-2286.811) [-2270.060] (-2276.466) * (-2265.974) (-2283.592) (-2270.674) [-2272.723] -- 0:05:05
84500 -- (-2271.918) (-2280.941) (-2289.914) [-2263.164] * (-2277.335) (-2267.060) [-2275.418] (-2278.720) -- 0:05:03
85000 -- (-2275.429) (-2286.116) (-2271.533) [-2283.991] * (-2273.951) (-2281.186) [-2281.351] (-2269.088) -- 0:05:01
Average standard deviation of split frequencies: 0.021195
85500 -- (-2273.122) (-2277.553) (-2297.492) [-2267.478] * [-2281.896] (-2285.590) (-2275.220) (-2267.148) -- 0:04:59
86000 -- (-2274.958) (-2281.678) (-2268.107) [-2276.249] * (-2278.533) [-2268.756] (-2264.904) (-2273.223) -- 0:04:57
86500 -- [-2280.435] (-2277.434) (-2277.830) (-2275.275) * (-2283.017) [-2270.679] (-2268.352) (-2280.202) -- 0:04:55
87000 -- [-2270.435] (-2281.552) (-2271.872) (-2281.974) * [-2274.077] (-2276.071) (-2274.168) (-2284.112) -- 0:05:04
87500 -- (-2277.350) [-2271.006] (-2283.189) (-2277.735) * (-2281.273) [-2275.205] (-2281.152) (-2284.927) -- 0:05:02
88000 -- (-2274.808) [-2271.750] (-2280.534) (-2277.498) * (-2276.279) (-2275.502) (-2294.327) [-2266.369] -- 0:05:00
88500 -- (-2273.101) (-2278.214) (-2277.170) [-2267.718] * (-2280.545) [-2270.402] (-2269.639) (-2276.350) -- 0:04:58
89000 -- (-2284.646) (-2268.563) (-2272.050) [-2279.319] * (-2270.816) [-2273.679] (-2268.647) (-2278.241) -- 0:04:56
89500 -- (-2272.043) [-2275.839] (-2274.577) (-2274.736) * (-2278.882) (-2288.155) [-2274.120] (-2282.997) -- 0:05:05
90000 -- [-2270.353] (-2280.241) (-2284.218) (-2275.980) * [-2271.252] (-2273.484) (-2269.344) (-2280.237) -- 0:05:03
Average standard deviation of split frequencies: 0.016638
90500 -- (-2276.065) (-2280.534) (-2279.354) [-2280.791] * (-2272.696) (-2282.610) [-2270.947] (-2284.013) -- 0:05:01
91000 -- (-2266.043) (-2280.880) (-2279.230) [-2273.794] * (-2272.155) (-2276.199) (-2275.617) [-2268.926] -- 0:04:59
91500 -- (-2272.970) (-2277.112) (-2286.191) [-2274.433] * [-2269.008] (-2265.333) (-2277.597) (-2285.402) -- 0:04:57
92000 -- (-2279.829) (-2273.806) (-2279.529) [-2267.746] * (-2279.407) (-2268.397) (-2281.046) [-2272.567] -- 0:04:56
92500 -- [-2282.253] (-2279.281) (-2275.644) (-2265.984) * (-2279.361) [-2270.453] (-2275.711) (-2281.483) -- 0:05:04
93000 -- (-2276.583) (-2274.749) (-2277.780) [-2268.013] * (-2277.214) (-2271.606) (-2270.744) [-2271.411] -- 0:05:02
93500 -- (-2293.483) [-2270.219] (-2276.928) (-2277.280) * (-2280.781) (-2273.384) (-2289.810) [-2277.584] -- 0:05:00
94000 -- (-2277.517) [-2275.891] (-2278.814) (-2276.536) * (-2271.605) [-2275.766] (-2277.763) (-2270.364) -- 0:04:58
94500 -- (-2284.279) (-2276.837) (-2272.557) [-2274.297] * [-2278.829] (-2270.386) (-2281.868) (-2275.114) -- 0:04:57
95000 -- (-2269.099) [-2266.974] (-2276.131) (-2291.790) * (-2277.359) [-2282.806] (-2276.328) (-2268.281) -- 0:04:55
Average standard deviation of split frequencies: 0.016368
95500 -- (-2275.392) [-2271.153] (-2271.085) (-2286.473) * (-2277.020) [-2271.862] (-2271.749) (-2280.142) -- 0:04:53
96000 -- (-2277.265) (-2277.682) [-2271.212] (-2274.394) * (-2275.511) [-2270.949] (-2284.544) (-2271.317) -- 0:05:01
96500 -- (-2273.992) [-2278.429] (-2269.396) (-2283.055) * (-2273.246) (-2281.271) (-2279.855) [-2265.964] -- 0:04:59
97000 -- (-2270.016) (-2279.770) [-2274.643] (-2286.755) * [-2272.538] (-2286.665) (-2274.146) (-2277.434) -- 0:04:57
97500 -- [-2277.018] (-2278.974) (-2273.411) (-2291.164) * (-2277.791) (-2272.386) (-2280.996) [-2271.870] -- 0:04:56
98000 -- (-2284.829) (-2285.233) [-2267.521] (-2286.443) * (-2271.319) (-2270.581) [-2270.738] (-2286.669) -- 0:04:54
98500 -- (-2271.468) (-2280.710) [-2271.030] (-2281.742) * (-2273.645) [-2268.031] (-2277.710) (-2287.667) -- 0:04:52
99000 -- (-2275.820) (-2278.697) [-2274.398] (-2289.301) * (-2281.460) [-2265.257] (-2268.278) (-2284.299) -- 0:04:51
99500 -- [-2278.055] (-2280.777) (-2278.121) (-2280.107) * [-2267.768] (-2275.646) (-2281.679) (-2274.145) -- 0:04:58
100000 -- (-2280.320) (-2274.382) (-2276.935) [-2273.731] * [-2266.497] (-2275.572) (-2271.484) (-2272.807) -- 0:04:57
Average standard deviation of split frequencies: 0.015609
100500 -- (-2275.209) (-2274.746) (-2276.413) [-2269.440] * (-2280.718) [-2273.198] (-2268.451) (-2286.261) -- 0:04:55
101000 -- [-2268.009] (-2271.579) (-2289.383) (-2289.451) * [-2270.595] (-2274.129) (-2268.187) (-2279.031) -- 0:04:53
101500 -- [-2270.421] (-2278.575) (-2277.352) (-2276.553) * (-2285.679) [-2272.257] (-2280.206) (-2274.106) -- 0:04:52
102000 -- [-2269.861] (-2276.976) (-2272.330) (-2280.519) * (-2286.176) (-2268.758) [-2277.836] (-2286.445) -- 0:04:50
102500 -- (-2270.871) [-2276.101] (-2287.454) (-2285.805) * (-2275.258) (-2279.709) [-2274.136] (-2274.639) -- 0:04:48
103000 -- (-2269.887) (-2278.140) [-2279.267] (-2294.531) * (-2274.958) [-2268.512] (-2273.263) (-2280.114) -- 0:04:56
103500 -- [-2273.957] (-2276.482) (-2267.796) (-2280.909) * (-2285.513) [-2268.579] (-2279.734) (-2275.977) -- 0:04:54
104000 -- (-2271.097) [-2273.183] (-2279.554) (-2263.840) * (-2284.704) (-2276.594) [-2286.397] (-2273.645) -- 0:04:52
104500 -- [-2273.953] (-2282.407) (-2269.239) (-2276.109) * [-2280.822] (-2277.506) (-2286.507) (-2268.641) -- 0:04:51
105000 -- [-2272.188] (-2279.516) (-2278.441) (-2280.302) * [-2269.042] (-2283.379) (-2278.712) (-2275.277) -- 0:04:49
Average standard deviation of split frequencies: 0.018085
105500 -- (-2295.545) (-2279.247) (-2284.155) [-2270.609] * [-2275.295] (-2274.122) (-2290.348) (-2269.539) -- 0:04:48
106000 -- (-2275.671) (-2274.230) [-2276.187] (-2281.540) * (-2276.353) [-2279.850] (-2280.797) (-2281.676) -- 0:04:46
106500 -- [-2275.750] (-2271.304) (-2287.511) (-2271.297) * (-2272.663) (-2280.890) [-2273.881] (-2280.476) -- 0:04:45
107000 -- (-2277.715) (-2280.550) [-2274.132] (-2270.714) * (-2277.686) (-2290.621) [-2274.683] (-2280.214) -- 0:04:52
107500 -- (-2276.964) [-2266.783] (-2271.573) (-2273.233) * [-2285.191] (-2269.554) (-2269.422) (-2288.212) -- 0:04:50
108000 -- (-2275.988) (-2280.053) (-2273.819) [-2275.689] * [-2280.686] (-2271.115) (-2279.597) (-2281.144) -- 0:04:49
108500 -- (-2267.751) (-2270.957) (-2277.627) [-2275.987] * (-2275.446) (-2262.434) (-2274.198) [-2280.949] -- 0:04:47
109000 -- (-2274.565) [-2268.356] (-2275.938) (-2278.178) * (-2288.285) (-2283.961) [-2269.413] (-2269.722) -- 0:04:46
109500 -- [-2264.648] (-2272.324) (-2270.031) (-2279.213) * (-2269.402) (-2273.703) (-2271.871) [-2270.590] -- 0:04:44
110000 -- (-2275.975) [-2265.926] (-2278.484) (-2272.076) * [-2263.680] (-2279.333) (-2272.510) (-2280.703) -- 0:04:43
Average standard deviation of split frequencies: 0.019027
110500 -- [-2269.890] (-2278.866) (-2284.486) (-2269.599) * (-2277.478) [-2281.693] (-2270.466) (-2275.824) -- 0:04:49
111000 -- (-2271.761) (-2275.201) (-2271.873) [-2273.599] * (-2275.858) (-2277.741) (-2265.277) [-2279.662] -- 0:04:48
111500 -- [-2269.918] (-2286.693) (-2278.736) (-2277.265) * [-2276.586] (-2274.521) (-2272.249) (-2282.863) -- 0:04:46
112000 -- (-2272.923) (-2280.626) (-2273.886) [-2271.088] * (-2278.653) (-2286.413) [-2270.562] (-2279.514) -- 0:04:45
112500 -- (-2280.704) [-2268.720] (-2267.041) (-2272.816) * [-2267.927] (-2288.012) (-2274.191) (-2276.218) -- 0:04:44
113000 -- (-2283.936) (-2279.477) (-2265.996) [-2267.503] * (-2278.770) (-2269.055) [-2270.335] (-2283.898) -- 0:04:42
113500 -- (-2274.721) (-2279.044) (-2280.793) [-2265.506] * (-2276.135) [-2278.103] (-2278.732) (-2283.829) -- 0:04:41
114000 -- (-2280.568) (-2279.897) (-2267.821) [-2271.115] * (-2264.331) (-2276.956) (-2285.068) [-2286.669] -- 0:04:47
114500 -- (-2288.643) (-2284.426) [-2271.631] (-2272.585) * (-2279.965) [-2275.914] (-2281.878) (-2275.668) -- 0:04:46
115000 -- (-2277.607) (-2277.618) (-2295.285) [-2273.626] * (-2267.829) [-2283.610] (-2286.046) (-2283.711) -- 0:04:44
Average standard deviation of split frequencies: 0.019235
115500 -- (-2300.166) (-2286.084) (-2268.002) [-2267.711] * (-2277.053) (-2281.322) [-2282.486] (-2282.051) -- 0:04:43
116000 -- (-2276.532) (-2281.086) (-2275.944) [-2268.522] * (-2276.039) (-2276.400) (-2273.192) [-2279.299] -- 0:04:41
116500 -- (-2287.410) [-2265.548] (-2280.333) (-2279.326) * (-2269.189) (-2277.005) [-2271.621] (-2271.092) -- 0:04:40
117000 -- (-2281.383) (-2277.448) (-2276.175) [-2276.055] * (-2264.583) [-2269.359] (-2265.993) (-2281.116) -- 0:04:39
117500 -- (-2275.462) (-2272.217) (-2276.116) [-2275.083] * (-2271.790) (-2282.198) [-2270.324] (-2268.101) -- 0:04:45
118000 -- (-2278.373) (-2274.608) [-2271.916] (-2282.682) * [-2270.949] (-2282.084) (-2274.571) (-2270.950) -- 0:04:44
118500 -- (-2282.655) (-2275.328) (-2276.067) [-2282.711] * (-2282.718) (-2266.430) [-2269.838] (-2284.542) -- 0:04:42
119000 -- [-2272.081] (-2276.749) (-2282.196) (-2276.405) * (-2275.968) (-2279.016) [-2274.270] (-2283.792) -- 0:04:41
119500 -- (-2274.387) (-2279.895) [-2267.623] (-2278.339) * (-2293.185) [-2270.331] (-2278.169) (-2282.447) -- 0:04:39
120000 -- (-2281.383) [-2285.047] (-2270.550) (-2284.776) * (-2281.847) (-2271.676) (-2275.595) [-2276.205] -- 0:04:38
Average standard deviation of split frequencies: 0.019533
120500 -- (-2268.896) (-2268.927) (-2272.602) [-2275.014] * (-2262.576) (-2281.148) (-2274.971) [-2268.817] -- 0:04:37
121000 -- (-2274.531) (-2284.297) [-2274.971] (-2274.181) * (-2285.968) (-2284.682) [-2276.985] (-2292.228) -- 0:04:43
121500 -- (-2277.462) [-2278.901] (-2266.799) (-2281.608) * (-2281.428) (-2272.455) (-2283.227) [-2270.631] -- 0:04:41
122000 -- (-2278.194) (-2286.337) (-2276.510) [-2286.543] * (-2295.901) (-2269.208) (-2266.083) [-2266.746] -- 0:04:40
122500 -- (-2277.023) [-2273.816] (-2270.778) (-2289.161) * (-2276.609) [-2274.349] (-2279.087) (-2278.222) -- 0:04:39
123000 -- (-2271.363) [-2276.482] (-2265.328) (-2297.924) * (-2268.197) (-2290.753) (-2289.439) [-2278.847] -- 0:04:38
123500 -- (-2281.676) [-2272.911] (-2274.252) (-2283.570) * (-2270.475) (-2283.385) [-2274.405] (-2272.346) -- 0:04:36
124000 -- (-2274.540) [-2274.428] (-2276.155) (-2289.100) * [-2281.832] (-2265.033) (-2280.127) (-2271.616) -- 0:04:35
124500 -- [-2273.289] (-2284.056) (-2284.934) (-2276.983) * [-2269.758] (-2267.827) (-2283.955) (-2282.116) -- 0:04:41
125000 -- (-2271.390) [-2271.908] (-2270.695) (-2279.662) * [-2272.184] (-2273.987) (-2269.324) (-2282.110) -- 0:04:40
Average standard deviation of split frequencies: 0.019455
125500 -- (-2282.382) (-2270.362) (-2273.723) [-2271.703] * (-2280.273) (-2277.469) [-2272.909] (-2279.260) -- 0:04:38
126000 -- (-2280.723) (-2271.876) [-2276.377] (-2268.542) * (-2279.062) (-2270.962) [-2283.894] (-2284.088) -- 0:04:37
126500 -- (-2276.974) [-2269.023] (-2276.103) (-2273.225) * [-2276.588] (-2270.244) (-2267.135) (-2275.410) -- 0:04:36
127000 -- (-2272.037) (-2281.077) [-2274.319] (-2286.944) * [-2267.677] (-2274.978) (-2278.107) (-2285.993) -- 0:04:34
127500 -- (-2278.397) (-2278.182) [-2275.462] (-2276.345) * (-2271.740) [-2269.336] (-2273.931) (-2279.087) -- 0:04:33
128000 -- (-2278.602) (-2276.076) (-2273.246) [-2267.226] * (-2276.249) [-2270.461] (-2278.625) (-2284.073) -- 0:04:39
128500 -- (-2277.320) (-2281.372) [-2269.354] (-2273.924) * (-2275.000) [-2274.941] (-2266.749) (-2282.462) -- 0:04:38
129000 -- [-2267.382] (-2287.144) (-2276.443) (-2272.140) * (-2278.467) (-2274.437) (-2274.718) [-2271.386] -- 0:04:36
129500 -- [-2269.003] (-2279.821) (-2268.874) (-2280.952) * (-2270.107) (-2275.170) (-2274.625) [-2272.130] -- 0:04:35
130000 -- [-2264.329] (-2273.691) (-2283.308) (-2281.153) * [-2277.266] (-2277.594) (-2272.877) (-2279.851) -- 0:04:34
Average standard deviation of split frequencies: 0.018038
130500 -- (-2267.823) [-2284.507] (-2270.113) (-2276.241) * (-2283.028) [-2278.823] (-2282.670) (-2277.870) -- 0:04:33
131000 -- (-2272.411) (-2275.539) (-2277.883) [-2274.344] * (-2278.048) (-2271.781) (-2269.475) [-2273.751] -- 0:04:38
131500 -- [-2269.031] (-2275.401) (-2277.332) (-2274.769) * (-2276.386) (-2281.748) (-2279.723) [-2272.018] -- 0:04:37
132000 -- (-2270.721) (-2282.295) [-2276.030] (-2285.694) * (-2276.198) (-2275.724) (-2273.115) [-2265.583] -- 0:04:36
132500 -- [-2269.526] (-2276.881) (-2268.481) (-2278.435) * [-2278.175] (-2278.657) (-2280.050) (-2274.892) -- 0:04:34
133000 -- (-2281.744) [-2270.661] (-2270.193) (-2286.820) * [-2276.566] (-2277.759) (-2288.027) (-2272.918) -- 0:04:33
133500 -- (-2278.469) [-2270.760] (-2274.149) (-2284.504) * (-2284.343) (-2271.675) (-2277.990) [-2265.883] -- 0:04:32
134000 -- [-2271.026] (-2269.655) (-2275.520) (-2274.471) * (-2275.104) [-2270.452] (-2277.720) (-2269.915) -- 0:04:37
134500 -- (-2280.558) [-2275.746] (-2288.548) (-2272.564) * (-2275.761) (-2289.332) (-2278.749) [-2268.415] -- 0:04:36
135000 -- (-2279.192) [-2274.044] (-2278.621) (-2272.009) * (-2283.572) (-2284.882) (-2274.274) [-2270.619] -- 0:04:35
Average standard deviation of split frequencies: 0.017331
135500 -- [-2269.745] (-2276.742) (-2286.124) (-2285.184) * (-2274.645) [-2270.533] (-2272.843) (-2280.734) -- 0:04:34
136000 -- [-2269.523] (-2283.775) (-2285.887) (-2285.953) * (-2282.654) [-2276.768] (-2282.701) (-2269.666) -- 0:04:33
136500 -- (-2289.696) [-2276.837] (-2276.365) (-2270.056) * (-2279.842) (-2280.182) (-2275.884) [-2263.277] -- 0:04:38
137000 -- (-2272.589) [-2276.806] (-2274.757) (-2277.863) * (-2288.402) (-2275.933) [-2269.591] (-2277.913) -- 0:04:37
137500 -- [-2268.238] (-2264.559) (-2279.739) (-2276.839) * (-2285.054) (-2279.891) [-2269.535] (-2284.276) -- 0:04:36
138000 -- (-2285.156) [-2270.566] (-2279.798) (-2270.280) * (-2274.394) (-2302.587) (-2290.930) [-2273.296] -- 0:04:34
138500 -- (-2278.943) (-2272.102) [-2284.140] (-2280.536) * (-2281.341) (-2267.364) [-2274.131] (-2288.233) -- 0:04:33
139000 -- (-2271.614) (-2273.482) [-2270.677] (-2281.754) * (-2285.658) [-2277.315] (-2283.416) (-2269.885) -- 0:04:32
139500 -- [-2272.565] (-2279.643) (-2265.741) (-2281.109) * (-2279.525) (-2270.473) [-2268.411] (-2274.052) -- 0:04:31
140000 -- (-2272.047) [-2275.763] (-2278.822) (-2273.372) * (-2277.353) (-2277.215) (-2287.774) [-2266.776] -- 0:04:36
Average standard deviation of split frequencies: 0.017203
140500 -- (-2282.384) [-2272.665] (-2278.255) (-2271.093) * (-2275.181) [-2269.634] (-2274.053) (-2280.223) -- 0:04:35
141000 -- [-2271.714] (-2289.814) (-2288.346) (-2265.961) * (-2279.332) (-2268.706) [-2277.712] (-2291.798) -- 0:04:34
141500 -- (-2273.449) (-2269.329) [-2272.328] (-2274.507) * [-2271.668] (-2283.781) (-2273.503) (-2280.908) -- 0:04:33
142000 -- (-2271.794) (-2271.140) (-2279.285) [-2267.408] * (-2272.845) (-2273.097) [-2275.382] (-2285.266) -- 0:04:31
142500 -- [-2273.729] (-2280.707) (-2280.521) (-2281.868) * (-2278.729) (-2274.879) (-2281.476) [-2280.367] -- 0:04:30
143000 -- (-2280.011) (-2294.489) [-2277.408] (-2268.257) * [-2271.147] (-2283.370) (-2275.061) (-2274.047) -- 0:04:29
143500 -- [-2271.681] (-2282.268) (-2271.206) (-2278.615) * (-2272.975) [-2271.502] (-2278.992) (-2269.035) -- 0:04:34
144000 -- (-2273.843) [-2269.643] (-2277.366) (-2273.337) * (-2281.257) [-2267.534] (-2274.285) (-2275.690) -- 0:04:33
144500 -- (-2290.342) [-2269.757] (-2278.685) (-2280.428) * (-2289.357) (-2273.614) [-2262.560] (-2270.996) -- 0:04:32
145000 -- (-2284.891) (-2283.577) [-2278.266] (-2295.583) * (-2285.369) (-2265.860) (-2270.890) [-2273.323] -- 0:04:31
Average standard deviation of split frequencies: 0.016359
145500 -- (-2268.057) (-2273.070) [-2273.104] (-2287.395) * (-2292.527) [-2276.223] (-2264.199) (-2285.199) -- 0:04:30
146000 -- (-2275.640) (-2272.433) (-2269.578) [-2281.716] * (-2288.590) [-2270.923] (-2270.036) (-2279.101) -- 0:04:29
146500 -- (-2269.786) [-2274.391] (-2269.604) (-2280.998) * (-2300.372) (-2271.589) [-2275.515] (-2277.196) -- 0:04:27
147000 -- (-2271.271) (-2280.973) (-2279.859) [-2272.501] * (-2269.204) (-2278.644) (-2277.397) [-2271.810] -- 0:04:32
147500 -- (-2267.150) (-2269.943) [-2272.163] (-2271.071) * (-2274.623) [-2271.189] (-2278.220) (-2274.649) -- 0:04:31
148000 -- (-2269.574) (-2267.751) (-2277.548) [-2270.996] * (-2293.338) (-2273.744) [-2267.577] (-2277.738) -- 0:04:30
148500 -- (-2270.960) [-2270.234] (-2287.112) (-2277.896) * (-2277.150) (-2276.563) [-2269.461] (-2283.287) -- 0:04:29
149000 -- (-2283.459) [-2287.606] (-2277.742) (-2286.928) * (-2292.695) [-2285.116] (-2274.441) (-2275.317) -- 0:04:28
149500 -- (-2269.989) (-2275.525) (-2288.071) [-2276.149] * (-2276.008) (-2274.435) [-2275.858] (-2282.863) -- 0:04:27
150000 -- (-2270.524) (-2270.482) [-2280.346] (-2269.639) * [-2272.322] (-2278.892) (-2270.533) (-2289.161) -- 0:04:26
Average standard deviation of split frequencies: 0.015853
150500 -- [-2268.441] (-2273.480) (-2276.145) (-2279.854) * [-2272.825] (-2277.414) (-2266.283) (-2281.773) -- 0:04:30
151000 -- (-2277.344) (-2284.281) [-2276.800] (-2278.336) * [-2267.929] (-2282.142) (-2270.357) (-2272.123) -- 0:04:29
151500 -- (-2283.722) [-2272.762] (-2278.147) (-2281.407) * (-2271.407) (-2283.592) (-2269.310) [-2275.128] -- 0:04:28
152000 -- [-2276.845] (-2273.447) (-2276.161) (-2278.854) * (-2274.492) (-2291.007) [-2284.624] (-2280.722) -- 0:04:27
152500 -- (-2274.564) (-2288.187) (-2282.528) [-2277.324] * (-2275.997) (-2285.990) [-2269.026] (-2270.154) -- 0:04:26
153000 -- (-2281.931) (-2276.335) (-2278.243) [-2274.063] * (-2294.385) (-2274.723) [-2278.210] (-2282.795) -- 0:04:31
153500 -- (-2278.768) (-2291.737) (-2278.926) [-2267.631] * (-2280.778) [-2273.401] (-2277.203) (-2272.653) -- 0:04:30
154000 -- (-2274.400) (-2278.232) [-2280.661] (-2287.244) * [-2290.094] (-2292.061) (-2273.309) (-2279.550) -- 0:04:29
154500 -- [-2271.833] (-2287.775) (-2278.931) (-2278.406) * (-2280.459) (-2276.929) [-2276.166] (-2274.714) -- 0:04:28
155000 -- [-2271.354] (-2284.101) (-2276.853) (-2278.196) * (-2276.927) (-2278.787) (-2273.521) [-2271.007] -- 0:04:27
Average standard deviation of split frequencies: 0.017325
155500 -- (-2275.107) (-2295.182) (-2273.472) [-2272.148] * (-2274.189) (-2286.866) [-2275.423] (-2279.996) -- 0:04:26
156000 -- (-2271.273) (-2278.696) [-2267.572] (-2283.158) * (-2279.977) (-2287.937) [-2280.372] (-2289.294) -- 0:04:30
156500 -- (-2272.527) [-2277.189] (-2266.768) (-2271.294) * (-2283.121) [-2282.041] (-2282.984) (-2282.733) -- 0:04:29
157000 -- (-2267.093) (-2269.999) (-2283.641) [-2280.487] * [-2269.025] (-2285.151) (-2288.413) (-2274.076) -- 0:04:28
157500 -- (-2273.869) (-2272.735) [-2274.072] (-2280.304) * (-2281.815) (-2279.834) [-2277.795] (-2278.693) -- 0:04:27
158000 -- (-2277.108) (-2276.376) (-2291.899) [-2274.106] * (-2277.300) (-2273.448) (-2271.784) [-2271.147] -- 0:04:26
158500 -- (-2275.929) (-2272.373) [-2277.787] (-2282.068) * (-2282.494) (-2268.410) (-2281.832) [-2271.818] -- 0:04:25
159000 -- (-2266.703) (-2283.637) [-2275.020] (-2271.381) * (-2286.859) [-2266.590] (-2282.156) (-2271.859) -- 0:04:24
159500 -- (-2282.330) [-2276.907] (-2270.876) (-2280.583) * (-2273.190) (-2277.143) [-2265.529] (-2267.347) -- 0:04:28
160000 -- (-2282.744) [-2269.818] (-2278.742) (-2276.175) * [-2275.912] (-2272.925) (-2271.174) (-2277.154) -- 0:04:27
Average standard deviation of split frequencies: 0.017800
160500 -- (-2281.718) (-2274.385) [-2266.403] (-2278.831) * (-2273.525) (-2267.910) [-2280.307] (-2269.407) -- 0:04:26
161000 -- (-2277.396) (-2284.112) [-2275.967] (-2273.540) * (-2276.126) (-2277.000) (-2274.408) [-2271.333] -- 0:04:25
161500 -- (-2275.834) (-2273.493) [-2277.098] (-2276.291) * [-2264.439] (-2275.505) (-2271.221) (-2278.536) -- 0:04:24
162000 -- (-2276.764) (-2273.587) [-2269.911] (-2275.929) * (-2267.186) [-2273.857] (-2293.029) (-2282.889) -- 0:04:23
162500 -- (-2276.354) (-2279.694) [-2272.429] (-2293.806) * (-2275.428) (-2276.107) (-2271.413) [-2271.690] -- 0:04:22
163000 -- (-2275.736) [-2272.702] (-2269.809) (-2289.759) * (-2275.742) [-2276.268] (-2266.704) (-2271.526) -- 0:04:27
163500 -- (-2283.932) (-2284.961) (-2284.290) [-2273.048] * (-2278.808) (-2264.314) (-2271.105) [-2268.742] -- 0:04:26
164000 -- (-2277.719) (-2277.852) (-2267.077) [-2273.399] * (-2273.591) (-2276.777) [-2266.833] (-2271.435) -- 0:04:25
164500 -- (-2278.825) (-2273.221) [-2270.334] (-2275.173) * [-2274.198] (-2280.255) (-2267.277) (-2274.377) -- 0:04:24
165000 -- (-2284.898) (-2273.687) [-2268.735] (-2280.323) * (-2266.147) [-2276.676] (-2273.104) (-2286.603) -- 0:04:23
Average standard deviation of split frequencies: 0.017607
165500 -- (-2280.338) (-2276.263) (-2284.456) [-2280.743] * (-2273.092) (-2283.828) [-2269.806] (-2278.440) -- 0:04:22
166000 -- (-2269.340) (-2284.833) (-2273.267) [-2271.268] * [-2269.669] (-2278.328) (-2277.104) (-2271.060) -- 0:04:21
166500 -- [-2271.702] (-2279.552) (-2272.830) (-2277.256) * (-2285.832) (-2275.040) [-2275.469] (-2282.045) -- 0:04:25
167000 -- (-2273.882) [-2273.133] (-2276.754) (-2284.136) * (-2280.128) (-2277.470) (-2275.097) [-2272.575] -- 0:04:24
167500 -- [-2273.634] (-2271.188) (-2268.407) (-2277.606) * (-2274.757) (-2289.417) [-2270.656] (-2289.435) -- 0:04:23
168000 -- [-2266.235] (-2284.961) (-2281.503) (-2275.793) * (-2274.153) (-2282.037) [-2277.667] (-2280.272) -- 0:04:22
168500 -- (-2274.847) [-2278.841] (-2276.012) (-2271.836) * (-2268.180) (-2290.729) (-2273.445) [-2271.259] -- 0:04:21
169000 -- (-2274.047) [-2271.629] (-2271.795) (-2281.722) * (-2284.187) [-2275.602] (-2266.370) (-2281.620) -- 0:04:20
169500 -- [-2263.710] (-2283.545) (-2275.365) (-2270.373) * [-2270.928] (-2277.331) (-2277.208) (-2268.849) -- 0:04:19
170000 -- (-2262.841) (-2284.037) [-2272.475] (-2272.611) * (-2274.491) (-2285.650) (-2283.018) [-2271.287] -- 0:04:23
Average standard deviation of split frequencies: 0.015468
170500 -- (-2266.508) (-2293.523) (-2268.230) [-2269.759] * (-2270.343) (-2278.594) (-2281.910) [-2269.779] -- 0:04:22
171000 -- (-2282.892) [-2272.993] (-2275.484) (-2268.920) * (-2271.932) (-2280.606) (-2277.438) [-2265.958] -- 0:04:21
171500 -- [-2272.959] (-2273.584) (-2291.500) (-2270.148) * [-2278.066] (-2277.358) (-2273.592) (-2270.051) -- 0:04:20
172000 -- (-2271.052) (-2276.553) [-2288.099] (-2283.516) * (-2291.547) [-2264.784] (-2272.081) (-2271.810) -- 0:04:19
172500 -- (-2279.508) (-2275.421) [-2269.560] (-2288.451) * [-2289.018] (-2283.983) (-2272.383) (-2268.815) -- 0:04:19
173000 -- (-2272.607) (-2279.936) [-2274.842] (-2277.507) * [-2272.884] (-2268.446) (-2286.927) (-2268.044) -- 0:04:22
173500 -- (-2273.506) (-2274.166) [-2277.343] (-2277.461) * (-2278.969) [-2274.225] (-2285.381) (-2271.032) -- 0:04:22
174000 -- (-2271.772) (-2276.446) (-2277.022) [-2267.002] * (-2280.026) (-2278.929) [-2267.013] (-2286.917) -- 0:04:21
174500 -- (-2273.805) (-2277.237) [-2273.257] (-2275.079) * (-2274.724) [-2272.671] (-2278.699) (-2275.739) -- 0:04:20
175000 -- (-2277.838) (-2275.944) (-2288.443) [-2269.600] * (-2268.975) (-2268.536) (-2270.770) [-2274.721] -- 0:04:19
Average standard deviation of split frequencies: 0.016071
175500 -- (-2273.659) (-2276.626) [-2268.730] (-2291.356) * (-2270.634) (-2277.912) [-2280.600] (-2281.375) -- 0:04:23
176000 -- (-2279.157) (-2268.524) [-2264.920] (-2286.905) * (-2279.541) [-2271.695] (-2275.613) (-2276.442) -- 0:04:22
176500 -- (-2277.837) [-2269.131] (-2268.924) (-2274.175) * (-2287.194) [-2264.095] (-2278.398) (-2282.168) -- 0:04:21
177000 -- (-2287.046) (-2279.283) (-2275.016) [-2268.994] * (-2271.880) [-2270.365] (-2273.640) (-2283.975) -- 0:04:20
177500 -- (-2287.986) [-2270.849] (-2284.975) (-2270.585) * [-2281.454] (-2278.367) (-2270.314) (-2274.555) -- 0:04:19
178000 -- (-2283.355) (-2265.221) [-2278.515] (-2266.609) * [-2279.146] (-2274.089) (-2271.317) (-2265.641) -- 0:04:23
178500 -- (-2289.507) (-2273.187) (-2281.061) [-2267.370] * (-2275.332) (-2276.486) [-2272.885] (-2278.240) -- 0:04:22
179000 -- (-2301.655) (-2276.761) (-2273.842) [-2272.554] * (-2273.336) [-2273.971] (-2271.798) (-2272.929) -- 0:04:21
179500 -- (-2280.908) (-2273.348) (-2269.334) [-2271.183] * (-2274.418) [-2275.493] (-2270.654) (-2270.267) -- 0:04:20
180000 -- (-2282.800) [-2269.777] (-2274.735) (-2267.541) * (-2273.245) [-2272.937] (-2276.423) (-2284.546) -- 0:04:19
Average standard deviation of split frequencies: 0.016525
180500 -- (-2282.489) (-2265.677) (-2272.166) [-2267.796] * [-2276.984] (-2266.155) (-2274.998) (-2283.858) -- 0:04:18
181000 -- (-2280.804) (-2277.818) (-2272.640) [-2271.986] * (-2290.563) (-2276.691) (-2277.283) [-2274.419] -- 0:04:17
181500 -- (-2274.837) [-2290.095] (-2277.981) (-2279.366) * (-2272.285) (-2277.663) (-2277.126) [-2276.876] -- 0:04:21
182000 -- (-2286.376) (-2277.678) [-2270.757] (-2278.000) * (-2273.250) [-2277.855] (-2281.793) (-2277.700) -- 0:04:20
182500 -- (-2275.805) [-2285.851] (-2273.671) (-2277.168) * (-2277.710) [-2264.375] (-2269.992) (-2284.219) -- 0:04:19
183000 -- (-2280.166) (-2270.458) (-2290.519) [-2276.378] * [-2281.867] (-2287.954) (-2273.150) (-2279.428) -- 0:04:18
183500 -- (-2282.545) (-2282.608) (-2286.246) [-2269.036] * (-2274.539) (-2272.213) (-2275.994) [-2277.064] -- 0:04:18
184000 -- (-2276.206) (-2273.678) (-2284.243) [-2267.342] * (-2272.553) (-2268.578) [-2271.401] (-2274.131) -- 0:04:17
184500 -- (-2282.463) [-2267.764] (-2285.436) (-2272.606) * (-2285.776) (-2271.473) (-2279.291) [-2269.508] -- 0:04:16
185000 -- (-2275.542) [-2268.456] (-2277.437) (-2282.907) * [-2265.773] (-2267.355) (-2285.162) (-2283.240) -- 0:04:19
Average standard deviation of split frequencies: 0.014362
185500 -- (-2289.378) (-2290.923) (-2289.707) [-2273.125] * [-2273.216] (-2269.053) (-2275.171) (-2281.338) -- 0:04:19
186000 -- (-2296.883) (-2277.995) (-2271.336) [-2277.656] * [-2273.867] (-2279.938) (-2275.874) (-2277.426) -- 0:04:18
186500 -- (-2277.199) (-2288.264) [-2267.991] (-2277.161) * (-2274.376) [-2280.379] (-2276.825) (-2283.640) -- 0:04:17
187000 -- (-2286.283) (-2284.884) (-2267.325) [-2276.844] * (-2280.583) (-2276.481) [-2270.699] (-2275.447) -- 0:04:16
187500 -- (-2285.491) (-2280.993) [-2275.492] (-2283.071) * (-2273.466) (-2279.861) [-2270.987] (-2289.828) -- 0:04:15
188000 -- (-2288.407) [-2278.961] (-2268.349) (-2282.918) * (-2271.149) (-2286.861) [-2273.603] (-2274.763) -- 0:04:19
188500 -- (-2269.097) (-2280.871) [-2272.630] (-2283.809) * (-2277.168) (-2271.472) [-2276.420] (-2279.538) -- 0:04:18
189000 -- (-2289.659) (-2289.480) (-2273.799) [-2277.614] * (-2293.815) [-2281.330] (-2274.684) (-2268.458) -- 0:04:17
189500 -- (-2272.216) (-2278.789) [-2275.918] (-2281.384) * (-2272.011) [-2275.067] (-2273.367) (-2272.736) -- 0:04:16
190000 -- (-2277.786) (-2280.156) [-2269.861] (-2284.355) * (-2276.055) (-2273.142) (-2275.479) [-2275.741] -- 0:04:15
Average standard deviation of split frequencies: 0.014834
190500 -- (-2278.128) (-2274.181) [-2274.478] (-2277.810) * (-2278.004) [-2272.836] (-2276.864) (-2288.984) -- 0:04:14
191000 -- [-2287.078] (-2269.151) (-2284.344) (-2277.441) * (-2283.559) [-2274.112] (-2270.478) (-2270.074) -- 0:04:18
191500 -- (-2272.526) (-2285.274) (-2275.252) [-2270.552] * (-2279.618) (-2268.352) [-2279.028] (-2303.541) -- 0:04:17
192000 -- [-2268.777] (-2290.916) (-2283.015) (-2279.958) * [-2276.631] (-2270.062) (-2282.958) (-2278.619) -- 0:04:16
192500 -- (-2276.743) (-2282.239) [-2276.230] (-2273.318) * (-2270.729) (-2269.410) (-2275.032) [-2271.931] -- 0:04:15
193000 -- (-2285.070) (-2279.290) (-2275.697) [-2272.354] * [-2266.495] (-2266.096) (-2279.061) (-2278.750) -- 0:04:15
193500 -- (-2274.662) (-2268.553) [-2267.519] (-2276.219) * (-2275.593) (-2279.093) [-2275.939] (-2280.539) -- 0:04:14
194000 -- [-2269.631] (-2274.548) (-2272.675) (-2270.875) * (-2278.093) [-2271.721] (-2279.070) (-2286.459) -- 0:04:13
194500 -- (-2284.968) (-2286.211) [-2278.669] (-2269.403) * [-2275.935] (-2269.636) (-2274.458) (-2281.224) -- 0:04:16
195000 -- (-2282.804) [-2271.392] (-2274.473) (-2280.207) * (-2291.639) (-2267.003) [-2269.982] (-2278.123) -- 0:04:15
Average standard deviation of split frequencies: 0.014751
195500 -- (-2283.623) [-2273.482] (-2273.372) (-2279.210) * (-2287.620) [-2272.498] (-2274.397) (-2279.372) -- 0:04:15
196000 -- (-2287.116) (-2276.519) (-2291.181) [-2265.565] * (-2271.877) [-2265.407] (-2284.445) (-2297.420) -- 0:04:14
196500 -- [-2272.968] (-2276.817) (-2273.547) (-2280.294) * (-2274.209) [-2263.794] (-2284.523) (-2286.334) -- 0:04:13
197000 -- (-2278.489) [-2270.010] (-2273.135) (-2274.695) * (-2269.497) (-2273.499) (-2270.711) [-2270.272] -- 0:04:12
197500 -- (-2297.065) (-2274.866) (-2275.089) [-2272.059] * [-2266.556] (-2269.732) (-2279.977) (-2285.342) -- 0:04:11
198000 -- (-2280.717) [-2276.638] (-2287.943) (-2271.570) * [-2261.526] (-2285.266) (-2276.211) (-2277.914) -- 0:04:15
198500 -- [-2267.669] (-2280.336) (-2276.318) (-2273.915) * (-2275.241) [-2270.033] (-2272.615) (-2281.131) -- 0:04:14
199000 -- [-2271.896] (-2274.748) (-2278.154) (-2273.664) * (-2272.656) (-2289.539) [-2272.438] (-2268.845) -- 0:04:13
199500 -- (-2276.580) [-2265.606] (-2278.047) (-2269.665) * (-2292.381) [-2271.030] (-2283.150) (-2280.113) -- 0:04:12
200000 -- (-2280.326) (-2268.315) (-2269.713) [-2279.615] * (-2278.809) (-2275.079) (-2273.219) [-2287.977] -- 0:04:12
Average standard deviation of split frequencies: 0.014878
200500 -- [-2276.939] (-2280.536) (-2270.698) (-2280.789) * [-2275.226] (-2277.062) (-2268.731) (-2281.067) -- 0:04:11
201000 -- (-2290.875) [-2277.974] (-2277.773) (-2287.194) * (-2286.125) [-2265.030] (-2273.491) (-2284.636) -- 0:04:10
201500 -- [-2272.694] (-2279.636) (-2276.088) (-2285.729) * [-2273.070] (-2280.501) (-2268.446) (-2276.393) -- 0:04:13
202000 -- (-2272.956) [-2285.697] (-2273.548) (-2279.552) * (-2276.290) (-2277.185) [-2266.543] (-2288.870) -- 0:04:12
202500 -- (-2271.880) [-2268.722] (-2272.133) (-2277.581) * [-2275.432] (-2277.027) (-2282.711) (-2269.984) -- 0:04:12
203000 -- (-2280.983) (-2271.874) (-2291.715) [-2280.142] * [-2277.523] (-2285.848) (-2274.001) (-2285.341) -- 0:04:11
203500 -- (-2277.057) (-2269.005) [-2266.732] (-2291.450) * [-2282.247] (-2274.910) (-2270.299) (-2297.204) -- 0:04:10
204000 -- (-2278.371) (-2276.747) (-2269.414) [-2270.780] * (-2289.050) (-2285.705) (-2273.903) [-2275.200] -- 0:04:09
204500 -- (-2270.617) [-2275.732] (-2274.613) (-2283.681) * (-2282.769) (-2275.761) (-2270.060) [-2270.735] -- 0:04:12
205000 -- (-2288.720) [-2280.670] (-2280.576) (-2272.521) * (-2277.654) [-2271.002] (-2270.026) (-2291.060) -- 0:04:12
Average standard deviation of split frequencies: 0.015713
205500 -- (-2276.808) (-2293.737) [-2276.033] (-2287.671) * (-2266.830) (-2285.751) [-2271.599] (-2280.369) -- 0:04:11
206000 -- (-2275.130) (-2279.005) [-2268.153] (-2294.043) * (-2270.770) (-2279.007) [-2267.433] (-2274.534) -- 0:04:10
206500 -- (-2278.380) (-2278.828) (-2274.197) [-2275.423] * (-2280.362) (-2279.815) [-2266.996] (-2279.189) -- 0:04:09
207000 -- (-2284.102) (-2274.748) [-2276.961] (-2280.384) * (-2288.067) [-2278.136] (-2269.543) (-2285.276) -- 0:04:09
207500 -- (-2277.477) (-2278.104) [-2269.884] (-2278.401) * (-2275.585) [-2275.304] (-2279.117) (-2280.230) -- 0:04:12
208000 -- [-2261.472] (-2279.463) (-2276.475) (-2274.192) * (-2288.000) (-2285.725) [-2269.110] (-2282.587) -- 0:04:11
208500 -- (-2264.130) (-2274.448) (-2279.153) [-2275.114] * (-2271.902) [-2271.755] (-2271.963) (-2293.134) -- 0:04:10
209000 -- (-2278.434) (-2271.044) (-2286.301) [-2267.702] * [-2274.338] (-2276.731) (-2278.281) (-2274.799) -- 0:04:09
209500 -- [-2271.076] (-2274.873) (-2278.107) (-2280.446) * (-2270.362) (-2273.063) (-2273.310) [-2271.302] -- 0:04:09
210000 -- (-2280.414) [-2284.506] (-2272.508) (-2270.255) * (-2269.502) [-2272.292] (-2275.282) (-2276.928) -- 0:04:08
Average standard deviation of split frequencies: 0.016857
210500 -- (-2276.262) (-2279.967) (-2277.032) [-2266.430] * [-2268.973] (-2284.439) (-2274.956) (-2276.964) -- 0:04:07
211000 -- [-2270.909] (-2281.788) (-2275.693) (-2286.710) * [-2277.606] (-2279.276) (-2276.722) (-2273.830) -- 0:04:10
211500 -- (-2279.508) [-2268.922] (-2274.845) (-2278.711) * (-2271.416) [-2283.127] (-2275.066) (-2269.741) -- 0:04:09
212000 -- (-2270.957) [-2263.232] (-2274.464) (-2275.989) * (-2272.832) [-2277.820] (-2285.986) (-2279.275) -- 0:04:09
212500 -- (-2269.459) (-2275.452) [-2271.557] (-2267.465) * (-2276.841) [-2269.065] (-2283.339) (-2275.385) -- 0:04:08
213000 -- [-2268.937] (-2287.269) (-2285.177) (-2284.030) * (-2274.833) (-2279.849) (-2280.336) [-2262.497] -- 0:04:07
213500 -- (-2271.951) (-2292.414) (-2276.982) [-2270.466] * [-2275.941] (-2285.030) (-2272.915) (-2281.644) -- 0:04:10
214000 -- (-2270.735) (-2285.930) (-2276.631) [-2265.070] * (-2267.883) (-2278.050) [-2268.891] (-2279.230) -- 0:04:09
214500 -- (-2270.627) (-2287.017) [-2277.386] (-2273.144) * (-2267.932) (-2290.367) (-2274.545) [-2270.266] -- 0:04:09
215000 -- (-2278.235) (-2282.514) (-2274.392) [-2272.913] * (-2279.009) (-2280.548) [-2267.607] (-2280.428) -- 0:04:08
Average standard deviation of split frequencies: 0.015713
215500 -- (-2276.959) [-2276.818] (-2268.390) (-2279.851) * [-2272.946] (-2288.660) (-2275.541) (-2279.850) -- 0:04:07
216000 -- (-2282.549) [-2279.934] (-2277.304) (-2278.444) * (-2280.978) [-2272.422] (-2281.669) (-2276.077) -- 0:04:06
216500 -- (-2278.444) [-2274.592] (-2279.131) (-2274.006) * [-2264.510] (-2284.649) (-2291.072) (-2265.942) -- 0:04:09
217000 -- (-2280.823) (-2300.583) (-2279.547) [-2277.889] * [-2275.783] (-2275.176) (-2275.886) (-2291.790) -- 0:04:08
217500 -- (-2272.697) [-2281.038] (-2279.071) (-2271.956) * (-2280.541) (-2282.655) (-2277.909) [-2274.798] -- 0:04:08
218000 -- (-2269.952) [-2274.386] (-2278.039) (-2271.317) * [-2278.030] (-2278.521) (-2276.468) (-2276.171) -- 0:04:07
218500 -- (-2267.342) (-2272.682) (-2283.077) [-2273.315] * [-2270.012] (-2272.015) (-2300.002) (-2278.893) -- 0:04:06
219000 -- [-2265.540] (-2274.396) (-2273.342) (-2269.704) * (-2285.497) (-2274.617) (-2279.005) [-2277.641] -- 0:04:06
219500 -- (-2276.414) (-2290.150) [-2282.519] (-2269.978) * (-2295.535) [-2267.383] (-2276.461) (-2285.765) -- 0:04:05
220000 -- [-2268.671] (-2291.079) (-2276.053) (-2277.152) * (-2288.435) (-2273.746) [-2267.716] (-2278.269) -- 0:04:08
Average standard deviation of split frequencies: 0.014099
220500 -- [-2271.823] (-2277.313) (-2268.150) (-2286.679) * (-2280.278) (-2292.023) (-2274.734) [-2279.587] -- 0:04:07
221000 -- (-2276.674) (-2277.694) (-2268.814) [-2273.012] * (-2274.696) [-2277.942] (-2276.530) (-2277.481) -- 0:04:06
221500 -- (-2286.532) (-2278.297) [-2275.025] (-2281.813) * (-2280.699) [-2271.031] (-2273.124) (-2294.506) -- 0:04:06
222000 -- (-2300.638) [-2278.828] (-2264.424) (-2284.374) * (-2282.496) (-2271.648) [-2273.264] (-2272.882) -- 0:04:05
222500 -- (-2281.050) [-2273.807] (-2271.458) (-2277.218) * (-2286.898) (-2274.890) [-2265.877] (-2272.519) -- 0:04:04
223000 -- (-2285.689) (-2278.307) [-2269.168] (-2284.193) * (-2279.706) (-2273.925) (-2278.015) [-2278.206] -- 0:04:07
223500 -- (-2286.020) (-2275.952) (-2275.950) [-2278.587] * [-2277.900] (-2282.667) (-2282.587) (-2277.778) -- 0:04:06
224000 -- (-2274.091) (-2277.235) (-2289.506) [-2272.921] * (-2285.176) (-2282.848) [-2268.828] (-2274.128) -- 0:04:05
224500 -- (-2270.589) (-2276.819) [-2276.156] (-2272.168) * (-2270.147) [-2272.899] (-2266.489) (-2280.057) -- 0:04:05
225000 -- (-2276.346) (-2271.694) (-2272.846) [-2279.172] * (-2274.500) (-2284.578) (-2264.710) [-2276.578] -- 0:04:04
Average standard deviation of split frequencies: 0.014323
225500 -- (-2274.820) [-2266.179] (-2275.542) (-2284.831) * [-2270.397] (-2278.877) (-2277.492) (-2273.195) -- 0:04:07
226000 -- (-2266.605) (-2273.583) [-2272.792] (-2274.160) * (-2269.994) (-2268.602) [-2276.673] (-2270.409) -- 0:04:06
226500 -- (-2269.179) (-2280.346) (-2270.191) [-2273.990] * (-2284.202) [-2267.308] (-2290.182) (-2264.679) -- 0:04:05
227000 -- (-2271.641) (-2269.470) [-2275.936] (-2290.471) * (-2282.646) (-2279.576) (-2279.582) [-2274.995] -- 0:04:05
227500 -- (-2283.512) [-2270.990] (-2276.178) (-2275.493) * (-2277.845) (-2281.129) [-2280.365] (-2273.006) -- 0:04:04
228000 -- (-2292.498) (-2273.963) (-2279.352) [-2272.728] * [-2277.780] (-2281.843) (-2280.646) (-2278.973) -- 0:04:03
228500 -- (-2284.985) (-2281.061) (-2277.601) [-2268.479] * (-2283.757) (-2273.279) [-2272.294] (-2280.811) -- 0:04:03
229000 -- (-2285.731) [-2271.570] (-2288.394) (-2281.400) * [-2273.909] (-2271.475) (-2272.898) (-2284.238) -- 0:04:05
229500 -- (-2269.826) [-2277.667] (-2288.176) (-2279.632) * (-2271.998) (-2274.682) [-2267.660] (-2284.373) -- 0:04:05
230000 -- (-2271.686) (-2278.919) (-2288.075) [-2268.273] * [-2274.644] (-2289.599) (-2271.013) (-2292.523) -- 0:04:04
Average standard deviation of split frequencies: 0.013897
230500 -- [-2269.977] (-2279.356) (-2283.975) (-2273.185) * (-2275.005) (-2295.115) [-2275.001] (-2275.019) -- 0:04:03
231000 -- (-2271.405) (-2270.368) (-2291.480) [-2270.676] * [-2271.665] (-2281.092) (-2275.728) (-2281.270) -- 0:04:03
231500 -- (-2281.518) [-2271.664] (-2284.595) (-2280.096) * [-2270.020] (-2276.936) (-2273.998) (-2294.036) -- 0:04:02
232000 -- (-2280.575) [-2268.572] (-2293.127) (-2280.914) * (-2284.137) [-2271.671] (-2277.893) (-2275.808) -- 0:04:01
232500 -- (-2294.080) (-2267.455) (-2289.868) [-2276.407] * (-2270.447) [-2275.335] (-2291.841) (-2274.356) -- 0:04:04
233000 -- (-2295.323) (-2275.087) [-2273.091] (-2272.202) * (-2279.546) (-2289.150) (-2279.364) [-2280.946] -- 0:04:03
233500 -- (-2278.567) (-2278.155) [-2282.806] (-2271.691) * (-2278.929) (-2277.821) (-2274.285) [-2271.170] -- 0:04:02
234000 -- (-2275.784) (-2275.505) (-2272.767) [-2277.531] * (-2288.832) [-2268.076] (-2280.856) (-2280.455) -- 0:04:02
234500 -- [-2282.042] (-2273.109) (-2278.392) (-2277.880) * (-2293.039) [-2267.113] (-2281.250) (-2274.225) -- 0:04:01
235000 -- (-2279.806) (-2274.852) [-2277.902] (-2274.548) * (-2274.552) (-2275.485) [-2274.100] (-2290.618) -- 0:04:00
Average standard deviation of split frequencies: 0.011319
235500 -- (-2284.963) (-2276.802) (-2307.248) [-2275.467] * (-2279.117) (-2270.373) [-2271.491] (-2268.583) -- 0:04:00
236000 -- (-2280.255) (-2288.889) (-2286.414) [-2273.477] * (-2270.398) [-2271.185] (-2271.864) (-2276.838) -- 0:04:02
236500 -- (-2279.566) (-2295.376) [-2274.997] (-2269.767) * [-2272.905] (-2273.009) (-2284.596) (-2276.124) -- 0:04:02
237000 -- (-2288.679) (-2287.952) (-2285.555) [-2273.799] * [-2270.617] (-2272.699) (-2290.718) (-2280.041) -- 0:04:01
237500 -- [-2279.408] (-2283.523) (-2281.271) (-2271.315) * [-2275.503] (-2277.856) (-2283.436) (-2284.022) -- 0:04:00
238000 -- (-2272.941) (-2281.475) (-2282.525) [-2281.477] * (-2280.030) (-2273.712) [-2271.965] (-2284.369) -- 0:04:00
238500 -- (-2269.649) (-2269.115) [-2275.237] (-2274.246) * (-2283.644) (-2275.177) [-2275.440] (-2278.362) -- 0:03:59
239000 -- (-2279.695) [-2276.049] (-2273.019) (-2276.158) * (-2287.188) [-2278.048] (-2273.500) (-2269.685) -- 0:03:58
239500 -- (-2284.655) (-2276.109) (-2283.208) [-2274.022] * (-2287.221) (-2290.165) (-2278.013) [-2270.523] -- 0:04:01
240000 -- [-2271.933] (-2269.049) (-2281.451) (-2280.750) * (-2275.151) (-2284.414) [-2270.262] (-2284.105) -- 0:04:00
Average standard deviation of split frequencies: 0.012144
240500 -- (-2276.773) (-2283.579) [-2274.839] (-2284.844) * (-2275.736) [-2274.929] (-2278.148) (-2285.508) -- 0:04:00
241000 -- (-2271.961) (-2294.805) [-2271.400] (-2272.845) * [-2275.816] (-2289.975) (-2282.057) (-2273.014) -- 0:03:59
241500 -- [-2273.408] (-2266.229) (-2276.392) (-2275.877) * (-2277.570) [-2274.613] (-2275.503) (-2287.559) -- 0:03:58
242000 -- (-2272.026) (-2277.899) (-2281.988) [-2279.708] * [-2277.727] (-2272.140) (-2276.337) (-2266.931) -- 0:04:01
242500 -- (-2278.968) (-2278.734) (-2272.479) [-2270.607] * (-2269.131) [-2280.775] (-2283.229) (-2289.715) -- 0:04:00
243000 -- (-2278.382) [-2275.045] (-2277.249) (-2271.714) * (-2270.273) [-2277.571] (-2278.383) (-2275.021) -- 0:03:59
243500 -- [-2269.524] (-2285.760) (-2277.786) (-2273.037) * (-2286.761) (-2275.741) [-2276.172] (-2280.427) -- 0:03:59
244000 -- [-2273.508] (-2276.675) (-2280.438) (-2278.408) * (-2269.160) (-2280.313) (-2288.784) [-2273.274] -- 0:03:58
244500 -- (-2272.150) (-2271.870) (-2278.395) [-2279.162] * (-2267.508) [-2272.651] (-2286.418) (-2278.812) -- 0:03:57
245000 -- (-2272.736) [-2269.354] (-2293.701) (-2284.220) * [-2284.235] (-2278.186) (-2280.469) (-2290.402) -- 0:03:57
Average standard deviation of split frequencies: 0.012775
245500 -- (-2269.071) [-2275.733] (-2279.356) (-2274.648) * (-2284.171) (-2272.526) (-2272.949) [-2278.982] -- 0:03:59
246000 -- (-2275.910) [-2273.778] (-2274.923) (-2279.529) * (-2289.716) (-2274.687) (-2270.802) [-2272.842] -- 0:03:59
246500 -- [-2267.782] (-2276.570) (-2282.553) (-2276.101) * (-2292.017) (-2271.695) [-2275.845] (-2281.862) -- 0:03:58
247000 -- (-2276.525) (-2287.671) (-2278.507) [-2270.551] * (-2282.863) (-2268.417) [-2271.319] (-2282.722) -- 0:03:57
247500 -- [-2266.296] (-2283.702) (-2286.869) (-2278.134) * (-2279.821) (-2278.114) [-2266.672] (-2267.487) -- 0:03:57
248000 -- (-2279.619) (-2274.983) [-2266.594] (-2276.946) * [-2280.596] (-2281.170) (-2283.471) (-2276.591) -- 0:03:56
248500 -- (-2283.291) (-2271.645) (-2276.850) [-2271.686] * (-2279.280) [-2265.613] (-2276.156) (-2269.223) -- 0:03:55
249000 -- [-2268.466] (-2282.974) (-2277.883) (-2283.933) * [-2270.481] (-2275.122) (-2269.571) (-2283.653) -- 0:03:58
249500 -- (-2278.174) (-2277.434) [-2264.953] (-2275.789) * (-2276.249) [-2272.093] (-2277.547) (-2278.178) -- 0:03:57
250000 -- (-2273.054) (-2285.944) [-2275.631] (-2268.471) * [-2267.358] (-2283.693) (-2290.249) (-2285.068) -- 0:03:57
Average standard deviation of split frequencies: 0.013666
250500 -- [-2275.764] (-2274.110) (-2284.899) (-2274.179) * (-2266.282) [-2272.430] (-2265.552) (-2289.664) -- 0:03:56
251000 -- (-2277.341) (-2297.727) [-2277.372] (-2285.076) * (-2287.766) [-2274.727] (-2266.555) (-2269.009) -- 0:03:55
251500 -- (-2276.136) (-2290.856) [-2272.120] (-2268.300) * [-2277.071] (-2282.281) (-2274.757) (-2274.139) -- 0:03:55
252000 -- (-2275.672) (-2275.039) [-2270.320] (-2281.813) * (-2274.838) (-2280.640) (-2276.744) [-2272.786] -- 0:03:54
252500 -- [-2278.342] (-2278.695) (-2279.520) (-2285.498) * (-2269.389) (-2286.695) (-2273.634) [-2269.819] -- 0:03:56
253000 -- (-2284.796) [-2278.966] (-2288.858) (-2280.090) * (-2269.777) (-2285.829) (-2280.227) [-2272.919] -- 0:03:56
253500 -- [-2275.963] (-2268.738) (-2277.169) (-2272.004) * (-2279.504) (-2279.099) [-2268.968] (-2278.163) -- 0:03:55
254000 -- (-2280.795) (-2271.180) [-2271.385] (-2293.601) * (-2275.746) (-2267.455) (-2260.817) [-2288.705] -- 0:03:54
254500 -- (-2279.229) (-2272.704) [-2280.660] (-2293.444) * (-2288.905) (-2284.131) [-2274.693] (-2284.417) -- 0:03:54
255000 -- (-2287.999) (-2265.965) [-2270.941] (-2290.596) * [-2266.807] (-2299.485) (-2277.160) (-2284.466) -- 0:03:53
Average standard deviation of split frequencies: 0.011417
255500 -- (-2285.594) [-2272.585] (-2277.927) (-2289.133) * (-2273.191) (-2282.826) (-2267.017) [-2262.724] -- 0:03:53
256000 -- (-2270.846) (-2282.220) (-2271.798) [-2271.215] * (-2271.738) (-2277.469) [-2273.683] (-2281.529) -- 0:03:55
256500 -- (-2277.107) (-2280.353) [-2277.491] (-2278.707) * [-2269.082] (-2305.521) (-2271.005) (-2292.578) -- 0:03:54
257000 -- (-2275.287) (-2269.861) [-2271.410] (-2273.450) * [-2268.635] (-2277.196) (-2277.589) (-2284.075) -- 0:03:54
257500 -- (-2280.572) (-2280.905) [-2270.654] (-2263.821) * (-2281.652) [-2269.446] (-2287.160) (-2280.815) -- 0:03:53
258000 -- (-2289.271) (-2273.692) (-2279.826) [-2274.016] * (-2294.874) (-2278.780) (-2268.068) [-2268.469] -- 0:03:52
258500 -- (-2275.365) (-2280.958) (-2271.741) [-2272.052] * (-2272.048) (-2268.911) (-2280.787) [-2266.309] -- 0:03:52
259000 -- (-2279.530) (-2280.142) (-2279.021) [-2276.313] * (-2275.916) (-2267.588) [-2269.807] (-2269.746) -- 0:03:51
259500 -- (-2271.661) (-2284.804) [-2274.644] (-2271.742) * [-2270.954] (-2279.855) (-2271.861) (-2278.800) -- 0:03:53
260000 -- (-2275.532) (-2283.847) [-2273.377] (-2274.007) * [-2274.078] (-2270.640) (-2275.143) (-2272.114) -- 0:03:53
Average standard deviation of split frequencies: 0.010851
260500 -- (-2270.196) (-2278.661) [-2271.372] (-2279.386) * (-2270.860) (-2277.470) [-2273.194] (-2271.565) -- 0:03:52
261000 -- (-2285.455) [-2264.783] (-2273.509) (-2273.861) * (-2286.508) [-2281.650] (-2279.661) (-2274.997) -- 0:03:52
261500 -- (-2285.221) (-2277.535) (-2273.574) [-2265.079] * (-2270.239) (-2274.913) [-2273.633] (-2273.735) -- 0:03:51
262000 -- (-2276.437) [-2271.746] (-2280.476) (-2274.248) * (-2282.502) (-2276.501) [-2265.086] (-2288.199) -- 0:03:50
262500 -- (-2282.580) (-2274.224) (-2283.937) [-2277.406] * (-2277.596) (-2286.592) (-2261.813) [-2273.370] -- 0:03:50
263000 -- (-2313.015) [-2272.188] (-2278.751) (-2277.137) * [-2281.960] (-2286.994) (-2269.491) (-2282.305) -- 0:03:49
263500 -- (-2281.506) (-2271.947) [-2277.761] (-2276.731) * [-2273.076] (-2275.602) (-2270.073) (-2264.661) -- 0:03:51
264000 -- (-2284.334) [-2282.308] (-2279.125) (-2283.256) * (-2282.671) (-2275.278) (-2270.622) [-2282.275] -- 0:03:51
264500 -- [-2279.874] (-2277.630) (-2277.099) (-2281.340) * (-2293.617) [-2272.197] (-2303.594) (-2276.323) -- 0:03:50
265000 -- (-2272.306) (-2284.127) (-2280.549) [-2275.033] * [-2280.317] (-2270.324) (-2282.816) (-2270.443) -- 0:03:50
Average standard deviation of split frequencies: 0.012051
265500 -- (-2267.862) (-2274.545) (-2268.493) [-2268.395] * [-2273.974] (-2278.494) (-2278.006) (-2270.503) -- 0:03:49
266000 -- (-2279.856) (-2270.354) (-2276.586) [-2276.783] * (-2279.859) (-2289.180) (-2287.534) [-2281.879] -- 0:03:49
266500 -- (-2267.132) (-2277.619) (-2279.982) [-2278.338] * (-2266.712) (-2279.604) (-2278.399) [-2276.234] -- 0:03:51
267000 -- (-2279.566) (-2279.271) [-2279.707] (-2283.854) * [-2274.941] (-2271.375) (-2268.600) (-2277.531) -- 0:03:50
267500 -- (-2277.100) (-2287.166) (-2285.645) [-2271.076] * (-2274.091) (-2274.353) (-2272.668) [-2274.791] -- 0:03:50
268000 -- (-2274.161) (-2274.438) [-2272.557] (-2275.494) * (-2269.038) [-2268.442] (-2286.300) (-2277.033) -- 0:03:49
268500 -- (-2281.667) [-2279.527] (-2271.161) (-2281.654) * (-2270.717) (-2274.008) [-2276.920] (-2280.223) -- 0:03:48
269000 -- [-2264.761] (-2274.119) (-2284.551) (-2268.774) * (-2278.833) (-2273.268) (-2271.934) [-2268.651] -- 0:03:50
269500 -- (-2273.825) (-2274.585) (-2273.539) [-2269.949] * (-2278.045) (-2278.412) [-2268.916] (-2281.588) -- 0:03:50
270000 -- [-2273.249] (-2275.504) (-2275.438) (-2275.537) * (-2278.870) [-2275.297] (-2273.706) (-2276.429) -- 0:03:49
Average standard deviation of split frequencies: 0.012191
270500 -- [-2276.244] (-2281.000) (-2272.664) (-2271.407) * (-2276.207) [-2285.982] (-2283.873) (-2278.166) -- 0:03:49
271000 -- (-2276.247) (-2275.389) [-2273.143] (-2277.575) * [-2276.535] (-2287.042) (-2273.695) (-2271.360) -- 0:03:48
271500 -- (-2284.642) (-2278.103) [-2270.061] (-2277.296) * (-2270.093) [-2270.061] (-2279.702) (-2274.523) -- 0:03:48
272000 -- (-2284.903) (-2288.383) (-2272.660) [-2270.909] * (-2279.425) [-2269.858] (-2267.016) (-2272.371) -- 0:03:47
272500 -- (-2273.801) (-2289.388) (-2274.947) [-2269.143] * (-2275.065) (-2262.771) [-2264.515] (-2270.156) -- 0:03:49
273000 -- (-2270.377) (-2278.633) [-2269.202] (-2274.314) * (-2277.327) [-2283.922] (-2278.537) (-2278.006) -- 0:03:49
273500 -- (-2281.587) (-2275.165) [-2284.720] (-2278.581) * (-2283.663) (-2292.945) [-2272.519] (-2274.080) -- 0:03:48
274000 -- (-2274.058) (-2271.865) [-2280.337] (-2279.068) * (-2287.988) (-2277.683) [-2274.653] (-2285.518) -- 0:03:47
274500 -- (-2276.057) (-2282.554) [-2271.860] (-2274.175) * (-2272.332) (-2293.001) [-2271.540] (-2272.166) -- 0:03:47
275000 -- [-2265.035] (-2271.123) (-2273.419) (-2284.263) * (-2279.906) (-2277.148) (-2285.567) [-2274.711] -- 0:03:46
Average standard deviation of split frequencies: 0.011500
275500 -- [-2267.871] (-2269.953) (-2273.453) (-2279.386) * (-2274.879) (-2279.971) [-2275.497] (-2274.471) -- 0:03:46
276000 -- [-2279.137] (-2280.830) (-2279.982) (-2278.988) * (-2294.214) (-2279.288) (-2272.824) [-2271.001] -- 0:03:45
276500 -- [-2274.053] (-2274.461) (-2274.393) (-2271.715) * (-2268.642) [-2272.914] (-2274.971) (-2272.695) -- 0:03:47
277000 -- (-2275.989) (-2274.860) (-2281.160) [-2270.117] * (-2272.340) (-2274.990) (-2271.955) [-2271.594] -- 0:03:47
277500 -- (-2273.689) (-2276.470) (-2273.051) [-2270.686] * (-2274.249) (-2277.857) (-2268.443) [-2269.470] -- 0:03:46
278000 -- (-2277.086) (-2283.015) (-2286.076) [-2268.987] * (-2271.890) (-2277.696) [-2274.161] (-2285.436) -- 0:03:45
278500 -- (-2287.790) [-2278.634] (-2274.791) (-2275.709) * [-2273.701] (-2271.983) (-2270.601) (-2290.659) -- 0:03:45
279000 -- (-2283.124) (-2276.186) (-2268.336) [-2273.756] * [-2280.778] (-2275.826) (-2267.674) (-2289.384) -- 0:03:44
279500 -- (-2292.885) (-2285.848) [-2279.367] (-2269.167) * (-2279.858) (-2275.342) [-2272.827] (-2281.715) -- 0:03:44
280000 -- (-2288.504) (-2280.384) [-2276.291] (-2273.070) * (-2279.317) (-2272.777) (-2281.403) [-2271.933] -- 0:03:46
Average standard deviation of split frequencies: 0.013213
280500 -- [-2275.524] (-2285.092) (-2279.524) (-2280.103) * (-2272.105) [-2275.159] (-2278.938) (-2274.765) -- 0:03:45
281000 -- (-2289.214) (-2273.277) [-2275.088] (-2280.242) * (-2276.655) (-2277.803) (-2277.543) [-2272.165] -- 0:03:45
281500 -- (-2280.870) (-2272.041) (-2280.587) [-2283.392] * (-2285.063) (-2287.900) (-2278.717) [-2265.784] -- 0:03:44
282000 -- [-2270.920] (-2285.464) (-2273.777) (-2290.661) * (-2275.233) (-2282.994) (-2286.353) [-2263.379] -- 0:03:44
282500 -- [-2282.580] (-2281.592) (-2280.579) (-2275.539) * (-2283.863) (-2274.687) (-2282.257) [-2273.445] -- 0:03:43
283000 -- (-2284.616) (-2290.461) [-2267.123] (-2278.718) * (-2272.617) (-2269.263) (-2268.567) [-2275.224] -- 0:03:42
283500 -- (-2268.911) (-2282.588) (-2276.313) [-2269.185] * (-2283.625) (-2273.816) (-2277.231) [-2275.178] -- 0:03:44
284000 -- (-2283.229) (-2292.851) [-2265.373] (-2267.828) * (-2287.242) (-2275.461) [-2274.114] (-2280.674) -- 0:03:44
284500 -- (-2285.163) (-2282.133) [-2268.927] (-2272.323) * (-2278.935) (-2274.201) (-2271.973) [-2273.253] -- 0:03:43
285000 -- (-2274.461) (-2291.627) [-2264.336] (-2268.773) * (-2282.463) (-2275.380) (-2280.882) [-2280.080] -- 0:03:43
Average standard deviation of split frequencies: 0.013296
285500 -- (-2277.610) (-2275.401) (-2271.832) [-2272.555] * (-2267.406) (-2281.066) (-2269.559) [-2264.628] -- 0:03:42
286000 -- [-2265.371] (-2279.168) (-2295.117) (-2272.405) * (-2277.048) (-2279.055) [-2274.278] (-2271.140) -- 0:03:42
286500 -- (-2276.564) [-2280.038] (-2275.941) (-2273.815) * (-2282.338) [-2272.393] (-2275.067) (-2272.692) -- 0:03:41
287000 -- [-2276.783] (-2275.162) (-2287.214) (-2269.681) * (-2279.600) (-2283.722) (-2271.012) [-2273.383] -- 0:03:43
287500 -- [-2271.635] (-2285.438) (-2268.339) (-2280.064) * (-2281.728) (-2285.684) [-2274.671] (-2267.255) -- 0:03:43
288000 -- (-2276.544) (-2277.071) (-2269.301) [-2279.123] * (-2276.082) (-2287.271) [-2264.886] (-2274.075) -- 0:03:42
288500 -- (-2275.402) [-2280.275] (-2275.940) (-2270.033) * [-2266.938] (-2277.096) (-2270.953) (-2286.924) -- 0:03:41
289000 -- (-2274.726) (-2278.225) (-2272.799) [-2266.899] * [-2266.417] (-2283.548) (-2280.469) (-2285.008) -- 0:03:41
289500 -- [-2277.492] (-2272.503) (-2269.732) (-2276.258) * (-2269.488) (-2275.841) [-2267.700] (-2279.414) -- 0:03:40
290000 -- [-2266.532] (-2266.858) (-2282.165) (-2271.721) * [-2273.887] (-2275.273) (-2265.995) (-2282.782) -- 0:03:40
Average standard deviation of split frequencies: 0.013839
290500 -- [-2265.634] (-2290.611) (-2291.884) (-2267.842) * (-2281.810) [-2274.780] (-2277.638) (-2275.232) -- 0:03:42
291000 -- (-2279.720) (-2276.496) (-2273.366) [-2274.296] * [-2284.166] (-2277.477) (-2290.501) (-2277.164) -- 0:03:41
291500 -- (-2301.061) [-2269.255] (-2274.466) (-2272.263) * (-2277.578) (-2272.645) [-2276.295] (-2272.520) -- 0:03:41
292000 -- (-2277.894) [-2264.185] (-2279.260) (-2269.748) * (-2268.751) (-2278.750) [-2273.434] (-2270.635) -- 0:03:40
292500 -- (-2280.449) (-2286.856) [-2273.882] (-2284.955) * (-2280.123) (-2281.921) (-2277.249) [-2268.387] -- 0:03:40
293000 -- (-2270.103) (-2283.732) (-2271.892) [-2271.279] * (-2282.897) [-2273.239] (-2271.163) (-2274.663) -- 0:03:39
293500 -- (-2281.048) (-2274.643) [-2275.011] (-2277.361) * (-2280.826) (-2290.272) (-2279.311) [-2272.396] -- 0:03:39
294000 -- (-2274.213) (-2280.563) (-2278.339) [-2278.538] * (-2286.201) (-2288.210) (-2279.983) [-2268.419] -- 0:03:40
294500 -- (-2276.375) (-2276.550) [-2268.976] (-2269.050) * (-2277.789) (-2275.780) (-2272.880) [-2266.482] -- 0:03:40
295000 -- (-2276.150) (-2276.920) [-2274.867] (-2280.269) * (-2274.034) (-2275.221) [-2269.880] (-2276.005) -- 0:03:39
Average standard deviation of split frequencies: 0.013272
295500 -- [-2284.207] (-2275.668) (-2273.338) (-2277.303) * (-2272.889) [-2272.655] (-2275.767) (-2274.757) -- 0:03:39
296000 -- (-2278.755) [-2268.721] (-2285.828) (-2268.601) * (-2279.115) (-2273.455) [-2273.479] (-2269.863) -- 0:03:38
296500 -- [-2273.895] (-2271.647) (-2272.179) (-2272.545) * (-2271.770) (-2274.296) (-2275.417) [-2281.291] -- 0:03:40
297000 -- [-2264.501] (-2277.047) (-2266.899) (-2285.636) * (-2262.306) (-2281.349) [-2270.490] (-2270.459) -- 0:03:40
297500 -- (-2268.945) (-2290.894) [-2271.268] (-2280.196) * [-2275.139] (-2269.675) (-2273.194) (-2284.445) -- 0:03:39
298000 -- [-2274.074] (-2275.203) (-2271.994) (-2296.415) * (-2276.059) [-2269.283] (-2282.090) (-2270.689) -- 0:03:39
298500 -- (-2288.108) (-2281.329) (-2285.893) [-2274.530] * (-2275.050) (-2279.675) (-2283.595) [-2272.767] -- 0:03:38
299000 -- (-2267.154) (-2276.366) (-2270.679) [-2271.082] * [-2270.254] (-2284.020) (-2276.149) (-2275.646) -- 0:03:38
299500 -- [-2269.459] (-2275.850) (-2278.230) (-2279.443) * [-2264.496] (-2281.053) (-2284.162) (-2288.177) -- 0:03:37
300000 -- (-2277.111) (-2268.842) [-2275.568] (-2283.010) * (-2275.067) (-2275.904) (-2284.130) [-2273.595] -- 0:03:37
Average standard deviation of split frequencies: 0.013588
300500 -- (-2269.045) [-2274.501] (-2283.976) (-2275.480) * [-2275.979] (-2279.531) (-2284.733) (-2274.508) -- 0:03:38
301000 -- (-2272.836) (-2282.338) (-2282.942) [-2266.728] * (-2282.926) (-2279.976) (-2276.321) [-2274.524] -- 0:03:38
301500 -- [-2276.892] (-2297.550) (-2272.918) (-2277.457) * (-2279.099) [-2276.797] (-2280.452) (-2270.748) -- 0:03:37
302000 -- (-2272.746) (-2276.865) [-2276.671] (-2284.338) * (-2273.675) (-2274.541) (-2285.519) [-2263.410] -- 0:03:37
302500 -- (-2280.360) [-2271.081] (-2276.009) (-2292.247) * (-2271.948) [-2281.868] (-2288.143) (-2289.585) -- 0:03:36
303000 -- (-2281.134) (-2274.647) (-2280.814) [-2270.986] * (-2287.252) (-2277.020) (-2277.408) [-2272.221] -- 0:03:38
303500 -- (-2282.189) [-2271.393] (-2276.957) (-2287.960) * (-2279.695) (-2273.083) (-2279.363) [-2278.752] -- 0:03:38
304000 -- (-2280.752) (-2280.372) (-2274.369) [-2267.567] * (-2273.686) (-2273.412) [-2271.104] (-2280.533) -- 0:03:37
304500 -- (-2281.172) (-2284.879) [-2269.157] (-2273.677) * [-2275.017] (-2266.181) (-2279.116) (-2279.887) -- 0:03:36
305000 -- (-2273.434) [-2274.689] (-2268.088) (-2286.628) * (-2275.635) (-2273.860) [-2272.910] (-2276.764) -- 0:03:36
Average standard deviation of split frequencies: 0.013557
305500 -- (-2274.124) (-2281.920) [-2270.668] (-2284.239) * (-2274.335) (-2279.704) (-2272.989) [-2271.798] -- 0:03:35
306000 -- (-2273.953) (-2284.960) (-2280.436) [-2280.989] * (-2281.183) (-2271.415) (-2285.480) [-2267.799] -- 0:03:35
306500 -- (-2275.173) (-2274.201) [-2276.864] (-2289.498) * (-2285.253) (-2270.283) [-2273.687] (-2276.026) -- 0:03:37
307000 -- [-2279.555] (-2273.073) (-2279.933) (-2287.400) * [-2285.075] (-2283.795) (-2278.494) (-2278.069) -- 0:03:36
307500 -- (-2269.042) [-2277.867] (-2284.741) (-2283.491) * (-2277.171) (-2281.950) [-2262.259] (-2278.466) -- 0:03:36
308000 -- [-2281.641] (-2269.434) (-2274.136) (-2278.924) * (-2281.563) (-2272.916) (-2285.396) [-2271.146] -- 0:03:35
308500 -- [-2266.309] (-2278.720) (-2279.266) (-2276.285) * (-2273.185) [-2272.370] (-2277.760) (-2278.833) -- 0:03:35
309000 -- (-2266.282) (-2282.087) (-2277.495) [-2276.225] * [-2273.562] (-2287.740) (-2282.771) (-2269.074) -- 0:03:34
309500 -- (-2270.864) (-2286.322) (-2277.803) [-2264.382] * [-2266.268] (-2287.012) (-2279.992) (-2267.386) -- 0:03:34
310000 -- (-2277.985) (-2280.536) (-2276.881) [-2270.151] * [-2272.448] (-2272.405) (-2275.464) (-2276.248) -- 0:03:35
Average standard deviation of split frequencies: 0.014466
310500 -- (-2281.473) (-2275.586) [-2267.509] (-2296.938) * (-2274.998) (-2291.979) [-2271.996] (-2271.392) -- 0:03:35
311000 -- (-2287.248) [-2271.120] (-2278.516) (-2276.971) * [-2277.199] (-2280.495) (-2277.417) (-2276.413) -- 0:03:34
311500 -- (-2280.997) [-2279.549] (-2269.495) (-2280.291) * [-2278.364] (-2277.872) (-2278.167) (-2270.631) -- 0:03:34
312000 -- [-2269.398] (-2275.264) (-2272.158) (-2278.000) * (-2274.381) (-2284.543) [-2268.605] (-2272.777) -- 0:03:33
312500 -- (-2279.370) [-2267.269] (-2276.937) (-2270.533) * (-2269.743) (-2290.593) (-2296.865) [-2267.618] -- 0:03:33
313000 -- (-2275.525) [-2277.740] (-2283.015) (-2271.382) * (-2283.221) [-2271.231] (-2269.939) (-2270.272) -- 0:03:32
313500 -- [-2271.175] (-2279.427) (-2279.355) (-2279.362) * [-2271.351] (-2275.011) (-2270.831) (-2276.071) -- 0:03:34
314000 -- (-2284.966) [-2268.253] (-2277.180) (-2275.962) * (-2276.185) (-2283.385) (-2274.784) [-2266.261] -- 0:03:34
314500 -- (-2271.936) [-2273.935] (-2266.760) (-2275.967) * [-2271.313] (-2275.633) (-2281.235) (-2269.791) -- 0:03:33
315000 -- (-2279.384) (-2284.296) [-2266.488] (-2277.260) * [-2291.323] (-2283.068) (-2277.991) (-2277.598) -- 0:03:33
Average standard deviation of split frequencies: 0.013625
315500 -- (-2282.263) [-2278.456] (-2279.695) (-2274.859) * (-2281.872) [-2276.275] (-2271.075) (-2273.154) -- 0:03:32
316000 -- (-2276.100) (-2265.964) [-2273.170] (-2284.875) * [-2266.262] (-2271.310) (-2269.469) (-2271.186) -- 0:03:32
316500 -- (-2280.424) [-2273.200] (-2274.589) (-2277.874) * (-2271.759) (-2285.543) [-2271.047] (-2269.348) -- 0:03:31
317000 -- (-2287.540) [-2273.785] (-2279.314) (-2270.703) * (-2273.257) [-2271.086] (-2272.579) (-2273.061) -- 0:03:33
317500 -- [-2275.019] (-2285.472) (-2273.862) (-2277.954) * (-2273.119) (-2286.798) [-2273.177] (-2271.994) -- 0:03:32
318000 -- [-2276.111] (-2283.637) (-2287.402) (-2279.406) * (-2271.474) (-2278.998) (-2286.259) [-2276.193] -- 0:03:32
318500 -- (-2279.895) [-2275.507] (-2274.031) (-2266.888) * (-2275.385) (-2278.773) [-2274.050] (-2281.977) -- 0:03:31
319000 -- [-2272.245] (-2280.764) (-2280.956) (-2275.907) * (-2294.911) (-2273.077) [-2276.388] (-2265.250) -- 0:03:31
319500 -- (-2281.299) (-2277.817) [-2270.030] (-2280.856) * (-2288.099) (-2268.694) [-2276.206] (-2278.466) -- 0:03:30
320000 -- (-2287.670) [-2281.744] (-2282.084) (-2284.047) * [-2271.181] (-2274.037) (-2272.828) (-2275.811) -- 0:03:32
Average standard deviation of split frequencies: 0.013035
320500 -- (-2289.306) (-2285.518) (-2276.722) [-2266.739] * [-2267.579] (-2270.923) (-2277.292) (-2272.410) -- 0:03:32
321000 -- (-2287.560) [-2270.670] (-2273.719) (-2289.174) * (-2272.713) (-2268.730) [-2268.641] (-2276.274) -- 0:03:31
321500 -- (-2286.214) (-2270.148) (-2279.477) [-2282.720] * (-2268.132) (-2279.618) [-2273.001] (-2289.068) -- 0:03:31
322000 -- (-2269.053) (-2287.328) [-2274.362] (-2276.173) * [-2262.751] (-2278.155) (-2265.845) (-2280.591) -- 0:03:30
322500 -- [-2283.205] (-2292.034) (-2277.208) (-2280.281) * [-2270.048] (-2284.765) (-2271.274) (-2284.000) -- 0:03:32
323000 -- [-2279.422] (-2272.811) (-2286.273) (-2276.704) * [-2269.543] (-2292.428) (-2274.717) (-2270.128) -- 0:03:31
323500 -- [-2280.472] (-2274.059) (-2276.353) (-2274.604) * (-2260.851) (-2273.305) [-2265.525] (-2281.397) -- 0:03:31
324000 -- (-2281.600) (-2269.555) (-2281.261) [-2267.325] * (-2275.680) (-2281.602) [-2282.819] (-2284.283) -- 0:03:30
324500 -- (-2281.221) (-2263.252) (-2286.808) [-2266.226] * (-2301.542) (-2276.524) [-2271.273] (-2273.488) -- 0:03:30
325000 -- (-2275.380) [-2266.495] (-2287.651) (-2274.092) * (-2284.232) (-2277.265) [-2276.749] (-2282.350) -- 0:03:29
Average standard deviation of split frequencies: 0.013014
325500 -- (-2284.807) (-2272.934) [-2280.714] (-2269.311) * (-2272.914) [-2267.608] (-2269.123) (-2269.805) -- 0:03:31
326000 -- (-2274.164) (-2267.064) [-2275.767] (-2286.985) * (-2275.945) (-2274.459) (-2271.683) [-2272.486] -- 0:03:30
326500 -- (-2270.116) (-2279.178) (-2281.367) [-2278.211] * [-2273.786] (-2282.463) (-2279.027) (-2278.927) -- 0:03:30
327000 -- (-2282.159) (-2269.982) [-2266.017] (-2283.161) * [-2271.173] (-2286.430) (-2289.719) (-2276.675) -- 0:03:29
327500 -- (-2282.097) (-2264.988) (-2264.958) [-2272.926] * (-2272.404) (-2269.108) [-2271.786] (-2274.027) -- 0:03:29
328000 -- (-2275.057) (-2268.006) [-2277.702] (-2276.996) * [-2273.179] (-2267.886) (-2278.909) (-2278.018) -- 0:03:28
328500 -- (-2279.871) (-2263.655) (-2281.210) [-2271.099] * (-2280.179) (-2266.023) (-2287.752) [-2274.493] -- 0:03:28
329000 -- [-2273.344] (-2274.753) (-2281.885) (-2282.025) * (-2285.122) (-2270.772) (-2274.527) [-2275.058] -- 0:03:30
329500 -- (-2288.492) (-2273.162) [-2277.370] (-2279.824) * (-2280.715) (-2273.596) [-2280.724] (-2289.145) -- 0:03:29
330000 -- (-2277.514) (-2276.931) [-2270.472] (-2281.910) * (-2275.568) [-2269.070] (-2281.271) (-2276.671) -- 0:03:29
Average standard deviation of split frequencies: 0.012355
330500 -- (-2291.583) (-2280.373) (-2277.736) [-2272.791] * (-2278.109) (-2281.007) (-2276.714) [-2277.483] -- 0:03:28
331000 -- (-2278.292) (-2270.443) (-2279.365) [-2265.353] * [-2272.937] (-2295.946) (-2276.247) (-2279.584) -- 0:03:28
331500 -- (-2267.640) [-2281.267] (-2274.887) (-2275.020) * (-2281.541) (-2278.122) [-2274.886] (-2279.803) -- 0:03:27
332000 -- [-2276.185] (-2289.608) (-2289.298) (-2270.518) * [-2278.682] (-2274.015) (-2288.958) (-2272.002) -- 0:03:27
332500 -- (-2281.417) (-2280.383) (-2278.443) [-2260.450] * (-2277.730) [-2266.281] (-2278.757) (-2274.587) -- 0:03:26
333000 -- [-2269.088] (-2271.000) (-2275.225) (-2266.467) * [-2274.870] (-2277.370) (-2278.809) (-2275.161) -- 0:03:28
333500 -- [-2270.172] (-2277.852) (-2284.817) (-2278.618) * (-2285.513) (-2280.166) (-2274.653) [-2277.966] -- 0:03:27
334000 -- (-2276.294) (-2279.513) (-2295.937) [-2267.879] * (-2273.447) (-2281.184) (-2265.700) [-2274.821] -- 0:03:27
334500 -- [-2271.392] (-2273.881) (-2286.136) (-2279.093) * (-2278.254) (-2272.725) [-2264.885] (-2276.521) -- 0:03:26
335000 -- (-2271.663) [-2278.469] (-2286.140) (-2270.309) * (-2285.468) (-2272.643) [-2264.421] (-2278.386) -- 0:03:26
Average standard deviation of split frequencies: 0.011224
335500 -- (-2291.422) (-2271.164) [-2269.727] (-2271.956) * (-2286.634) (-2274.825) [-2275.963] (-2290.271) -- 0:03:27
336000 -- (-2275.722) [-2268.428] (-2274.062) (-2287.377) * (-2282.036) (-2282.344) (-2279.101) [-2275.016] -- 0:03:27
336500 -- (-2276.226) (-2274.994) (-2274.065) [-2263.803] * (-2267.498) [-2275.641] (-2283.237) (-2279.018) -- 0:03:27
337000 -- (-2275.697) (-2279.949) (-2289.507) [-2269.991] * (-2273.607) (-2275.060) (-2278.346) [-2274.729] -- 0:03:26
337500 -- (-2282.250) (-2270.695) [-2280.150] (-2275.992) * (-2273.205) [-2274.924] (-2284.614) (-2274.707) -- 0:03:26
338000 -- (-2277.573) (-2276.557) [-2276.592] (-2277.805) * (-2274.847) (-2271.142) (-2280.870) [-2279.271] -- 0:03:25
338500 -- (-2282.109) [-2270.943] (-2267.543) (-2278.209) * (-2268.835) [-2273.810] (-2276.846) (-2276.549) -- 0:03:25
339000 -- (-2287.662) [-2269.751] (-2278.500) (-2279.303) * (-2275.205) [-2266.648] (-2284.234) (-2281.873) -- 0:03:26
339500 -- (-2266.898) [-2279.704] (-2279.607) (-2282.849) * (-2284.810) (-2280.043) [-2279.765] (-2280.940) -- 0:03:26
340000 -- (-2271.015) (-2270.194) (-2274.081) [-2274.710] * (-2273.099) [-2278.621] (-2272.334) (-2276.737) -- 0:03:25
Average standard deviation of split frequencies: 0.011162
340500 -- (-2281.308) (-2276.298) [-2274.601] (-2269.712) * (-2277.755) [-2273.918] (-2275.305) (-2269.372) -- 0:03:25
341000 -- (-2281.286) [-2268.326] (-2267.894) (-2274.016) * (-2269.920) (-2282.412) (-2269.693) [-2282.378] -- 0:03:24
341500 -- [-2267.477] (-2278.044) (-2285.029) (-2277.097) * (-2280.963) (-2270.659) [-2265.658] (-2282.440) -- 0:03:24
342000 -- (-2271.741) (-2270.015) (-2273.588) [-2266.290] * [-2269.377] (-2282.133) (-2269.826) (-2270.508) -- 0:03:23
342500 -- [-2272.523] (-2287.096) (-2284.038) (-2276.505) * (-2285.123) (-2276.017) [-2280.373] (-2272.875) -- 0:03:25
343000 -- (-2269.673) (-2282.125) (-2295.438) [-2263.798] * (-2274.132) (-2276.631) [-2265.867] (-2285.267) -- 0:03:24
343500 -- (-2284.172) (-2270.299) (-2273.145) [-2272.224] * (-2291.346) [-2275.821] (-2267.550) (-2272.918) -- 0:03:24
344000 -- (-2278.046) (-2277.067) (-2274.515) [-2273.457] * [-2275.747] (-2277.956) (-2269.377) (-2279.994) -- 0:03:24
344500 -- (-2271.625) (-2276.692) [-2267.731] (-2274.994) * (-2282.332) (-2278.522) [-2271.557] (-2274.800) -- 0:03:23
345000 -- (-2277.648) (-2274.209) [-2279.006] (-2271.087) * (-2279.304) (-2275.250) [-2268.793] (-2270.931) -- 0:03:23
Average standard deviation of split frequencies: 0.011626
345500 -- (-2268.673) (-2274.610) [-2272.781] (-2271.325) * (-2275.832) (-2277.671) (-2275.617) [-2267.682] -- 0:03:22
346000 -- (-2276.645) (-2273.009) [-2272.548] (-2275.014) * [-2273.744] (-2282.353) (-2277.077) (-2267.754) -- 0:03:24
346500 -- [-2269.786] (-2277.304) (-2267.090) (-2275.394) * (-2280.644) (-2291.893) [-2266.014] (-2275.750) -- 0:03:23
347000 -- (-2278.705) (-2276.788) (-2269.476) [-2273.934] * (-2277.986) (-2288.803) [-2276.341] (-2267.131) -- 0:03:23
347500 -- (-2269.992) [-2274.343] (-2275.464) (-2279.171) * (-2273.488) (-2285.512) [-2284.064] (-2277.771) -- 0:03:22
348000 -- (-2284.651) [-2271.825] (-2293.347) (-2285.392) * (-2270.733) (-2295.695) (-2278.466) [-2272.596] -- 0:03:22
348500 -- (-2270.236) [-2273.019] (-2282.170) (-2272.902) * (-2282.051) [-2266.782] (-2277.155) (-2281.257) -- 0:03:21
349000 -- (-2278.889) [-2271.269] (-2269.533) (-2271.462) * (-2283.622) (-2277.768) [-2267.785] (-2268.931) -- 0:03:21
349500 -- (-2276.704) (-2274.421) (-2277.364) [-2276.495] * (-2287.289) (-2282.640) (-2274.730) [-2266.359] -- 0:03:21
350000 -- (-2270.595) [-2270.049] (-2277.648) (-2280.138) * (-2274.517) (-2277.835) (-2284.941) [-2275.580] -- 0:03:22
Average standard deviation of split frequencies: 0.011382
350500 -- (-2269.955) [-2271.793] (-2270.227) (-2273.648) * (-2276.249) (-2272.954) [-2270.903] (-2281.890) -- 0:03:21
351000 -- [-2271.925] (-2278.241) (-2285.884) (-2273.541) * (-2266.348) [-2271.593] (-2270.577) (-2282.833) -- 0:03:21
351500 -- [-2268.369] (-2286.634) (-2273.719) (-2270.124) * (-2280.800) (-2272.288) (-2280.347) [-2269.785] -- 0:03:21
352000 -- [-2273.053] (-2280.494) (-2287.240) (-2275.431) * (-2267.851) (-2278.363) (-2283.980) [-2271.906] -- 0:03:20
352500 -- (-2286.717) (-2285.489) (-2284.046) [-2270.136] * (-2279.814) (-2284.638) (-2273.355) [-2266.259] -- 0:03:20
353000 -- (-2278.948) (-2269.542) (-2284.663) [-2272.991] * [-2273.824] (-2286.618) (-2269.282) (-2263.980) -- 0:03:19
353500 -- (-2268.680) [-2276.892] (-2274.998) (-2275.179) * (-2278.948) (-2286.990) (-2270.521) [-2271.742] -- 0:03:21
354000 -- (-2279.767) (-2275.318) [-2268.666] (-2280.255) * (-2273.728) (-2279.127) (-2273.415) [-2278.483] -- 0:03:20
354500 -- (-2272.865) [-2266.511] (-2277.042) (-2274.325) * (-2269.558) [-2269.974] (-2286.254) (-2277.227) -- 0:03:20
355000 -- (-2274.517) (-2266.769) [-2268.783] (-2284.195) * (-2280.324) (-2283.087) (-2267.425) [-2262.425] -- 0:03:19
Average standard deviation of split frequencies: 0.011564
355500 -- (-2282.219) [-2275.490] (-2268.978) (-2267.084) * [-2276.417] (-2280.336) (-2282.670) (-2274.524) -- 0:03:19
356000 -- (-2292.322) (-2277.303) (-2279.056) [-2271.774] * (-2280.657) [-2279.097] (-2301.989) (-2272.459) -- 0:03:18
356500 -- (-2281.240) [-2269.752] (-2280.265) (-2290.788) * (-2271.257) (-2281.168) (-2286.389) [-2282.349] -- 0:03:18
357000 -- [-2275.835] (-2279.907) (-2282.344) (-2284.529) * [-2270.380] (-2275.451) (-2270.321) (-2285.870) -- 0:03:19
357500 -- (-2277.362) (-2276.364) (-2269.564) [-2266.551] * (-2274.460) (-2272.595) (-2277.995) [-2277.217] -- 0:03:19
358000 -- (-2277.237) (-2275.598) [-2273.746] (-2279.870) * (-2280.477) (-2301.538) [-2270.003] (-2269.500) -- 0:03:19
358500 -- (-2278.895) (-2272.365) [-2272.392] (-2275.450) * [-2271.427] (-2279.896) (-2285.712) (-2272.277) -- 0:03:18
359000 -- (-2276.820) [-2282.660] (-2286.169) (-2272.813) * [-2273.695] (-2283.174) (-2280.191) (-2275.508) -- 0:03:18
359500 -- (-2278.124) [-2270.018] (-2281.367) (-2283.891) * (-2281.485) (-2269.431) (-2277.748) [-2274.044] -- 0:03:17
360000 -- (-2271.197) (-2271.002) (-2283.289) [-2272.472] * [-2273.178] (-2271.120) (-2285.266) (-2282.590) -- 0:03:17
Average standard deviation of split frequencies: 0.011589
360500 -- (-2291.547) (-2280.084) [-2270.138] (-2275.598) * (-2284.832) (-2266.287) [-2275.277] (-2272.444) -- 0:03:18
361000 -- (-2278.329) (-2264.901) (-2264.343) [-2271.695] * [-2266.355] (-2284.025) (-2282.350) (-2276.468) -- 0:03:18
361500 -- (-2278.874) (-2286.314) (-2267.260) [-2270.580] * [-2266.091] (-2270.533) (-2278.756) (-2276.841) -- 0:03:17
362000 -- [-2271.023] (-2285.672) (-2276.769) (-2273.614) * [-2275.931] (-2284.166) (-2270.485) (-2268.558) -- 0:03:17
362500 -- [-2271.843] (-2279.734) (-2284.511) (-2274.766) * (-2274.641) (-2272.915) [-2274.346] (-2267.869) -- 0:03:16
363000 -- (-2274.596) (-2289.520) [-2289.827] (-2275.255) * (-2272.020) [-2274.253] (-2274.059) (-2283.297) -- 0:03:16
363500 -- (-2282.154) (-2291.379) (-2284.912) [-2276.270] * (-2269.648) [-2271.875] (-2283.517) (-2280.089) -- 0:03:16
364000 -- (-2283.592) [-2275.746] (-2283.249) (-2272.651) * (-2272.136) (-2274.190) (-2278.141) [-2268.569] -- 0:03:17
364500 -- (-2296.763) [-2271.883] (-2282.300) (-2275.079) * (-2283.535) (-2279.542) [-2268.045] (-2276.154) -- 0:03:17
365000 -- [-2276.104] (-2276.693) (-2285.537) (-2272.703) * (-2289.102) (-2276.862) [-2270.739] (-2275.354) -- 0:03:16
Average standard deviation of split frequencies: 0.012279
365500 -- (-2284.637) (-2280.027) (-2284.929) [-2272.822] * (-2272.471) (-2282.318) (-2276.175) [-2271.443] -- 0:03:16
366000 -- (-2272.982) (-2276.282) (-2287.298) [-2271.543] * (-2285.589) (-2280.075) (-2274.367) [-2270.497] -- 0:03:15
366500 -- [-2280.586] (-2275.339) (-2277.256) (-2264.388) * (-2271.932) (-2275.515) [-2274.612] (-2270.749) -- 0:03:17
367000 -- [-2272.026] (-2269.302) (-2285.525) (-2281.140) * [-2268.843] (-2275.635) (-2265.950) (-2280.881) -- 0:03:16
367500 -- [-2268.722] (-2277.615) (-2285.016) (-2280.517) * (-2276.305) [-2270.304] (-2271.845) (-2270.493) -- 0:03:16
368000 -- (-2270.819) (-2272.737) [-2290.336] (-2289.928) * (-2280.215) (-2275.359) (-2264.310) [-2277.072] -- 0:03:15
368500 -- (-2287.963) (-2278.784) [-2274.216] (-2273.457) * [-2278.021] (-2275.398) (-2277.054) (-2276.335) -- 0:03:15
369000 -- (-2277.795) (-2286.780) [-2278.712] (-2268.937) * (-2273.467) [-2267.101] (-2282.494) (-2272.609) -- 0:03:14
369500 -- (-2272.389) (-2270.485) (-2281.292) [-2271.437] * [-2267.620] (-2275.747) (-2274.951) (-2272.150) -- 0:03:14
370000 -- (-2276.972) (-2272.645) [-2268.768] (-2283.357) * [-2267.825] (-2272.254) (-2277.065) (-2269.189) -- 0:03:15
Average standard deviation of split frequencies: 0.013566
370500 -- (-2280.980) [-2270.376] (-2279.624) (-2274.715) * (-2284.245) (-2270.101) [-2270.515] (-2269.771) -- 0:03:15
371000 -- [-2271.460] (-2278.877) (-2276.390) (-2283.871) * (-2282.412) (-2281.845) [-2275.308] (-2273.016) -- 0:03:14
371500 -- [-2267.641] (-2282.547) (-2267.183) (-2279.947) * (-2283.711) (-2278.487) [-2275.852] (-2277.780) -- 0:03:14
372000 -- (-2272.967) (-2287.204) (-2265.586) [-2272.798] * (-2279.255) [-2272.370] (-2270.999) (-2275.861) -- 0:03:14
372500 -- (-2279.696) [-2273.175] (-2285.518) (-2283.764) * [-2275.422] (-2282.109) (-2270.506) (-2274.063) -- 0:03:13
373000 -- (-2276.137) (-2267.628) (-2280.542) [-2263.883] * (-2285.610) (-2277.058) [-2271.082] (-2272.095) -- 0:03:13
373500 -- (-2285.574) [-2266.490] (-2288.267) (-2274.773) * (-2275.570) (-2282.517) (-2285.932) [-2269.380] -- 0:03:12
374000 -- (-2279.504) (-2279.139) [-2275.345] (-2280.438) * (-2276.659) [-2275.690] (-2278.699) (-2282.728) -- 0:03:14
374500 -- (-2268.726) (-2274.782) (-2284.123) [-2270.057] * [-2270.606] (-2268.301) (-2271.408) (-2278.270) -- 0:03:13
375000 -- (-2276.930) [-2268.482] (-2281.607) (-2275.526) * (-2273.841) (-2277.760) [-2270.127] (-2279.334) -- 0:03:13
Average standard deviation of split frequencies: 0.013290
375500 -- (-2271.905) [-2276.975] (-2278.605) (-2276.336) * (-2284.294) [-2280.194] (-2276.993) (-2270.639) -- 0:03:12
376000 -- (-2280.337) [-2267.097] (-2278.712) (-2277.792) * (-2278.154) (-2280.961) [-2275.671] (-2290.172) -- 0:03:12
376500 -- (-2277.881) (-2270.409) [-2266.311] (-2282.905) * (-2266.848) (-2271.399) (-2276.029) [-2281.352] -- 0:03:12
377000 -- (-2287.601) (-2270.325) (-2266.005) [-2267.114] * (-2269.157) [-2275.595] (-2285.488) (-2283.680) -- 0:03:11
377500 -- [-2280.874] (-2281.749) (-2282.692) (-2273.414) * (-2282.980) [-2269.341] (-2281.201) (-2284.519) -- 0:03:12
378000 -- (-2269.529) (-2277.429) (-2282.990) [-2267.561] * (-2280.041) [-2271.327] (-2285.741) (-2268.186) -- 0:03:12
378500 -- (-2277.380) (-2278.407) (-2277.524) [-2265.255] * (-2273.502) [-2268.931] (-2267.085) (-2282.628) -- 0:03:12
379000 -- (-2267.886) [-2278.382] (-2285.012) (-2275.309) * (-2286.346) [-2278.340] (-2268.135) (-2273.686) -- 0:03:11
379500 -- (-2273.608) [-2273.735] (-2268.781) (-2283.999) * (-2276.317) (-2278.676) [-2277.427] (-2268.358) -- 0:03:11
380000 -- [-2284.206] (-2276.346) (-2270.216) (-2279.275) * (-2282.555) (-2275.671) (-2270.163) [-2268.637] -- 0:03:10
Average standard deviation of split frequencies: 0.012631
380500 -- (-2281.327) (-2267.922) (-2271.488) [-2277.112] * (-2285.807) (-2271.014) (-2270.989) [-2271.919] -- 0:03:10
381000 -- (-2278.526) (-2294.269) (-2275.610) [-2268.734] * [-2273.354] (-2264.610) (-2285.263) (-2278.533) -- 0:03:11
381500 -- (-2291.354) (-2281.791) (-2268.319) [-2270.743] * (-2274.911) (-2273.488) (-2286.336) [-2267.249] -- 0:03:11
382000 -- [-2271.053] (-2275.042) (-2266.973) (-2281.809) * (-2272.013) [-2268.747] (-2294.733) (-2271.599) -- 0:03:10
382500 -- (-2271.031) (-2282.805) [-2272.472] (-2279.801) * (-2276.832) [-2273.741] (-2270.586) (-2275.585) -- 0:03:10
383000 -- (-2278.709) (-2279.140) [-2272.575] (-2277.920) * [-2277.154] (-2276.399) (-2271.428) (-2268.156) -- 0:03:10
383500 -- (-2278.026) (-2296.809) (-2272.278) [-2279.779] * (-2272.340) (-2276.261) [-2268.733] (-2270.345) -- 0:03:11
384000 -- (-2278.253) (-2293.560) [-2265.262] (-2276.034) * (-2268.114) (-2275.416) [-2265.626] (-2284.308) -- 0:03:10
384500 -- (-2269.738) (-2295.030) [-2276.386] (-2278.036) * (-2282.442) [-2264.332] (-2280.865) (-2269.823) -- 0:03:10
385000 -- [-2264.988] (-2287.063) (-2276.557) (-2278.091) * (-2292.220) [-2271.747] (-2270.198) (-2269.669) -- 0:03:10
Average standard deviation of split frequencies: 0.012620
385500 -- (-2273.728) (-2277.401) (-2271.983) [-2271.062] * (-2290.845) [-2270.971] (-2279.155) (-2276.418) -- 0:03:09
386000 -- [-2273.642] (-2268.544) (-2289.557) (-2267.705) * (-2278.939) (-2271.636) [-2270.431] (-2273.293) -- 0:03:09
386500 -- (-2272.767) [-2267.147] (-2291.074) (-2272.508) * (-2272.763) (-2289.385) (-2281.961) [-2268.800] -- 0:03:08
387000 -- (-2275.671) (-2290.691) [-2265.399] (-2273.245) * (-2274.618) (-2284.293) (-2276.237) [-2269.222] -- 0:03:10
387500 -- [-2276.512] (-2277.920) (-2286.690) (-2278.000) * (-2280.259) (-2286.281) (-2276.682) [-2272.327] -- 0:03:09
388000 -- (-2284.076) (-2279.266) [-2276.166] (-2277.369) * [-2280.388] (-2271.970) (-2275.882) (-2275.651) -- 0:03:09
388500 -- [-2273.859] (-2267.545) (-2294.535) (-2280.369) * (-2272.657) (-2282.004) (-2274.442) [-2269.259] -- 0:03:08
389000 -- (-2270.791) [-2275.681] (-2280.294) (-2280.130) * [-2276.107] (-2271.632) (-2286.979) (-2285.709) -- 0:03:08
389500 -- (-2273.934) (-2271.901) [-2282.216] (-2283.308) * [-2271.262] (-2281.716) (-2281.437) (-2273.927) -- 0:03:08
390000 -- (-2275.953) [-2273.420] (-2274.738) (-2281.847) * [-2268.177] (-2283.380) (-2277.229) (-2274.384) -- 0:03:09
Average standard deviation of split frequencies: 0.010699
390500 -- [-2275.919] (-2267.324) (-2288.786) (-2277.454) * (-2282.436) [-2266.478] (-2295.601) (-2285.496) -- 0:03:08
391000 -- (-2281.181) (-2271.532) (-2273.618) [-2266.951] * (-2280.069) (-2273.129) [-2273.204] (-2279.792) -- 0:03:08
391500 -- [-2272.366] (-2277.208) (-2273.249) (-2274.157) * (-2272.536) [-2265.452] (-2283.102) (-2289.099) -- 0:03:08
392000 -- (-2269.593) (-2271.134) (-2276.984) [-2274.784] * (-2278.970) (-2276.972) (-2282.761) [-2266.951] -- 0:03:09
392500 -- (-2266.960) [-2272.374] (-2275.502) (-2276.025) * (-2269.866) [-2278.017] (-2276.806) (-2274.141) -- 0:03:08
393000 -- [-2276.307] (-2275.968) (-2273.360) (-2280.122) * (-2282.651) (-2284.254) (-2289.053) [-2271.077] -- 0:03:08
393500 -- (-2274.901) (-2281.843) (-2272.595) [-2275.293] * (-2278.236) (-2290.194) [-2264.477] (-2287.735) -- 0:03:08
394000 -- (-2270.777) (-2279.387) (-2270.769) [-2266.562] * [-2267.146] (-2273.310) (-2269.263) (-2281.486) -- 0:03:07
394500 -- (-2281.736) [-2269.964] (-2277.442) (-2286.417) * (-2284.907) (-2272.347) [-2268.192] (-2284.766) -- 0:03:07
395000 -- (-2277.503) [-2270.300] (-2275.609) (-2266.426) * (-2286.954) (-2267.745) [-2270.439] (-2281.988) -- 0:03:06
Average standard deviation of split frequencies: 0.010634
395500 -- (-2283.190) [-2280.184] (-2282.727) (-2284.194) * (-2275.037) (-2275.271) (-2281.756) [-2282.874] -- 0:03:07
396000 -- (-2278.542) (-2279.554) [-2270.273] (-2286.162) * (-2274.764) [-2273.232] (-2273.094) (-2287.948) -- 0:03:07
396500 -- (-2270.423) [-2269.639] (-2273.090) (-2284.774) * (-2281.189) (-2270.996) [-2265.236] (-2280.629) -- 0:03:07
397000 -- (-2287.508) (-2270.011) [-2266.942] (-2282.162) * [-2269.940] (-2281.579) (-2282.028) (-2286.696) -- 0:03:06
397500 -- (-2282.767) (-2275.572) [-2268.679] (-2272.896) * [-2273.388] (-2284.643) (-2290.282) (-2281.407) -- 0:03:06
398000 -- [-2275.495] (-2282.142) (-2276.574) (-2279.932) * [-2271.060] (-2269.076) (-2284.349) (-2278.658) -- 0:03:07
398500 -- (-2279.896) [-2277.343] (-2271.404) (-2280.086) * (-2279.084) (-2272.143) (-2279.987) [-2269.855] -- 0:03:07
399000 -- (-2272.551) [-2266.790] (-2279.636) (-2268.041) * (-2277.650) (-2273.422) (-2273.089) [-2271.232] -- 0:03:06
399500 -- (-2275.355) [-2271.318] (-2279.788) (-2277.880) * (-2285.965) (-2295.878) [-2267.107] (-2281.914) -- 0:03:06
400000 -- (-2277.672) (-2272.620) [-2282.268] (-2290.746) * (-2275.465) (-2274.219) [-2270.386] (-2280.837) -- 0:03:06
Average standard deviation of split frequencies: 0.009726
400500 -- (-2269.447) (-2278.475) (-2277.966) [-2279.199] * (-2290.246) (-2273.556) [-2272.834] (-2275.758) -- 0:03:05
401000 -- (-2279.408) (-2278.982) (-2279.947) [-2274.770] * (-2277.509) (-2276.403) [-2275.961] (-2279.398) -- 0:03:05
401500 -- (-2287.834) (-2287.470) [-2269.464] (-2270.257) * (-2279.045) (-2281.091) (-2274.059) [-2275.721] -- 0:03:04
402000 -- [-2270.948] (-2271.639) (-2273.297) (-2278.130) * (-2279.933) (-2271.209) [-2275.182] (-2289.255) -- 0:03:05
402500 -- (-2268.838) [-2274.744] (-2290.738) (-2287.595) * (-2286.878) (-2285.534) (-2277.270) [-2277.843] -- 0:03:05
403000 -- (-2277.425) (-2272.774) [-2276.812] (-2280.506) * [-2281.470] (-2277.975) (-2285.054) (-2287.419) -- 0:03:05
403500 -- (-2277.072) (-2278.340) (-2278.332) [-2271.084] * (-2277.445) (-2277.268) [-2276.955] (-2282.549) -- 0:03:04
404000 -- (-2286.058) (-2284.630) [-2263.169] (-2276.984) * (-2276.357) (-2277.938) [-2265.572] (-2276.834) -- 0:03:04
404500 -- (-2273.744) [-2274.392] (-2276.946) (-2276.540) * (-2276.144) [-2272.100] (-2285.365) (-2279.576) -- 0:03:04
405000 -- (-2284.878) (-2283.319) (-2268.537) [-2271.007] * [-2274.567] (-2280.268) (-2272.696) (-2270.344) -- 0:03:03
Average standard deviation of split frequencies: 0.010063
405500 -- [-2279.164] (-2285.557) (-2283.631) (-2279.252) * (-2270.544) (-2289.032) [-2264.249] (-2269.672) -- 0:03:04
406000 -- [-2281.452] (-2277.410) (-2297.592) (-2279.713) * [-2274.934] (-2282.776) (-2278.339) (-2274.834) -- 0:03:04
406500 -- (-2284.679) (-2270.875) (-2274.894) [-2275.838] * (-2282.024) (-2281.076) [-2268.138] (-2275.696) -- 0:03:03
407000 -- (-2274.269) [-2274.644] (-2282.526) (-2273.824) * (-2289.309) (-2280.233) [-2265.930] (-2276.173) -- 0:03:03
407500 -- (-2266.494) (-2279.028) [-2282.921] (-2274.834) * (-2278.192) (-2272.253) [-2273.061] (-2277.817) -- 0:03:03
408000 -- (-2271.278) [-2275.126] (-2273.424) (-2283.235) * (-2298.746) [-2266.501] (-2282.467) (-2273.049) -- 0:03:02
408500 -- (-2290.011) [-2266.320] (-2278.351) (-2287.713) * (-2278.414) (-2283.067) [-2268.473] (-2278.606) -- 0:03:02
409000 -- (-2278.490) (-2269.657) (-2286.077) [-2277.556] * [-2267.653] (-2286.650) (-2271.865) (-2274.764) -- 0:03:03
409500 -- (-2280.497) (-2279.014) (-2283.993) [-2273.259] * [-2268.679] (-2276.848) (-2274.164) (-2278.145) -- 0:03:03
410000 -- (-2280.253) [-2271.591] (-2288.261) (-2280.951) * (-2269.639) (-2286.365) [-2274.531] (-2276.586) -- 0:03:02
Average standard deviation of split frequencies: 0.009336
410500 -- (-2279.975) (-2275.528) (-2283.415) [-2269.987] * (-2278.186) [-2274.157] (-2275.215) (-2276.291) -- 0:03:02
411000 -- (-2271.447) (-2293.259) (-2272.957) [-2267.463] * (-2272.962) (-2272.051) [-2270.260] (-2269.615) -- 0:03:02
411500 -- (-2274.828) (-2272.691) (-2262.086) [-2267.860] * (-2269.671) (-2280.021) (-2282.770) [-2273.516] -- 0:03:01
412000 -- (-2279.521) [-2282.363] (-2283.355) (-2270.084) * (-2270.892) (-2278.072) (-2285.588) [-2281.665] -- 0:03:01
412500 -- (-2282.188) [-2279.555] (-2277.979) (-2268.310) * (-2275.800) (-2288.195) (-2273.714) [-2273.161] -- 0:03:02
413000 -- (-2271.699) (-2275.542) [-2268.019] (-2280.032) * (-2270.877) (-2285.069) (-2276.764) [-2269.989] -- 0:03:01
413500 -- (-2272.386) [-2277.423] (-2270.782) (-2270.356) * (-2271.311) (-2277.877) [-2277.776] (-2280.614) -- 0:03:01
414000 -- [-2273.338] (-2269.125) (-2277.447) (-2273.240) * (-2285.249) (-2279.050) (-2267.462) [-2273.385] -- 0:03:01
414500 -- [-2278.092] (-2276.686) (-2273.086) (-2284.311) * [-2276.411] (-2279.728) (-2279.167) (-2278.144) -- 0:03:02
415000 -- (-2262.699) (-2279.294) (-2278.096) [-2276.570] * [-2277.021] (-2273.069) (-2284.382) (-2281.694) -- 0:03:01
Average standard deviation of split frequencies: 0.009292
415500 -- (-2269.494) [-2279.031] (-2274.262) (-2296.538) * (-2277.260) (-2279.264) (-2286.653) [-2274.106] -- 0:03:01
416000 -- (-2270.120) [-2272.249] (-2273.331) (-2285.206) * (-2278.914) (-2273.099) (-2290.591) [-2280.393] -- 0:03:01
416500 -- (-2285.047) (-2275.908) (-2271.667) [-2276.528] * [-2268.474] (-2269.072) (-2293.303) (-2276.522) -- 0:03:00
417000 -- (-2284.274) (-2273.174) (-2275.207) [-2271.071] * [-2274.248] (-2285.456) (-2284.613) (-2266.685) -- 0:03:00
417500 -- (-2276.908) [-2275.239] (-2276.412) (-2286.430) * [-2272.151] (-2285.631) (-2282.529) (-2277.440) -- 0:03:01
418000 -- [-2271.064] (-2268.214) (-2276.710) (-2272.581) * (-2277.832) (-2281.901) (-2292.031) [-2278.322] -- 0:03:01
418500 -- (-2280.887) [-2272.606] (-2275.839) (-2281.719) * (-2290.725) [-2271.793] (-2281.375) (-2279.280) -- 0:03:00
419000 -- (-2273.862) (-2266.581) (-2282.691) [-2269.563] * (-2274.401) [-2271.964] (-2283.026) (-2290.692) -- 0:03:00
419500 -- (-2271.752) [-2270.544] (-2280.620) (-2276.326) * [-2283.215] (-2271.579) (-2270.934) (-2292.791) -- 0:02:59
420000 -- (-2281.954) [-2273.790] (-2269.679) (-2275.114) * [-2277.019] (-2278.632) (-2272.310) (-2291.561) -- 0:02:59
Average standard deviation of split frequencies: 0.010310
420500 -- (-2281.136) (-2281.451) [-2267.273] (-2274.808) * (-2275.018) (-2270.591) [-2272.890] (-2274.785) -- 0:02:59
421000 -- [-2267.259] (-2264.187) (-2281.586) (-2277.422) * (-2273.932) (-2279.953) (-2281.129) [-2263.832] -- 0:03:00
421500 -- (-2272.019) (-2277.653) (-2268.594) [-2275.223] * (-2271.506) (-2283.399) (-2268.048) [-2271.415] -- 0:02:59
422000 -- (-2274.058) (-2273.948) [-2278.335] (-2273.950) * (-2274.836) (-2286.345) [-2274.865] (-2276.344) -- 0:02:59
422500 -- [-2270.336] (-2291.186) (-2273.010) (-2271.244) * (-2280.445) (-2291.485) (-2272.676) [-2270.338] -- 0:02:59
423000 -- [-2273.715] (-2285.024) (-2275.187) (-2279.292) * (-2281.015) (-2272.068) (-2281.385) [-2266.859] -- 0:02:58
423500 -- [-2269.812] (-2280.445) (-2283.922) (-2283.273) * (-2276.617) (-2286.358) [-2268.498] (-2274.141) -- 0:02:58
424000 -- [-2268.384] (-2282.382) (-2292.528) (-2270.792) * (-2285.770) [-2271.962] (-2288.516) (-2282.809) -- 0:02:59
424500 -- (-2266.991) (-2271.797) (-2280.253) [-2268.464] * (-2270.011) (-2283.908) (-2282.016) [-2267.118] -- 0:02:58
425000 -- [-2268.981] (-2278.818) (-2279.196) (-2268.229) * (-2283.081) (-2291.986) (-2282.117) [-2278.274] -- 0:02:58
Average standard deviation of split frequencies: 0.011140
425500 -- (-2274.063) [-2270.497] (-2272.502) (-2284.575) * [-2281.732] (-2273.190) (-2278.418) (-2274.836) -- 0:02:58
426000 -- [-2275.929] (-2273.437) (-2280.842) (-2280.986) * (-2268.624) (-2295.427) [-2275.802] (-2276.177) -- 0:02:57
426500 -- (-2278.925) [-2277.154] (-2271.942) (-2280.891) * (-2285.317) [-2273.292] (-2284.459) (-2285.866) -- 0:02:57
427000 -- (-2287.993) [-2266.425] (-2275.227) (-2269.868) * (-2267.815) (-2277.120) [-2276.449] (-2276.256) -- 0:02:58
427500 -- (-2278.213) [-2273.336] (-2280.085) (-2277.268) * [-2268.164] (-2282.954) (-2280.968) (-2273.024) -- 0:02:58
428000 -- (-2273.060) (-2271.149) (-2293.222) [-2267.469] * (-2292.488) [-2281.471] (-2276.038) (-2276.409) -- 0:02:57
428500 -- (-2285.710) [-2265.928] (-2283.292) (-2267.315) * [-2284.455] (-2277.236) (-2271.530) (-2278.247) -- 0:02:57
429000 -- (-2287.563) (-2264.862) [-2283.304] (-2279.008) * [-2270.204] (-2283.434) (-2275.631) (-2275.156) -- 0:02:57
429500 -- (-2272.517) [-2271.630] (-2282.414) (-2274.892) * (-2281.926) (-2287.904) (-2286.522) [-2268.747] -- 0:02:56
430000 -- [-2279.061] (-2286.407) (-2267.046) (-2275.668) * (-2273.130) (-2277.091) [-2275.216] (-2267.440) -- 0:02:56
Average standard deviation of split frequencies: 0.012186
430500 -- (-2284.540) (-2276.066) [-2273.113] (-2280.465) * (-2272.907) (-2276.721) [-2271.388] (-2270.902) -- 0:02:55
431000 -- (-2280.417) (-2270.573) [-2263.867] (-2266.826) * (-2277.395) (-2279.434) (-2274.019) [-2273.063] -- 0:02:56
431500 -- [-2275.223] (-2282.367) (-2272.010) (-2271.822) * (-2273.990) (-2279.031) [-2270.093] (-2262.870) -- 0:02:56
432000 -- (-2274.775) (-2278.325) [-2277.140] (-2269.116) * (-2284.486) (-2278.986) (-2285.316) [-2270.506] -- 0:02:56
432500 -- [-2274.600] (-2281.195) (-2279.979) (-2275.999) * (-2271.841) (-2278.217) [-2273.345] (-2269.075) -- 0:02:55
433000 -- (-2267.763) [-2277.179] (-2278.459) (-2275.715) * (-2286.707) (-2275.569) [-2277.058] (-2268.698) -- 0:02:55
433500 -- [-2271.089] (-2274.820) (-2282.647) (-2278.484) * (-2287.018) [-2287.741] (-2278.819) (-2284.078) -- 0:02:55
434000 -- [-2275.812] (-2285.282) (-2283.119) (-2274.352) * (-2277.443) (-2286.772) (-2278.527) [-2268.558] -- 0:02:54
434500 -- (-2274.232) (-2272.148) [-2279.452] (-2294.671) * (-2286.997) [-2273.820] (-2271.962) (-2268.408) -- 0:02:55
435000 -- (-2281.643) (-2284.115) [-2275.271] (-2279.373) * (-2269.112) (-2276.970) (-2276.061) [-2272.698] -- 0:02:55
Average standard deviation of split frequencies: 0.011028
435500 -- [-2271.317] (-2281.502) (-2269.535) (-2273.836) * [-2268.198] (-2276.516) (-2268.091) (-2272.511) -- 0:02:54
436000 -- (-2273.684) (-2275.362) (-2271.713) [-2268.333] * (-2276.682) (-2282.080) (-2288.272) [-2269.570] -- 0:02:54
436500 -- (-2285.531) [-2268.254] (-2290.066) (-2276.042) * [-2268.735] (-2284.051) (-2278.929) (-2278.424) -- 0:02:54
437000 -- [-2269.838] (-2280.845) (-2276.447) (-2283.797) * (-2281.603) (-2286.214) (-2267.859) [-2271.915] -- 0:02:53
437500 -- (-2275.153) (-2279.784) [-2284.643] (-2277.761) * [-2276.204] (-2275.577) (-2280.723) (-2274.385) -- 0:02:54
438000 -- (-2264.003) (-2286.504) (-2269.837) [-2265.442] * (-2279.099) [-2276.617] (-2268.455) (-2273.322) -- 0:02:54
438500 -- [-2270.844] (-2283.495) (-2278.350) (-2271.446) * (-2286.674) [-2264.821] (-2280.751) (-2275.506) -- 0:02:54
439000 -- [-2269.205] (-2274.359) (-2281.479) (-2281.686) * (-2275.580) [-2269.433] (-2271.896) (-2282.838) -- 0:02:53
439500 -- (-2268.190) [-2266.214] (-2270.263) (-2283.170) * [-2272.367] (-2271.074) (-2277.106) (-2287.964) -- 0:02:53
440000 -- (-2285.342) (-2267.993) (-2284.496) [-2279.035] * [-2269.810] (-2268.282) (-2289.252) (-2278.449) -- 0:02:53
Average standard deviation of split frequencies: 0.010341
440500 -- [-2283.708] (-2286.433) (-2272.745) (-2279.779) * (-2272.746) [-2268.382] (-2271.164) (-2278.507) -- 0:02:52
441000 -- (-2281.277) [-2276.616] (-2264.238) (-2280.741) * [-2271.891] (-2271.829) (-2289.723) (-2271.806) -- 0:02:52
441500 -- (-2297.921) (-2275.753) (-2277.097) [-2270.747] * (-2278.977) (-2272.399) (-2275.488) [-2269.967] -- 0:02:53
442000 -- (-2275.018) (-2274.210) [-2268.185] (-2275.227) * (-2271.468) [-2286.671] (-2265.520) (-2278.913) -- 0:02:52
442500 -- (-2273.725) (-2271.734) (-2276.926) [-2267.573] * (-2277.412) (-2275.415) (-2283.716) [-2275.611] -- 0:02:52
443000 -- (-2278.337) (-2279.716) [-2271.113] (-2269.435) * [-2270.424] (-2268.179) (-2273.808) (-2265.254) -- 0:02:52
443500 -- (-2267.569) (-2288.798) [-2276.706] (-2279.053) * (-2273.438) (-2280.467) [-2273.906] (-2281.417) -- 0:02:51
444000 -- (-2278.401) [-2278.060] (-2278.825) (-2281.540) * (-2277.470) (-2280.895) [-2271.056] (-2270.819) -- 0:02:51
444500 -- [-2276.223] (-2278.270) (-2271.432) (-2280.849) * (-2288.865) (-2285.423) (-2269.475) [-2275.470] -- 0:02:51
445000 -- (-2288.271) (-2270.391) [-2280.268] (-2271.341) * (-2276.056) [-2268.771] (-2271.488) (-2286.057) -- 0:02:52
Average standard deviation of split frequencies: 0.010429
445500 -- (-2292.941) (-2273.553) [-2273.233] (-2273.996) * [-2271.216] (-2269.831) (-2271.691) (-2275.044) -- 0:02:51
446000 -- (-2290.598) (-2275.183) [-2276.413] (-2276.243) * (-2277.107) [-2264.689] (-2279.083) (-2266.730) -- 0:02:51
446500 -- (-2271.563) (-2281.991) (-2274.462) [-2276.255] * [-2268.482] (-2274.007) (-2284.731) (-2282.682) -- 0:02:51
447000 -- [-2275.331] (-2276.619) (-2289.820) (-2285.434) * (-2264.754) (-2274.438) [-2273.756] (-2275.693) -- 0:02:50
447500 -- (-2277.046) [-2270.683] (-2281.065) (-2274.231) * (-2265.447) [-2261.843] (-2271.922) (-2282.503) -- 0:02:51
448000 -- (-2269.812) (-2273.753) (-2274.480) [-2274.996] * [-2273.473] (-2273.385) (-2280.146) (-2269.209) -- 0:02:51
448500 -- (-2284.262) (-2277.498) [-2276.615] (-2284.228) * (-2275.229) (-2278.019) (-2295.844) [-2269.328] -- 0:02:50
449000 -- (-2277.319) (-2279.015) [-2284.104] (-2273.551) * (-2284.322) (-2269.642) [-2265.125] (-2281.055) -- 0:02:50
449500 -- (-2267.891) [-2274.195] (-2272.572) (-2285.085) * [-2265.858] (-2281.108) (-2274.653) (-2279.031) -- 0:02:50
450000 -- (-2276.933) (-2275.765) [-2281.801] (-2271.459) * (-2278.539) (-2283.832) [-2283.722] (-2270.383) -- 0:02:49
Average standard deviation of split frequencies: 0.010181
450500 -- (-2283.145) [-2269.115] (-2283.507) (-2269.308) * (-2284.996) (-2280.179) [-2263.072] (-2289.152) -- 0:02:50
451000 -- (-2283.047) [-2278.250] (-2274.683) (-2283.537) * (-2278.976) (-2281.222) (-2266.119) [-2273.818] -- 0:02:50
451500 -- (-2274.418) (-2276.301) [-2281.694] (-2275.747) * [-2272.396] (-2284.172) (-2277.077) (-2281.189) -- 0:02:50
452000 -- (-2279.931) [-2274.287] (-2288.266) (-2295.930) * (-2274.437) (-2277.834) [-2280.295] (-2273.659) -- 0:02:49
452500 -- (-2279.947) (-2278.938) [-2274.244] (-2296.101) * (-2281.935) (-2269.981) [-2269.135] (-2273.858) -- 0:02:50
453000 -- (-2274.187) [-2280.844] (-2276.540) (-2282.098) * (-2286.098) (-2294.364) [-2270.502] (-2270.565) -- 0:02:50
453500 -- (-2279.045) (-2281.765) [-2276.922] (-2278.587) * (-2287.468) (-2271.978) [-2274.643] (-2277.825) -- 0:02:49
454000 -- (-2281.466) (-2271.624) [-2270.377] (-2276.958) * (-2288.426) (-2277.293) [-2280.047] (-2276.744) -- 0:02:49
454500 -- (-2291.283) (-2266.955) (-2293.381) [-2278.372] * (-2292.395) (-2269.090) (-2281.559) [-2272.991] -- 0:02:49
455000 -- (-2274.434) [-2273.827] (-2287.021) (-2271.862) * [-2271.245] (-2277.155) (-2267.379) (-2283.934) -- 0:02:48
Average standard deviation of split frequencies: 0.009166
455500 -- (-2281.116) (-2280.172) (-2301.341) [-2270.887] * (-2273.829) (-2271.806) [-2269.349] (-2282.265) -- 0:02:48
456000 -- (-2276.455) (-2275.253) (-2283.943) [-2262.380] * (-2287.286) (-2276.158) (-2279.565) [-2272.207] -- 0:02:49
456500 -- [-2271.964] (-2281.425) (-2269.494) (-2268.096) * (-2275.139) [-2277.056] (-2278.777) (-2288.844) -- 0:02:49
457000 -- [-2270.430] (-2302.261) (-2275.385) (-2272.186) * (-2288.788) (-2276.103) [-2270.345] (-2276.627) -- 0:02:48
457500 -- (-2281.493) (-2285.441) (-2280.147) [-2287.610] * (-2285.825) (-2275.102) (-2272.772) [-2279.066] -- 0:02:48
458000 -- (-2280.745) (-2287.806) (-2282.128) [-2272.921] * (-2287.256) (-2267.574) (-2272.087) [-2274.970] -- 0:02:48
458500 -- [-2279.112] (-2286.422) (-2281.264) (-2272.609) * (-2277.373) (-2280.636) [-2266.946] (-2276.968) -- 0:02:48
459000 -- (-2278.150) (-2281.403) [-2273.376] (-2274.606) * (-2278.522) (-2272.564) (-2277.351) [-2275.866] -- 0:02:48
459500 -- (-2271.892) (-2288.283) (-2276.786) [-2276.090] * (-2269.365) (-2274.565) (-2277.676) [-2264.208] -- 0:02:48
460000 -- (-2276.813) (-2272.694) [-2269.588] (-2279.538) * [-2264.725] (-2273.270) (-2274.223) (-2277.325) -- 0:02:47
Average standard deviation of split frequencies: 0.008869
460500 -- (-2270.420) [-2262.722] (-2275.350) (-2267.806) * (-2279.912) (-2272.525) [-2273.330] (-2271.398) -- 0:02:47
461000 -- (-2273.646) [-2275.074] (-2276.067) (-2277.359) * (-2278.633) [-2275.669] (-2278.070) (-2274.098) -- 0:02:47
461500 -- [-2271.694] (-2268.939) (-2292.147) (-2266.502) * [-2276.266] (-2276.982) (-2271.798) (-2274.355) -- 0:02:46
462000 -- (-2282.632) (-2276.237) (-2271.095) [-2271.108] * [-2278.946] (-2282.253) (-2272.838) (-2279.331) -- 0:02:47
462500 -- [-2274.043] (-2282.622) (-2282.038) (-2278.276) * [-2267.778] (-2280.643) (-2296.275) (-2274.225) -- 0:02:47
463000 -- (-2274.329) [-2267.383] (-2281.978) (-2272.849) * (-2284.242) (-2274.115) [-2271.744] (-2276.889) -- 0:02:47
463500 -- (-2284.141) (-2283.739) (-2274.929) [-2267.142] * (-2273.639) [-2268.321] (-2278.424) (-2278.357) -- 0:02:46
464000 -- (-2279.109) [-2272.147] (-2275.026) (-2283.622) * (-2274.967) (-2280.651) [-2268.266] (-2280.410) -- 0:02:46
464500 -- [-2270.723] (-2271.285) (-2274.975) (-2273.551) * (-2271.034) [-2277.659] (-2270.869) (-2279.208) -- 0:02:46
465000 -- [-2268.060] (-2281.585) (-2272.104) (-2273.605) * (-2272.720) (-2273.343) (-2289.613) [-2278.359] -- 0:02:45
Average standard deviation of split frequencies: 0.008295
465500 -- (-2289.583) (-2293.155) (-2274.134) [-2271.356] * (-2282.926) (-2276.299) [-2268.703] (-2276.349) -- 0:02:46
466000 -- [-2272.103] (-2275.980) (-2278.558) (-2283.388) * [-2272.293] (-2275.487) (-2267.094) (-2277.685) -- 0:02:46
466500 -- (-2271.975) [-2278.966] (-2280.220) (-2277.723) * (-2283.974) [-2269.792] (-2282.158) (-2271.155) -- 0:02:45
467000 -- (-2280.292) (-2283.709) [-2269.146] (-2273.054) * [-2286.557] (-2279.475) (-2285.608) (-2282.332) -- 0:02:45
467500 -- (-2270.841) (-2292.096) [-2272.595] (-2274.910) * [-2282.521] (-2270.587) (-2284.330) (-2268.693) -- 0:02:45
468000 -- (-2278.926) [-2277.093] (-2273.788) (-2289.209) * (-2282.120) (-2268.194) (-2270.767) [-2269.442] -- 0:02:44
468500 -- (-2275.129) (-2299.510) [-2270.323] (-2275.890) * (-2290.715) [-2270.234] (-2278.803) (-2287.566) -- 0:02:44
469000 -- (-2275.351) (-2279.636) [-2274.219] (-2280.949) * (-2285.314) [-2281.151] (-2275.059) (-2286.735) -- 0:02:45
469500 -- (-2277.874) (-2274.836) [-2268.113] (-2276.166) * (-2286.619) (-2279.174) (-2273.439) [-2266.119] -- 0:02:44
470000 -- [-2274.088] (-2281.636) (-2276.094) (-2280.595) * (-2274.825) (-2280.636) (-2270.465) [-2270.667] -- 0:02:44
Average standard deviation of split frequencies: 0.008413
470500 -- [-2271.378] (-2281.171) (-2275.603) (-2280.291) * (-2284.198) [-2268.183] (-2279.989) (-2274.980) -- 0:02:44
471000 -- (-2270.015) [-2277.151] (-2286.160) (-2275.995) * (-2269.328) [-2270.980] (-2272.706) (-2276.176) -- 0:02:43
471500 -- [-2276.920] (-2278.792) (-2279.520) (-2273.613) * (-2273.297) (-2271.881) [-2268.387] (-2277.074) -- 0:02:43
472000 -- (-2274.901) [-2274.640] (-2275.039) (-2285.972) * [-2275.889] (-2270.692) (-2272.851) (-2281.299) -- 0:02:43
472500 -- (-2275.239) (-2291.654) [-2274.402] (-2280.958) * (-2274.386) (-2277.087) [-2270.230] (-2277.725) -- 0:02:42
473000 -- (-2283.222) (-2277.781) (-2279.323) [-2264.723] * (-2282.575) [-2269.651] (-2264.571) (-2290.525) -- 0:02:43
473500 -- (-2274.895) [-2270.717] (-2279.208) (-2277.758) * (-2265.686) [-2267.959] (-2298.520) (-2274.581) -- 0:02:43
474000 -- (-2271.174) (-2277.120) [-2270.598] (-2268.751) * [-2266.933] (-2270.986) (-2281.887) (-2282.826) -- 0:02:43
474500 -- (-2273.806) (-2274.628) [-2264.104] (-2270.824) * (-2271.162) (-2284.052) [-2277.217] (-2280.802) -- 0:02:42
475000 -- (-2290.458) (-2276.038) (-2278.016) [-2279.477] * (-2280.708) (-2280.376) (-2281.235) [-2279.157] -- 0:02:42
Average standard deviation of split frequencies: 0.008385
475500 -- (-2284.314) (-2276.493) [-2273.394] (-2275.226) * (-2283.119) (-2281.748) [-2266.637] (-2278.303) -- 0:02:42
476000 -- (-2282.555) (-2280.157) [-2267.829] (-2273.636) * (-2278.322) (-2277.821) (-2271.119) [-2274.803] -- 0:02:41
476500 -- (-2282.236) (-2275.377) (-2276.804) [-2269.291] * (-2270.135) (-2269.914) [-2279.718] (-2286.549) -- 0:02:42
477000 -- (-2275.468) [-2274.510] (-2281.781) (-2272.672) * (-2283.125) (-2286.525) (-2274.259) [-2284.531] -- 0:02:42
477500 -- (-2281.482) (-2275.026) (-2270.524) [-2272.038] * (-2274.850) (-2278.227) [-2269.966] (-2280.308) -- 0:02:41
478000 -- (-2282.352) (-2280.180) [-2274.036] (-2275.144) * (-2282.790) (-2268.087) [-2272.528] (-2272.805) -- 0:02:41
478500 -- (-2281.540) (-2275.302) [-2279.431] (-2274.444) * (-2272.829) (-2278.529) [-2270.985] (-2293.738) -- 0:02:41
479000 -- (-2277.630) (-2276.678) (-2277.010) [-2267.482] * (-2272.442) (-2290.209) [-2272.350] (-2281.259) -- 0:02:42
479500 -- [-2268.592] (-2270.913) (-2292.927) (-2271.851) * [-2280.264] (-2278.318) (-2284.385) (-2282.870) -- 0:02:41
480000 -- (-2267.524) (-2279.505) [-2271.570] (-2273.992) * (-2280.096) (-2278.563) [-2274.093] (-2276.230) -- 0:02:41
Average standard deviation of split frequencies: 0.008827
480500 -- (-2276.580) [-2283.058] (-2272.557) (-2281.973) * (-2279.325) (-2272.170) [-2268.059] (-2273.914) -- 0:02:41
481000 -- [-2274.763] (-2281.624) (-2270.426) (-2283.271) * (-2276.082) (-2277.548) [-2275.722] (-2290.937) -- 0:02:40
481500 -- [-2269.206] (-2285.757) (-2276.089) (-2269.037) * (-2280.649) (-2276.065) (-2282.026) [-2269.882] -- 0:02:41
482000 -- (-2262.681) (-2275.139) (-2265.124) [-2273.477] * (-2278.116) (-2282.892) (-2280.934) [-2268.126] -- 0:02:41
482500 -- [-2289.859] (-2289.495) (-2272.604) (-2276.490) * [-2269.931] (-2270.429) (-2285.277) (-2283.389) -- 0:02:40
483000 -- (-2275.405) (-2286.259) (-2278.487) [-2272.890] * [-2266.457] (-2275.079) (-2272.864) (-2273.985) -- 0:02:40
483500 -- [-2273.489] (-2269.383) (-2277.631) (-2270.581) * (-2284.374) [-2268.124] (-2276.849) (-2274.051) -- 0:02:40
484000 -- [-2269.938] (-2285.464) (-2267.443) (-2267.371) * (-2288.059) [-2273.306] (-2274.825) (-2270.387) -- 0:02:39
484500 -- (-2282.801) (-2281.747) [-2272.670] (-2289.301) * (-2292.079) (-2282.716) [-2279.112] (-2283.724) -- 0:02:39
485000 -- [-2273.955] (-2279.194) (-2281.680) (-2291.312) * (-2289.281) [-2276.294] (-2263.487) (-2271.864) -- 0:02:39
Average standard deviation of split frequencies: 0.008924
485500 -- [-2272.175] (-2273.613) (-2282.816) (-2288.672) * (-2279.914) [-2275.073] (-2274.720) (-2282.818) -- 0:02:40
486000 -- (-2279.538) (-2278.298) [-2268.734] (-2281.204) * (-2273.770) [-2274.111] (-2286.822) (-2283.364) -- 0:02:39
486500 -- (-2275.625) [-2279.334] (-2268.240) (-2291.078) * (-2269.126) (-2277.888) [-2273.418] (-2281.235) -- 0:02:39
487000 -- (-2274.438) (-2274.984) (-2276.077) [-2277.991] * [-2268.604] (-2284.540) (-2276.548) (-2271.197) -- 0:02:39
487500 -- [-2277.233] (-2271.937) (-2281.330) (-2267.783) * (-2271.789) [-2277.006] (-2276.121) (-2281.578) -- 0:02:38
488000 -- (-2288.283) (-2279.267) [-2279.544] (-2272.801) * (-2269.165) (-2287.990) (-2266.384) [-2270.287] -- 0:02:38
488500 -- (-2284.512) (-2274.856) (-2268.924) [-2273.806] * (-2269.889) (-2274.808) [-2272.880] (-2272.091) -- 0:02:38
489000 -- [-2268.665] (-2284.372) (-2272.209) (-2269.977) * [-2271.821] (-2274.105) (-2287.468) (-2281.940) -- 0:02:38
489500 -- (-2284.807) (-2277.089) [-2267.235] (-2281.720) * (-2281.946) (-2273.635) [-2277.400] (-2279.777) -- 0:02:38
490000 -- (-2279.203) (-2283.171) [-2274.958] (-2276.720) * [-2269.201] (-2277.926) (-2269.094) (-2271.597) -- 0:02:38
Average standard deviation of split frequencies: 0.009415
490500 -- (-2276.017) (-2281.108) (-2279.426) [-2281.915] * [-2271.138] (-2280.680) (-2275.027) (-2293.692) -- 0:02:37
491000 -- (-2270.270) (-2277.563) [-2272.926] (-2278.957) * (-2288.073) (-2271.924) [-2270.372] (-2276.611) -- 0:02:37
491500 -- (-2273.947) (-2280.092) (-2288.299) [-2276.160] * (-2281.107) [-2280.144] (-2266.435) (-2286.840) -- 0:02:37
492000 -- [-2266.145] (-2279.778) (-2276.546) (-2289.785) * (-2284.442) (-2274.197) (-2274.655) [-2266.776] -- 0:02:36
492500 -- [-2269.529] (-2277.533) (-2269.820) (-2289.858) * (-2283.727) (-2267.498) (-2271.951) [-2273.375] -- 0:02:37
493000 -- [-2281.252] (-2284.547) (-2273.278) (-2274.636) * (-2292.680) [-2267.461] (-2283.740) (-2272.325) -- 0:02:37
493500 -- (-2279.405) (-2283.423) [-2270.766] (-2278.036) * (-2285.647) (-2275.221) (-2281.374) [-2266.488] -- 0:02:37
494000 -- (-2279.084) (-2279.193) (-2268.937) [-2270.814] * (-2280.074) (-2277.898) (-2280.105) [-2277.297] -- 0:02:36
494500 -- [-2269.352] (-2281.720) (-2274.246) (-2269.221) * (-2269.728) [-2277.234] (-2281.373) (-2274.067) -- 0:02:36
495000 -- (-2281.392) (-2272.763) [-2269.280] (-2268.337) * [-2278.783] (-2272.867) (-2282.285) (-2275.528) -- 0:02:36
Average standard deviation of split frequencies: 0.009124
495500 -- (-2278.712) [-2267.332] (-2280.204) (-2275.235) * (-2280.044) [-2271.091] (-2279.183) (-2271.192) -- 0:02:36
496000 -- (-2276.859) (-2273.904) (-2270.890) [-2279.093] * (-2281.002) [-2268.554] (-2274.064) (-2271.690) -- 0:02:36
496500 -- (-2285.929) (-2260.621) (-2272.531) [-2277.720] * (-2277.098) [-2274.494] (-2266.251) (-2278.845) -- 0:02:36
497000 -- (-2279.623) (-2273.705) [-2272.945] (-2276.122) * (-2290.003) [-2281.113] (-2287.755) (-2274.482) -- 0:02:35
497500 -- (-2267.768) (-2276.578) [-2273.738] (-2266.430) * (-2279.987) (-2291.088) [-2283.319] (-2274.270) -- 0:02:35
498000 -- (-2276.015) [-2283.210] (-2275.452) (-2292.480) * (-2271.691) (-2270.034) (-2283.821) [-2273.690] -- 0:02:36
498500 -- (-2280.483) (-2277.647) (-2276.147) [-2275.329] * [-2268.116] (-2276.715) (-2277.431) (-2269.469) -- 0:02:35
499000 -- (-2282.598) (-2280.505) (-2272.058) [-2271.432] * (-2276.705) [-2267.562] (-2280.702) (-2282.738) -- 0:02:35
499500 -- [-2276.241] (-2271.305) (-2269.303) (-2277.775) * (-2272.679) [-2281.801] (-2275.135) (-2282.316) -- 0:02:35
500000 -- (-2269.992) (-2276.773) [-2273.629] (-2284.576) * (-2274.781) (-2274.934) [-2268.778] (-2280.729) -- 0:02:35
Average standard deviation of split frequencies: 0.007595
500500 -- [-2268.145] (-2272.484) (-2284.586) (-2265.702) * (-2273.098) (-2281.750) [-2275.497] (-2275.350) -- 0:02:34
501000 -- [-2268.644] (-2281.962) (-2279.298) (-2270.331) * (-2269.810) (-2287.619) (-2284.829) [-2265.757] -- 0:02:34
501500 -- (-2271.117) (-2283.376) (-2272.830) [-2270.568] * (-2274.110) (-2279.193) (-2274.096) [-2269.993] -- 0:02:34
502000 -- (-2278.211) (-2277.491) (-2282.908) [-2263.713] * (-2283.008) (-2271.233) [-2274.566] (-2279.316) -- 0:02:34
502500 -- (-2277.512) (-2297.785) (-2282.102) [-2272.567] * [-2264.667] (-2276.491) (-2278.777) (-2273.830) -- 0:02:34
503000 -- (-2278.766) (-2277.456) [-2277.288] (-2278.908) * (-2284.794) (-2278.517) [-2274.402] (-2271.333) -- 0:02:34
503500 -- (-2288.725) [-2264.213] (-2277.722) (-2275.437) * (-2276.378) [-2268.657] (-2273.489) (-2287.884) -- 0:02:33
504000 -- (-2295.154) (-2280.791) (-2292.438) [-2266.039] * [-2275.161] (-2270.766) (-2283.498) (-2282.253) -- 0:02:33
504500 -- (-2275.170) (-2271.252) (-2287.278) [-2273.300] * (-2276.791) [-2281.239] (-2284.739) (-2283.856) -- 0:02:33
505000 -- (-2284.583) [-2267.052] (-2287.950) (-2267.132) * (-2277.802) (-2266.487) (-2282.642) [-2272.148] -- 0:02:32
Average standard deviation of split frequencies: 0.006956
505500 -- (-2289.793) (-2276.151) (-2271.906) [-2269.325] * [-2271.134] (-2266.221) (-2273.180) (-2271.328) -- 0:02:33
506000 -- (-2277.828) [-2266.781] (-2281.741) (-2284.004) * [-2277.884] (-2270.627) (-2270.617) (-2272.333) -- 0:02:33
506500 -- (-2280.437) [-2278.039] (-2278.330) (-2268.635) * (-2283.515) (-2272.923) [-2272.781] (-2282.848) -- 0:02:32
507000 -- [-2272.086] (-2287.761) (-2279.570) (-2273.709) * (-2279.999) (-2278.946) (-2272.204) [-2275.174] -- 0:02:32
507500 -- (-2287.180) [-2282.906] (-2275.894) (-2283.123) * (-2274.053) (-2279.325) (-2284.405) [-2271.812] -- 0:02:32
508000 -- (-2284.855) [-2275.267] (-2280.731) (-2267.116) * (-2275.735) (-2271.844) (-2283.391) [-2273.447] -- 0:02:32
508500 -- (-2276.600) [-2271.133] (-2272.819) (-2272.856) * (-2273.733) (-2282.213) [-2276.034] (-2272.990) -- 0:02:31
509000 -- (-2284.204) (-2280.252) (-2268.717) [-2272.608] * (-2277.557) [-2285.762] (-2279.194) (-2278.612) -- 0:02:32
509500 -- [-2274.449] (-2273.757) (-2273.518) (-2275.749) * [-2274.320] (-2266.961) (-2276.938) (-2295.671) -- 0:02:32
510000 -- [-2269.878] (-2267.143) (-2276.431) (-2280.505) * [-2273.450] (-2280.947) (-2279.163) (-2278.816) -- 0:02:31
Average standard deviation of split frequencies: 0.007446
510500 -- (-2267.535) [-2275.330] (-2280.603) (-2272.183) * (-2267.062) (-2271.902) (-2278.146) [-2291.070] -- 0:02:31
511000 -- (-2275.094) (-2268.617) [-2274.591] (-2273.255) * (-2274.925) [-2277.114] (-2272.873) (-2271.069) -- 0:02:31
511500 -- [-2267.292] (-2288.428) (-2269.882) (-2266.841) * (-2281.839) (-2274.159) (-2279.985) [-2268.163] -- 0:02:30
512000 -- (-2278.964) [-2277.360] (-2276.275) (-2274.147) * (-2283.936) [-2270.286] (-2275.151) (-2287.280) -- 0:02:30
512500 -- [-2267.845] (-2278.628) (-2284.985) (-2283.188) * (-2289.109) [-2276.425] (-2278.811) (-2288.204) -- 0:02:31
513000 -- (-2275.293) (-2290.420) [-2284.341] (-2267.930) * (-2278.040) (-2273.565) [-2266.651] (-2283.353) -- 0:02:30
513500 -- (-2275.567) (-2280.429) (-2275.439) [-2268.718] * (-2268.639) (-2282.139) [-2261.892] (-2276.956) -- 0:02:30
514000 -- [-2270.927] (-2284.037) (-2275.598) (-2287.695) * (-2276.588) [-2278.407] (-2265.707) (-2282.650) -- 0:02:30
514500 -- (-2270.781) (-2271.848) [-2283.509] (-2293.951) * (-2263.701) (-2291.848) [-2268.786] (-2274.261) -- 0:02:30
515000 -- (-2280.586) (-2281.711) [-2281.388] (-2274.111) * [-2267.785] (-2288.867) (-2271.844) (-2279.233) -- 0:02:29
Average standard deviation of split frequencies: 0.006578
515500 -- (-2285.423) [-2270.398] (-2284.544) (-2274.044) * [-2267.287] (-2273.402) (-2280.189) (-2273.658) -- 0:02:30
516000 -- [-2273.660] (-2276.238) (-2283.708) (-2275.278) * (-2272.145) [-2268.448] (-2284.198) (-2273.680) -- 0:02:30
516500 -- (-2273.950) (-2281.745) (-2285.299) [-2280.373] * [-2271.696] (-2276.132) (-2278.859) (-2278.491) -- 0:02:29
517000 -- (-2269.703) (-2286.679) (-2265.959) [-2276.992] * [-2281.480] (-2272.393) (-2273.323) (-2281.332) -- 0:02:29
517500 -- (-2273.799) (-2273.001) (-2272.096) [-2266.650] * [-2274.220] (-2279.058) (-2269.860) (-2277.303) -- 0:02:29
518000 -- (-2279.345) [-2269.271] (-2286.032) (-2281.360) * (-2273.771) (-2282.230) [-2269.767] (-2277.179) -- 0:02:28
518500 -- [-2263.731] (-2275.319) (-2275.512) (-2280.411) * [-2276.845] (-2298.728) (-2276.591) (-2278.189) -- 0:02:29
519000 -- [-2268.223] (-2272.675) (-2274.001) (-2275.382) * (-2273.936) (-2284.458) (-2277.129) [-2272.169] -- 0:02:29
519500 -- (-2276.530) [-2272.645] (-2273.457) (-2283.724) * (-2277.688) (-2288.650) (-2269.664) [-2271.349] -- 0:02:28
520000 -- (-2280.544) (-2274.176) [-2269.861] (-2277.718) * [-2269.161] (-2282.356) (-2280.560) (-2281.329) -- 0:02:28
Average standard deviation of split frequencies: 0.006157
520500 -- (-2288.279) (-2271.992) [-2271.486] (-2265.370) * (-2268.891) [-2274.991] (-2274.192) (-2282.399) -- 0:02:28
521000 -- (-2276.236) [-2271.119] (-2276.846) (-2281.502) * (-2271.873) (-2282.754) (-2277.845) [-2269.259] -- 0:02:28
521500 -- (-2281.083) (-2274.543) (-2270.765) [-2267.972] * (-2276.714) (-2275.163) [-2272.891] (-2280.425) -- 0:02:27
522000 -- (-2273.367) (-2275.045) (-2279.098) [-2271.452] * (-2287.402) (-2280.378) (-2284.225) [-2281.596] -- 0:02:28
522500 -- [-2274.120] (-2270.548) (-2266.669) (-2275.713) * (-2270.038) (-2274.588) (-2279.123) [-2274.375] -- 0:02:28
523000 -- (-2272.455) (-2277.623) (-2274.448) [-2271.150] * (-2277.286) [-2267.159] (-2283.032) (-2270.458) -- 0:02:27
523500 -- (-2281.084) (-2274.496) (-2273.187) [-2269.396] * (-2276.608) (-2283.759) [-2266.784] (-2275.270) -- 0:02:27
524000 -- (-2283.809) (-2268.579) (-2276.576) [-2268.748] * (-2283.057) (-2272.122) [-2263.363] (-2281.260) -- 0:02:27
524500 -- (-2285.504) (-2273.978) [-2278.482] (-2277.856) * (-2282.593) (-2285.139) (-2278.256) [-2277.733] -- 0:02:26
525000 -- (-2278.428) (-2278.260) (-2283.853) [-2266.676] * (-2278.459) (-2286.001) (-2273.897) [-2265.140] -- 0:02:26
Average standard deviation of split frequencies: 0.007050
525500 -- (-2268.534) (-2281.277) (-2272.811) [-2275.619] * (-2274.761) [-2279.342] (-2282.532) (-2269.846) -- 0:02:27
526000 -- (-2269.886) (-2290.849) [-2275.674] (-2271.358) * (-2277.606) (-2279.679) (-2276.761) [-2269.465] -- 0:02:26
526500 -- (-2268.667) (-2288.011) [-2274.037] (-2274.326) * [-2282.489] (-2268.915) (-2279.087) (-2280.984) -- 0:02:26
527000 -- [-2271.568] (-2290.795) (-2282.510) (-2281.764) * (-2273.395) (-2270.385) (-2270.821) [-2272.277] -- 0:02:26
527500 -- (-2272.665) (-2264.671) [-2270.433] (-2281.396) * (-2275.595) (-2294.990) [-2268.353] (-2289.824) -- 0:02:26
528000 -- (-2286.745) [-2270.224] (-2271.641) (-2280.396) * [-2273.927] (-2283.428) (-2272.342) (-2280.573) -- 0:02:25
528500 -- [-2274.738] (-2282.029) (-2269.080) (-2278.699) * (-2278.988) [-2271.096] (-2269.207) (-2283.857) -- 0:02:25
529000 -- (-2277.800) (-2273.582) (-2280.652) [-2276.008] * (-2268.416) (-2269.818) (-2273.099) [-2281.694] -- 0:02:26
529500 -- [-2267.053] (-2282.236) (-2274.453) (-2286.145) * (-2282.359) (-2278.842) (-2283.798) [-2282.495] -- 0:02:25
530000 -- (-2270.027) [-2277.743] (-2276.994) (-2279.420) * [-2268.168] (-2274.945) (-2284.501) (-2277.913) -- 0:02:25
Average standard deviation of split frequencies: 0.007936
530500 -- (-2269.640) [-2278.766] (-2295.001) (-2269.992) * (-2276.219) (-2280.462) (-2284.744) [-2267.453] -- 0:02:25
531000 -- (-2278.892) [-2274.276] (-2276.842) (-2272.049) * (-2282.821) [-2274.711] (-2274.489) (-2275.586) -- 0:02:24
531500 -- [-2275.091] (-2280.624) (-2280.276) (-2283.573) * [-2274.014] (-2279.886) (-2272.091) (-2269.207) -- 0:02:24
532000 -- (-2273.812) (-2280.984) [-2277.411] (-2269.114) * (-2287.841) (-2281.797) [-2269.558] (-2271.135) -- 0:02:24
532500 -- (-2287.551) (-2278.121) (-2290.113) [-2276.278] * (-2290.063) (-2277.632) [-2269.862] (-2279.162) -- 0:02:24
533000 -- (-2283.331) [-2262.364] (-2274.176) (-2283.785) * (-2278.799) (-2272.001) (-2280.615) [-2267.213] -- 0:02:24
533500 -- (-2275.790) (-2278.882) (-2279.129) [-2269.734] * (-2281.863) (-2274.030) [-2271.813] (-2283.531) -- 0:02:24
534000 -- (-2278.166) [-2265.284] (-2265.644) (-2274.095) * (-2281.911) (-2267.946) [-2273.161] (-2281.080) -- 0:02:23
534500 -- (-2277.455) (-2293.952) (-2278.747) [-2268.006] * [-2268.463] (-2281.550) (-2284.472) (-2277.799) -- 0:02:23
535000 -- (-2269.540) (-2281.374) (-2286.323) [-2277.887] * (-2275.592) (-2276.659) (-2277.188) [-2267.882] -- 0:02:23
Average standard deviation of split frequencies: 0.007153
535500 -- (-2277.534) (-2281.371) [-2268.601] (-2279.840) * (-2267.726) [-2269.912] (-2278.306) (-2268.785) -- 0:02:23
536000 -- (-2282.238) (-2290.005) (-2281.782) [-2274.680] * [-2274.424] (-2273.314) (-2270.089) (-2276.827) -- 0:02:23
536500 -- (-2281.679) (-2290.478) [-2278.142] (-2275.955) * (-2291.689) (-2272.568) (-2284.828) [-2271.058] -- 0:02:23
537000 -- (-2268.000) (-2275.300) (-2279.796) [-2262.453] * (-2279.611) [-2277.808] (-2271.992) (-2292.233) -- 0:02:23
537500 -- (-2281.093) [-2269.840] (-2276.428) (-2278.946) * (-2278.951) [-2269.581] (-2279.786) (-2275.200) -- 0:02:22
538000 -- (-2278.409) (-2275.690) (-2278.563) [-2286.627] * (-2272.840) [-2278.312] (-2276.824) (-2278.448) -- 0:02:22
538500 -- (-2277.862) (-2266.123) (-2276.619) [-2273.985] * (-2279.363) [-2267.016] (-2281.279) (-2290.153) -- 0:02:22
539000 -- (-2271.757) (-2272.828) (-2277.781) [-2271.595] * (-2284.877) (-2274.259) (-2292.505) [-2274.419] -- 0:02:22
539500 -- (-2274.957) [-2277.051] (-2280.678) (-2271.996) * (-2270.238) [-2270.057] (-2289.821) (-2276.250) -- 0:02:22
540000 -- (-2281.502) (-2276.890) (-2278.655) [-2274.543] * [-2271.496] (-2280.916) (-2287.810) (-2282.150) -- 0:02:22
Average standard deviation of split frequencies: 0.007324
540500 -- (-2286.564) [-2279.031] (-2275.338) (-2268.751) * [-2268.352] (-2270.748) (-2277.853) (-2266.235) -- 0:02:21
541000 -- (-2275.326) (-2280.508) [-2276.125] (-2269.756) * (-2283.408) [-2277.580] (-2285.192) (-2280.979) -- 0:02:21
541500 -- (-2271.953) (-2278.500) [-2271.610] (-2270.310) * (-2287.923) [-2268.135] (-2273.497) (-2267.976) -- 0:02:21
542000 -- [-2269.356] (-2279.099) (-2278.943) (-2285.707) * (-2284.675) [-2268.561] (-2273.818) (-2281.770) -- 0:02:21
542500 -- (-2282.641) [-2270.621] (-2285.692) (-2277.233) * (-2279.690) (-2283.849) (-2267.971) [-2263.135] -- 0:02:21
543000 -- (-2276.791) (-2275.172) [-2279.811] (-2285.726) * (-2276.250) (-2275.635) (-2279.973) [-2273.297] -- 0:02:21
543500 -- [-2265.342] (-2273.960) (-2279.650) (-2277.133) * (-2282.605) [-2274.141] (-2285.469) (-2271.722) -- 0:02:21
544000 -- (-2273.556) [-2281.225] (-2276.114) (-2284.402) * (-2286.978) [-2264.486] (-2271.212) (-2278.276) -- 0:02:20
544500 -- (-2280.755) [-2280.483] (-2275.286) (-2277.862) * (-2278.527) [-2277.563] (-2283.611) (-2273.660) -- 0:02:20
545000 -- (-2289.429) (-2288.609) (-2278.155) [-2267.530] * (-2279.974) [-2268.926] (-2276.874) (-2272.342) -- 0:02:20
Average standard deviation of split frequencies: 0.007598
545500 -- [-2278.871] (-2271.177) (-2273.182) (-2275.527) * (-2271.136) (-2276.536) [-2271.032] (-2285.276) -- 0:02:19
546000 -- [-2275.776] (-2273.321) (-2276.946) (-2271.144) * (-2275.500) (-2272.324) [-2269.038] (-2287.699) -- 0:02:20
546500 -- [-2274.810] (-2276.595) (-2271.705) (-2284.255) * (-2276.969) (-2275.270) (-2263.458) [-2268.540] -- 0:02:20
547000 -- (-2272.360) [-2277.786] (-2272.379) (-2281.159) * (-2275.112) (-2275.514) [-2271.705] (-2275.512) -- 0:02:19
547500 -- (-2282.972) (-2292.501) [-2272.409] (-2269.751) * (-2296.834) (-2280.795) (-2280.733) [-2276.756] -- 0:02:19
548000 -- (-2277.208) (-2274.860) [-2263.955] (-2292.381) * (-2281.678) [-2270.533] (-2277.523) (-2274.259) -- 0:02:19
548500 -- (-2277.010) (-2278.598) [-2273.531] (-2286.103) * (-2299.687) (-2272.725) (-2271.694) [-2275.115] -- 0:02:19
549000 -- (-2273.122) (-2276.768) (-2277.469) [-2282.133] * (-2285.827) [-2275.796] (-2274.178) (-2280.843) -- 0:02:19
549500 -- [-2272.410] (-2276.084) (-2271.635) (-2277.476) * (-2278.297) (-2268.664) (-2280.308) [-2268.482] -- 0:02:19
550000 -- (-2271.432) [-2281.370] (-2275.318) (-2285.768) * (-2286.284) [-2266.462] (-2275.800) (-2274.745) -- 0:02:19
Average standard deviation of split frequencies: 0.008047
550500 -- (-2278.312) (-2269.486) (-2281.585) [-2280.233] * [-2272.860] (-2283.568) (-2275.992) (-2283.015) -- 0:02:18
551000 -- (-2277.586) (-2280.232) [-2276.764] (-2281.727) * (-2270.752) (-2290.932) [-2275.368] (-2277.565) -- 0:02:18
551500 -- (-2278.826) [-2272.712] (-2280.245) (-2276.462) * [-2275.616] (-2282.941) (-2274.889) (-2276.953) -- 0:02:18
552000 -- [-2274.133] (-2272.543) (-2277.687) (-2274.658) * (-2277.161) [-2269.189] (-2278.300) (-2271.818) -- 0:02:18
552500 -- [-2264.439] (-2271.218) (-2267.683) (-2291.539) * (-2290.809) (-2275.964) (-2281.663) [-2267.971] -- 0:02:18
553000 -- (-2270.560) (-2279.943) [-2265.331] (-2276.312) * (-2275.166) (-2282.429) (-2276.683) [-2270.771] -- 0:02:18
553500 -- (-2266.599) (-2277.551) (-2276.105) [-2264.995] * [-2287.163] (-2277.869) (-2274.877) (-2278.857) -- 0:02:17
554000 -- [-2270.243] (-2270.348) (-2277.086) (-2272.499) * (-2282.330) [-2277.667] (-2277.127) (-2280.942) -- 0:02:17
554500 -- (-2269.675) (-2271.025) (-2274.718) [-2270.418] * [-2272.873] (-2277.720) (-2279.038) (-2278.426) -- 0:02:17
555000 -- (-2277.574) [-2279.212] (-2279.696) (-2285.642) * (-2279.388) (-2279.025) (-2282.106) [-2277.719] -- 0:02:17
Average standard deviation of split frequencies: 0.007687
555500 -- (-2270.985) (-2279.486) [-2272.126] (-2279.463) * (-2264.219) (-2274.398) (-2275.649) [-2283.650] -- 0:02:17
556000 -- (-2278.463) (-2268.888) (-2275.223) [-2262.202] * (-2281.972) [-2270.133] (-2272.519) (-2282.498) -- 0:02:17
556500 -- [-2269.303] (-2287.480) (-2269.588) (-2270.448) * (-2279.341) (-2270.838) [-2272.526] (-2276.563) -- 0:02:17
557000 -- [-2269.708] (-2282.931) (-2280.838) (-2274.793) * (-2284.985) (-2280.012) [-2268.301] (-2290.158) -- 0:02:16
557500 -- (-2280.676) (-2278.982) (-2276.304) [-2266.332] * [-2275.967] (-2267.885) (-2280.109) (-2278.555) -- 0:02:16
558000 -- (-2270.813) (-2289.536) [-2271.549] (-2273.538) * (-2272.170) [-2270.994] (-2275.776) (-2275.924) -- 0:02:16
558500 -- (-2279.737) (-2294.345) (-2278.295) [-2274.759] * (-2289.382) (-2271.763) [-2273.268] (-2278.820) -- 0:02:15
559000 -- (-2265.281) (-2284.646) (-2292.252) [-2272.804] * [-2275.333] (-2270.191) (-2272.943) (-2283.133) -- 0:02:16
559500 -- (-2277.492) (-2286.545) (-2293.182) [-2275.541] * (-2271.293) (-2273.128) [-2267.608] (-2278.942) -- 0:02:16
560000 -- (-2275.247) [-2271.916] (-2279.990) (-2282.623) * (-2275.708) (-2277.752) [-2279.470] (-2281.158) -- 0:02:15
Average standard deviation of split frequencies: 0.007847
560500 -- (-2275.092) (-2281.518) (-2280.020) [-2270.326] * [-2264.735] (-2283.704) (-2278.426) (-2281.542) -- 0:02:15
561000 -- (-2273.270) (-2279.027) (-2278.979) [-2268.892] * (-2278.639) (-2283.429) [-2274.107] (-2275.116) -- 0:02:15
561500 -- (-2278.021) (-2288.197) [-2272.817] (-2266.472) * (-2276.202) (-2284.767) (-2287.786) [-2275.483] -- 0:02:15
562000 -- (-2295.481) (-2290.256) (-2279.760) [-2271.643] * [-2267.569] (-2267.486) (-2278.635) (-2290.047) -- 0:02:14
562500 -- (-2274.630) (-2276.495) (-2280.550) [-2273.901] * (-2276.709) [-2280.639] (-2270.984) (-2283.960) -- 0:02:15
563000 -- (-2276.509) (-2271.911) [-2273.740] (-2273.882) * [-2269.179] (-2282.023) (-2272.753) (-2282.079) -- 0:02:15
563500 -- (-2274.252) (-2296.972) [-2276.072] (-2273.586) * (-2272.902) (-2271.985) (-2284.297) [-2271.462] -- 0:02:14
564000 -- [-2268.407] (-2287.434) (-2275.309) (-2274.970) * (-2273.552) [-2275.874] (-2284.089) (-2276.685) -- 0:02:14
564500 -- (-2271.505) (-2285.882) (-2275.172) [-2266.374] * (-2282.911) [-2282.404] (-2276.367) (-2274.416) -- 0:02:14
565000 -- (-2268.368) (-2283.859) (-2275.529) [-2272.256] * (-2277.518) (-2281.737) [-2275.035] (-2282.255) -- 0:02:13
Average standard deviation of split frequencies: 0.008440
565500 -- [-2275.820] (-2281.411) (-2270.358) (-2278.734) * (-2273.689) (-2278.350) (-2267.877) [-2279.298] -- 0:02:14
566000 -- (-2270.867) (-2271.575) (-2283.044) [-2277.204] * (-2282.910) (-2278.693) (-2283.468) [-2270.004] -- 0:02:14
566500 -- (-2288.591) (-2271.798) [-2267.317] (-2283.903) * [-2272.075] (-2290.929) (-2277.082) (-2276.297) -- 0:02:13
567000 -- (-2279.902) (-2271.434) [-2265.333] (-2282.039) * [-2269.922] (-2282.375) (-2279.192) (-2278.361) -- 0:02:13
567500 -- [-2278.762] (-2282.750) (-2280.931) (-2279.520) * (-2277.251) (-2297.365) (-2280.433) [-2273.857] -- 0:02:13
568000 -- (-2283.752) (-2278.725) [-2273.196] (-2275.140) * (-2286.271) (-2275.572) (-2281.488) [-2273.143] -- 0:02:13
568500 -- (-2276.588) (-2286.280) (-2265.790) [-2275.154] * (-2285.655) [-2272.122] (-2282.681) (-2273.199) -- 0:02:13
569000 -- (-2283.151) (-2284.832) [-2272.096] (-2272.718) * (-2280.595) (-2266.562) (-2269.997) [-2274.777] -- 0:02:13
569500 -- (-2284.195) (-2280.322) (-2274.938) [-2272.628] * (-2272.865) (-2275.156) [-2285.113] (-2281.226) -- 0:02:13
570000 -- (-2280.195) (-2271.795) (-2285.746) [-2269.833] * (-2270.868) (-2275.902) [-2272.677] (-2278.480) -- 0:02:12
Average standard deviation of split frequencies: 0.009032
570500 -- (-2291.320) (-2277.973) [-2271.980] (-2272.452) * (-2267.687) [-2272.398] (-2279.314) (-2279.136) -- 0:02:12
571000 -- (-2281.880) (-2276.599) [-2277.715] (-2270.261) * (-2286.895) (-2273.036) [-2273.112] (-2291.350) -- 0:02:12
571500 -- [-2269.505] (-2288.156) (-2282.749) (-2271.900) * [-2276.493] (-2275.264) (-2285.443) (-2271.926) -- 0:02:11
572000 -- (-2266.869) (-2277.718) (-2286.847) [-2270.501] * (-2282.751) [-2275.582] (-2280.328) (-2278.173) -- 0:02:12
572500 -- (-2281.539) (-2276.378) (-2283.301) [-2269.663] * (-2273.981) [-2269.032] (-2276.893) (-2274.561) -- 0:02:12
573000 -- [-2277.824] (-2272.708) (-2297.944) (-2281.198) * (-2273.624) (-2268.460) (-2274.945) [-2284.967] -- 0:02:11
573500 -- (-2277.437) [-2276.787] (-2287.328) (-2271.474) * [-2273.478] (-2291.673) (-2278.456) (-2273.144) -- 0:02:11
574000 -- (-2285.697) [-2270.905] (-2282.995) (-2283.499) * [-2272.503] (-2277.754) (-2280.225) (-2271.128) -- 0:02:11
574500 -- [-2271.964] (-2271.091) (-2279.691) (-2268.554) * (-2279.619) [-2267.466] (-2282.964) (-2280.239) -- 0:02:11
575000 -- [-2265.674] (-2275.175) (-2283.369) (-2272.637) * (-2290.093) (-2280.706) [-2276.451] (-2285.231) -- 0:02:10
Average standard deviation of split frequencies: 0.009821
575500 -- (-2285.465) [-2275.113] (-2286.656) (-2282.958) * (-2278.210) [-2267.321] (-2272.861) (-2277.400) -- 0:02:11
576000 -- (-2279.038) [-2274.420] (-2283.428) (-2271.754) * (-2286.339) (-2276.911) (-2284.346) [-2268.698] -- 0:02:11
576500 -- (-2275.841) (-2273.613) (-2279.788) [-2269.296] * (-2282.545) (-2276.964) (-2284.777) [-2268.096] -- 0:02:10
577000 -- (-2285.813) (-2276.198) (-2282.444) [-2289.073] * (-2277.782) (-2268.427) [-2280.148] (-2274.048) -- 0:02:10
577500 -- (-2276.691) (-2277.874) (-2282.912) [-2269.302] * (-2281.355) [-2277.331] (-2279.505) (-2283.228) -- 0:02:10
578000 -- [-2274.593] (-2279.921) (-2294.375) (-2276.587) * (-2279.452) (-2283.429) [-2281.975] (-2283.570) -- 0:02:09
578500 -- (-2276.938) (-2275.267) (-2278.925) [-2268.107] * (-2281.531) (-2281.757) [-2275.507] (-2282.760) -- 0:02:09
579000 -- (-2274.023) [-2274.295] (-2275.095) (-2280.589) * (-2267.211) (-2280.819) [-2276.603] (-2285.017) -- 0:02:09
579500 -- [-2268.294] (-2277.139) (-2270.863) (-2270.950) * (-2282.380) (-2269.205) (-2286.988) [-2279.857] -- 0:02:09
580000 -- [-2274.931] (-2279.839) (-2268.146) (-2271.255) * (-2271.724) (-2279.719) [-2274.500] (-2283.892) -- 0:02:09
Average standard deviation of split frequencies: 0.009038
580500 -- (-2279.649) (-2272.776) (-2272.866) [-2270.995] * (-2289.244) [-2267.810] (-2278.104) (-2274.141) -- 0:02:09
581000 -- [-2273.818] (-2272.223) (-2277.190) (-2283.844) * (-2283.435) [-2272.341] (-2280.992) (-2266.396) -- 0:02:09
581500 -- [-2269.257] (-2275.798) (-2285.257) (-2275.828) * (-2268.153) (-2269.535) [-2269.990] (-2279.412) -- 0:02:08
582000 -- (-2272.291) [-2276.162] (-2280.902) (-2286.007) * (-2284.457) (-2267.390) [-2273.795] (-2278.842) -- 0:02:08
582500 -- (-2274.731) [-2276.546] (-2276.974) (-2282.063) * [-2274.853] (-2277.250) (-2284.303) (-2283.581) -- 0:02:08
583000 -- [-2276.196] (-2275.068) (-2281.758) (-2273.105) * (-2278.509) (-2278.517) (-2277.326) [-2270.557] -- 0:02:08
583500 -- (-2274.594) [-2272.944] (-2271.078) (-2275.498) * (-2274.680) (-2278.396) [-2270.399] (-2289.201) -- 0:02:08
584000 -- [-2273.815] (-2294.537) (-2275.157) (-2283.959) * [-2268.449] (-2268.710) (-2277.667) (-2278.872) -- 0:02:08
584500 -- (-2281.960) (-2292.658) [-2277.423] (-2280.586) * (-2277.122) (-2277.795) (-2277.987) [-2276.493] -- 0:02:07
585000 -- (-2271.955) (-2273.789) [-2275.924] (-2282.732) * (-2279.755) (-2275.283) [-2278.894] (-2276.649) -- 0:02:07
Average standard deviation of split frequencies: 0.010190
585500 -- [-2275.910] (-2283.077) (-2286.385) (-2278.903) * (-2270.987) (-2275.782) (-2274.000) [-2274.397] -- 0:02:07
586000 -- [-2271.090] (-2282.951) (-2275.453) (-2268.258) * [-2270.516] (-2272.214) (-2273.952) (-2273.534) -- 0:02:07
586500 -- (-2283.466) (-2269.816) [-2269.474] (-2277.886) * (-2287.313) [-2281.274] (-2289.889) (-2276.080) -- 0:02:07
587000 -- (-2271.539) (-2273.874) (-2278.680) [-2271.029] * (-2275.004) [-2269.029] (-2277.788) (-2280.737) -- 0:02:07
587500 -- (-2275.265) [-2267.290] (-2274.507) (-2287.883) * (-2281.360) [-2268.029] (-2277.892) (-2270.121) -- 0:02:07
588000 -- (-2278.976) (-2266.453) (-2287.805) [-2271.720] * (-2284.473) [-2276.493] (-2270.152) (-2271.237) -- 0:02:06
588500 -- (-2273.294) [-2268.999] (-2281.202) (-2271.244) * (-2278.075) (-2276.565) [-2274.640] (-2263.870) -- 0:02:06
589000 -- (-2284.331) (-2287.580) (-2279.078) [-2273.822] * (-2276.859) [-2266.850] (-2273.410) (-2265.498) -- 0:02:06
589500 -- (-2279.687) (-2270.592) (-2280.261) [-2269.697] * (-2279.185) (-2269.703) [-2274.205] (-2276.497) -- 0:02:06
590000 -- (-2276.634) (-2281.277) [-2269.544] (-2276.228) * (-2277.544) (-2275.799) (-2271.962) [-2266.100] -- 0:02:06
Average standard deviation of split frequencies: 0.009843
590500 -- (-2279.811) [-2279.093] (-2276.407) (-2270.636) * (-2278.798) (-2275.247) (-2276.448) [-2267.113] -- 0:02:06
591000 -- (-2276.121) (-2269.608) [-2267.544] (-2282.084) * (-2282.628) (-2276.525) [-2278.825] (-2276.759) -- 0:02:05
591500 -- (-2283.496) (-2276.801) [-2268.850] (-2269.096) * [-2271.298] (-2280.917) (-2273.202) (-2275.300) -- 0:02:05
592000 -- (-2284.215) (-2271.566) (-2269.266) [-2267.674] * (-2286.962) [-2271.186] (-2273.055) (-2276.451) -- 0:02:05
592500 -- (-2273.429) (-2270.997) (-2289.781) [-2265.863] * (-2279.907) (-2275.034) (-2276.674) [-2274.404] -- 0:02:05
593000 -- [-2271.917] (-2281.847) (-2270.321) (-2263.031) * (-2283.534) (-2276.687) (-2280.361) [-2279.154] -- 0:02:04
593500 -- (-2288.919) [-2279.182] (-2289.350) (-2275.876) * (-2285.254) (-2279.981) (-2285.194) [-2276.284] -- 0:02:05
594000 -- (-2282.439) (-2273.474) (-2277.454) [-2280.601] * (-2276.656) (-2272.073) [-2267.451] (-2275.728) -- 0:02:05
594500 -- (-2274.017) (-2274.879) (-2269.075) [-2270.533] * [-2273.971] (-2286.994) (-2280.639) (-2266.373) -- 0:02:04
595000 -- (-2272.404) (-2281.622) [-2268.803] (-2295.245) * (-2291.132) [-2277.668] (-2273.421) (-2284.196) -- 0:02:04
Average standard deviation of split frequencies: 0.009017
595500 -- [-2274.116] (-2283.277) (-2275.255) (-2291.082) * (-2290.589) (-2284.344) [-2275.099] (-2271.965) -- 0:02:04
596000 -- (-2273.125) (-2272.262) [-2283.796] (-2279.630) * (-2279.120) (-2279.446) [-2272.980] (-2275.645) -- 0:02:04
596500 -- [-2268.565] (-2274.931) (-2283.278) (-2292.824) * [-2281.448] (-2283.321) (-2284.505) (-2267.301) -- 0:02:03
597000 -- [-2281.883] (-2276.973) (-2280.902) (-2273.023) * [-2276.517] (-2277.352) (-2274.477) (-2274.819) -- 0:02:04
597500 -- (-2272.056) (-2277.037) (-2271.816) [-2271.390] * (-2278.215) (-2277.122) [-2278.844] (-2273.932) -- 0:02:03
598000 -- (-2272.179) (-2279.016) [-2277.958] (-2276.653) * (-2283.080) (-2265.619) [-2274.446] (-2278.338) -- 0:02:03
598500 -- (-2289.192) (-2272.288) [-2277.300] (-2267.865) * (-2276.263) (-2283.186) (-2267.476) [-2273.035] -- 0:02:03
599000 -- [-2268.653] (-2268.333) (-2269.243) (-2263.887) * (-2292.270) (-2271.214) (-2278.557) [-2271.105] -- 0:02:03
599500 -- (-2272.143) (-2280.367) (-2275.934) [-2273.528] * (-2287.705) (-2284.647) [-2276.559] (-2272.737) -- 0:02:02
600000 -- [-2271.216] (-2269.230) (-2268.937) (-2276.222) * (-2275.655) (-2268.578) [-2270.286] (-2277.530) -- 0:02:03
Average standard deviation of split frequencies: 0.010098
600500 -- (-2265.911) [-2264.938] (-2283.033) (-2271.430) * (-2284.546) (-2283.321) [-2265.627] (-2277.990) -- 0:02:03
601000 -- (-2270.630) [-2265.776] (-2272.950) (-2273.021) * [-2278.582] (-2265.895) (-2285.600) (-2282.651) -- 0:02:02
601500 -- (-2279.916) (-2280.095) [-2274.942] (-2273.099) * [-2268.085] (-2275.081) (-2281.046) (-2280.226) -- 0:02:02
602000 -- (-2277.917) [-2279.236] (-2269.299) (-2271.890) * (-2270.394) [-2269.851] (-2292.274) (-2285.075) -- 0:02:02
602500 -- (-2284.522) (-2290.929) [-2272.766] (-2282.339) * (-2272.079) [-2271.812] (-2293.608) (-2281.387) -- 0:02:02
603000 -- [-2267.670] (-2278.412) (-2278.120) (-2282.510) * (-2269.147) [-2267.608] (-2275.491) (-2277.053) -- 0:02:02
603500 -- (-2267.337) (-2272.389) [-2264.074] (-2273.761) * [-2267.573] (-2277.460) (-2286.058) (-2278.834) -- 0:02:02
604000 -- (-2277.188) (-2283.216) (-2267.642) [-2267.007] * (-2273.516) [-2272.142] (-2285.075) (-2268.886) -- 0:02:01
604500 -- [-2274.335] (-2275.765) (-2275.806) (-2275.202) * (-2276.778) [-2284.489] (-2276.769) (-2281.564) -- 0:02:01
605000 -- (-2266.154) (-2270.374) (-2276.763) [-2279.135] * [-2267.130] (-2271.535) (-2284.341) (-2273.569) -- 0:02:01
Average standard deviation of split frequencies: 0.010891
605500 -- (-2278.439) [-2276.113] (-2282.731) (-2278.918) * (-2278.478) (-2286.522) (-2289.093) [-2276.727] -- 0:02:01
606000 -- (-2279.567) (-2276.294) [-2266.329] (-2272.312) * (-2279.410) (-2272.525) (-2277.390) [-2274.499] -- 0:02:01
606500 -- [-2271.412] (-2286.736) (-2281.344) (-2268.329) * (-2280.918) [-2272.747] (-2276.925) (-2281.776) -- 0:02:01
607000 -- (-2285.273) (-2273.471) [-2277.526] (-2270.696) * (-2279.546) (-2267.545) (-2287.611) [-2275.009] -- 0:02:01
607500 -- (-2273.699) (-2281.684) [-2273.077] (-2281.239) * (-2282.969) [-2272.803] (-2290.308) (-2271.424) -- 0:02:00
608000 -- (-2280.726) [-2274.805] (-2283.694) (-2274.447) * (-2270.807) (-2278.488) [-2269.961] (-2278.096) -- 0:02:00
608500 -- [-2272.338] (-2269.749) (-2279.640) (-2272.499) * (-2276.641) (-2271.130) [-2274.304] (-2274.884) -- 0:02:00
609000 -- (-2275.605) (-2274.442) [-2273.849] (-2282.108) * (-2273.321) [-2265.368] (-2279.682) (-2277.912) -- 0:02:00
609500 -- [-2274.636] (-2269.135) (-2280.242) (-2276.217) * (-2280.032) (-2272.349) (-2273.801) [-2278.223] -- 0:02:00
610000 -- (-2273.849) (-2281.553) [-2279.192] (-2295.860) * [-2271.834] (-2283.878) (-2269.890) (-2280.662) -- 0:02:00
Average standard deviation of split frequencies: 0.011373
610500 -- (-2278.523) (-2267.628) [-2267.281] (-2290.633) * (-2278.562) (-2272.629) [-2265.259] (-2276.462) -- 0:01:59
611000 -- (-2289.013) (-2271.819) (-2274.604) [-2278.255] * (-2268.909) (-2271.418) [-2280.828] (-2273.543) -- 0:01:59
611500 -- (-2293.072) (-2276.203) (-2273.162) [-2277.575] * (-2278.614) (-2266.981) (-2284.297) [-2278.868] -- 0:02:00
612000 -- (-2278.265) (-2286.689) [-2273.297] (-2268.625) * (-2274.465) [-2270.317] (-2277.837) (-2286.276) -- 0:01:59
612500 -- (-2286.089) (-2278.598) [-2277.752] (-2272.150) * (-2264.834) (-2274.106) (-2273.399) [-2271.800] -- 0:01:59
613000 -- (-2281.847) (-2277.585) [-2271.229] (-2294.171) * [-2270.569] (-2276.724) (-2282.828) (-2283.073) -- 0:01:59
613500 -- (-2269.291) [-2276.524] (-2274.888) (-2275.021) * [-2271.401] (-2279.846) (-2279.173) (-2275.949) -- 0:01:59
614000 -- [-2263.267] (-2287.208) (-2280.791) (-2283.356) * [-2266.393] (-2279.030) (-2275.541) (-2275.661) -- 0:01:58
614500 -- (-2272.559) (-2289.739) (-2278.617) [-2275.294] * (-2273.793) (-2268.886) (-2271.492) [-2272.986] -- 0:01:58
615000 -- (-2274.168) (-2294.759) (-2275.150) [-2280.217] * [-2271.809] (-2276.775) (-2284.565) (-2281.586) -- 0:01:58
Average standard deviation of split frequencies: 0.011632
615500 -- [-2276.906] (-2274.898) (-2291.720) (-2287.208) * (-2277.196) (-2288.411) [-2265.016] (-2269.553) -- 0:01:58
616000 -- [-2270.024] (-2270.257) (-2270.917) (-2278.938) * (-2281.884) (-2280.532) [-2272.694] (-2281.535) -- 0:01:58
616500 -- (-2267.994) (-2280.389) [-2271.254] (-2268.614) * [-2269.019] (-2277.598) (-2273.329) (-2291.921) -- 0:01:58
617000 -- (-2276.198) (-2275.403) [-2269.621] (-2280.475) * (-2285.693) (-2279.327) [-2269.999] (-2276.520) -- 0:01:57
617500 -- (-2275.981) (-2281.016) [-2277.437] (-2279.161) * (-2286.715) [-2280.944] (-2272.702) (-2272.785) -- 0:01:57
618000 -- (-2278.278) [-2271.421] (-2272.777) (-2270.641) * (-2278.715) (-2283.182) [-2272.723] (-2275.499) -- 0:01:57
618500 -- (-2278.371) [-2271.923] (-2267.456) (-2272.940) * (-2285.339) (-2273.053) (-2272.227) [-2275.481] -- 0:01:57
619000 -- [-2267.368] (-2273.977) (-2270.139) (-2285.188) * (-2277.820) [-2275.534] (-2279.017) (-2264.894) -- 0:01:57
619500 -- [-2276.674] (-2272.802) (-2273.600) (-2274.188) * (-2288.011) [-2280.462] (-2276.164) (-2272.010) -- 0:01:57
620000 -- (-2279.616) (-2278.035) (-2278.095) [-2270.455] * (-2278.364) (-2276.199) (-2275.614) [-2275.826] -- 0:01:57
Average standard deviation of split frequencies: 0.012304
620500 -- (-2278.974) (-2280.500) (-2278.362) [-2266.583] * (-2275.339) (-2270.444) [-2273.983] (-2282.470) -- 0:01:56
621000 -- (-2275.272) (-2277.311) [-2272.951] (-2278.304) * (-2275.824) [-2271.100] (-2270.704) (-2279.034) -- 0:01:56
621500 -- (-2272.678) (-2276.793) [-2272.872] (-2284.244) * (-2281.264) (-2272.316) (-2276.543) [-2262.422] -- 0:01:56
622000 -- (-2274.010) [-2280.085] (-2281.252) (-2283.507) * (-2279.114) (-2277.724) [-2266.371] (-2273.283) -- 0:01:56
622500 -- (-2274.784) [-2278.910] (-2282.893) (-2299.216) * (-2276.506) (-2278.158) (-2277.148) [-2268.656] -- 0:01:56
623000 -- (-2279.015) (-2288.581) [-2284.193] (-2282.201) * [-2283.826] (-2281.859) (-2279.064) (-2278.910) -- 0:01:56
623500 -- (-2267.641) (-2272.787) (-2286.447) [-2272.453] * (-2282.718) (-2282.195) (-2274.162) [-2277.308] -- 0:01:55
624000 -- (-2276.899) [-2272.669] (-2271.134) (-2277.381) * (-2283.924) (-2288.292) [-2271.786] (-2264.428) -- 0:01:56
624500 -- (-2290.643) [-2275.745] (-2274.495) (-2275.325) * [-2268.523] (-2276.311) (-2282.964) (-2270.353) -- 0:01:56
625000 -- (-2283.436) [-2275.891] (-2266.317) (-2276.276) * [-2271.476] (-2282.392) (-2284.818) (-2271.705) -- 0:01:55
Average standard deviation of split frequencies: 0.012802
625500 -- (-2280.415) (-2277.612) [-2267.722] (-2281.130) * [-2267.436] (-2275.789) (-2283.123) (-2264.650) -- 0:01:55
626000 -- [-2271.130] (-2276.834) (-2271.803) (-2288.826) * (-2274.356) (-2278.723) (-2277.213) [-2267.755] -- 0:01:55
626500 -- (-2270.344) (-2265.864) [-2263.759] (-2285.069) * (-2265.422) (-2277.759) (-2280.839) [-2274.201] -- 0:01:55
627000 -- (-2290.620) (-2268.087) (-2275.365) [-2275.634] * [-2272.637] (-2279.633) (-2299.013) (-2276.390) -- 0:01:55
627500 -- (-2288.323) (-2280.486) (-2272.520) [-2269.753] * (-2275.475) (-2271.684) (-2273.744) [-2277.114] -- 0:01:55
628000 -- (-2278.400) [-2274.675] (-2280.595) (-2280.104) * (-2265.125) (-2267.666) [-2281.912] (-2287.459) -- 0:01:54
628500 -- (-2281.832) [-2266.074] (-2276.175) (-2274.249) * [-2275.956] (-2272.009) (-2276.695) (-2292.432) -- 0:01:54
629000 -- (-2275.058) (-2271.036) [-2265.469] (-2280.682) * (-2286.875) (-2276.747) [-2269.952] (-2285.522) -- 0:01:54
629500 -- (-2277.028) (-2280.652) (-2279.704) [-2270.162] * (-2277.467) (-2282.597) [-2272.724] (-2281.599) -- 0:01:54
630000 -- [-2275.376] (-2266.466) (-2274.565) (-2277.287) * (-2277.674) (-2265.162) (-2275.097) [-2281.879] -- 0:01:54
Average standard deviation of split frequencies: 0.012657
630500 -- (-2274.398) (-2280.390) [-2270.811] (-2274.310) * (-2270.021) (-2270.956) [-2277.811] (-2271.283) -- 0:01:54
631000 -- (-2279.939) (-2290.651) [-2268.300] (-2274.114) * (-2275.375) (-2269.251) [-2279.942] (-2279.388) -- 0:01:54
631500 -- [-2281.827] (-2280.422) (-2273.628) (-2280.343) * [-2268.257] (-2276.077) (-2274.106) (-2278.226) -- 0:01:53
632000 -- [-2268.052] (-2278.950) (-2280.346) (-2270.880) * [-2271.754] (-2271.441) (-2276.935) (-2294.227) -- 0:01:53
632500 -- (-2265.165) [-2272.105] (-2278.637) (-2285.670) * (-2273.905) [-2271.415] (-2273.141) (-2283.282) -- 0:01:53
633000 -- (-2272.028) [-2272.178] (-2286.831) (-2282.126) * (-2267.293) (-2286.065) [-2270.302] (-2281.045) -- 0:01:53
633500 -- (-2281.462) [-2282.840] (-2277.703) (-2283.609) * (-2274.367) (-2274.092) [-2281.332] (-2284.725) -- 0:01:53
634000 -- (-2274.902) [-2267.156] (-2283.791) (-2288.643) * [-2274.847] (-2277.725) (-2270.464) (-2280.491) -- 0:01:53
634500 -- (-2275.841) [-2275.996] (-2289.654) (-2280.969) * (-2282.690) (-2269.572) [-2278.886] (-2279.148) -- 0:01:52
635000 -- (-2274.466) (-2291.196) (-2279.182) [-2274.139] * (-2285.258) [-2265.956] (-2277.617) (-2279.213) -- 0:01:52
Average standard deviation of split frequencies: 0.011859
635500 -- [-2270.528] (-2276.930) (-2276.422) (-2269.820) * (-2279.463) [-2271.900] (-2278.717) (-2283.606) -- 0:01:52
636000 -- (-2270.932) [-2277.001] (-2280.535) (-2267.813) * [-2274.344] (-2284.862) (-2275.373) (-2275.656) -- 0:01:52
636500 -- (-2270.703) (-2279.699) [-2273.223] (-2275.103) * (-2266.396) (-2300.982) (-2274.095) [-2277.853] -- 0:01:52
637000 -- (-2268.810) (-2282.666) [-2278.599] (-2266.184) * (-2272.432) (-2273.205) (-2286.298) [-2271.865] -- 0:01:52
637500 -- (-2272.265) (-2278.094) [-2270.064] (-2278.509) * (-2276.885) (-2285.271) [-2280.091] (-2277.531) -- 0:01:52
638000 -- [-2273.037] (-2273.429) (-2294.899) (-2275.817) * (-2275.654) [-2267.344] (-2278.380) (-2270.815) -- 0:01:51
638500 -- (-2270.823) (-2272.355) (-2274.492) [-2267.990] * (-2289.347) (-2281.493) [-2271.675] (-2271.554) -- 0:01:51
639000 -- [-2280.345] (-2271.186) (-2278.659) (-2280.875) * (-2288.029) (-2286.172) [-2265.835] (-2277.042) -- 0:01:51
639500 -- (-2278.193) (-2287.409) [-2270.416] (-2288.382) * (-2283.117) (-2280.036) (-2275.588) [-2272.100] -- 0:01:51
640000 -- (-2268.714) (-2287.608) (-2283.199) [-2278.302] * (-2278.331) [-2274.537] (-2284.622) (-2286.709) -- 0:01:50
Average standard deviation of split frequencies: 0.010645
640500 -- (-2272.452) [-2280.617] (-2293.547) (-2283.840) * (-2281.280) (-2288.592) (-2268.452) [-2266.730] -- 0:01:51
641000 -- (-2294.410) (-2286.436) (-2292.855) [-2278.291] * [-2271.102] (-2292.907) (-2268.923) (-2272.874) -- 0:01:50
641500 -- (-2281.116) [-2274.736] (-2295.987) (-2289.851) * (-2271.464) (-2302.606) (-2267.581) [-2274.734] -- 0:01:50
642000 -- [-2265.856] (-2271.965) (-2282.595) (-2276.525) * (-2272.425) (-2287.328) (-2288.462) [-2267.492] -- 0:01:50
642500 -- (-2282.128) (-2277.777) (-2279.904) [-2279.725] * (-2273.565) [-2282.850] (-2281.532) (-2283.391) -- 0:01:50
643000 -- [-2282.411] (-2287.665) (-2274.217) (-2272.109) * (-2280.833) [-2275.081] (-2269.248) (-2278.020) -- 0:01:49
643500 -- (-2271.731) [-2271.825] (-2277.644) (-2279.321) * (-2277.688) [-2266.973] (-2266.542) (-2289.402) -- 0:01:49
644000 -- (-2282.939) [-2279.415] (-2274.790) (-2280.737) * (-2280.101) (-2277.755) (-2276.777) [-2268.723] -- 0:01:50
644500 -- (-2286.963) [-2269.635] (-2288.995) (-2279.038) * [-2276.904] (-2272.107) (-2271.566) (-2269.612) -- 0:01:49
645000 -- (-2273.136) [-2272.636] (-2296.457) (-2272.616) * (-2276.536) (-2277.941) (-2277.275) [-2269.213] -- 0:01:49
Average standard deviation of split frequencies: 0.011189
645500 -- [-2271.901] (-2276.882) (-2280.971) (-2275.383) * (-2273.993) (-2286.171) (-2286.488) [-2268.711] -- 0:01:49
646000 -- (-2268.849) (-2268.123) (-2282.899) [-2271.804] * (-2278.337) (-2277.169) (-2280.996) [-2277.415] -- 0:01:49
646500 -- (-2271.764) [-2270.187] (-2275.440) (-2274.112) * (-2279.865) (-2267.682) (-2280.871) [-2272.655] -- 0:01:48
647000 -- [-2267.568] (-2275.240) (-2276.196) (-2272.714) * (-2272.363) [-2267.124] (-2273.887) (-2276.542) -- 0:01:48
647500 -- (-2268.813) (-2280.072) (-2280.688) [-2271.011] * [-2265.274] (-2287.923) (-2275.355) (-2268.675) -- 0:01:48
648000 -- (-2266.781) [-2269.017] (-2274.455) (-2277.357) * (-2280.176) [-2272.976] (-2267.707) (-2272.545) -- 0:01:48
648500 -- [-2271.139] (-2292.855) (-2276.781) (-2275.043) * [-2271.851] (-2270.929) (-2275.493) (-2271.944) -- 0:01:48
649000 -- [-2274.609] (-2287.471) (-2286.335) (-2280.756) * (-2272.175) (-2273.291) [-2271.506] (-2270.843) -- 0:01:48
649500 -- (-2274.043) (-2285.617) (-2287.041) [-2282.132] * (-2276.472) (-2272.804) [-2268.639] (-2282.876) -- 0:01:47
650000 -- (-2270.910) (-2288.302) [-2268.380] (-2280.362) * (-2274.778) [-2275.769] (-2278.035) (-2287.417) -- 0:01:47
Average standard deviation of split frequencies: 0.011254
650500 -- (-2271.217) (-2287.595) (-2274.982) [-2270.593] * [-2275.504] (-2282.942) (-2279.596) (-2279.185) -- 0:01:47
651000 -- (-2277.875) [-2280.078] (-2271.070) (-2271.225) * (-2277.425) (-2271.479) [-2268.301] (-2265.584) -- 0:01:47
651500 -- (-2273.440) (-2279.149) (-2274.214) [-2269.900] * (-2275.142) (-2268.389) (-2278.500) [-2271.700] -- 0:01:47
652000 -- (-2294.261) (-2275.180) (-2280.782) [-2280.835] * (-2290.245) (-2274.286) (-2277.052) [-2280.830] -- 0:01:47
652500 -- (-2275.195) (-2280.715) [-2267.253] (-2281.596) * (-2279.331) (-2285.449) (-2280.040) [-2265.111] -- 0:01:47
653000 -- [-2264.174] (-2275.456) (-2267.034) (-2272.008) * (-2272.256) (-2285.720) [-2270.550] (-2274.700) -- 0:01:46
653500 -- (-2279.571) (-2277.536) (-2277.901) [-2268.365] * (-2273.495) (-2286.098) [-2279.661] (-2284.461) -- 0:01:46
654000 -- (-2288.386) (-2275.661) [-2272.766] (-2273.351) * (-2272.799) (-2274.621) [-2264.471] (-2272.588) -- 0:01:46
654500 -- (-2277.204) [-2271.415] (-2274.918) (-2270.740) * (-2273.716) (-2281.391) (-2272.437) [-2282.391] -- 0:01:46
655000 -- (-2268.973) (-2279.019) [-2277.395] (-2296.751) * [-2267.467] (-2292.899) (-2271.349) (-2275.725) -- 0:01:46
Average standard deviation of split frequencies: 0.011019
655500 -- (-2282.874) (-2278.164) [-2268.548] (-2271.283) * (-2282.317) [-2268.300] (-2275.072) (-2277.588) -- 0:01:46
656000 -- (-2284.333) [-2282.700] (-2285.914) (-2276.507) * (-2287.053) (-2280.978) [-2273.134] (-2276.583) -- 0:01:45
656500 -- (-2283.524) [-2276.138] (-2279.730) (-2282.075) * (-2293.027) (-2284.764) [-2275.625] (-2271.333) -- 0:01:45
657000 -- (-2277.174) (-2291.408) (-2277.287) [-2274.547] * (-2275.914) [-2271.070] (-2278.248) (-2272.204) -- 0:01:45
657500 -- (-2283.875) (-2280.115) [-2278.997] (-2279.591) * [-2271.699] (-2275.830) (-2271.641) (-2285.719) -- 0:01:45
658000 -- (-2285.042) (-2274.132) (-2269.737) [-2276.284] * (-2272.665) (-2288.107) [-2273.854] (-2271.320) -- 0:01:45
658500 -- (-2283.887) (-2271.169) (-2275.623) [-2277.454] * (-2271.264) (-2282.330) (-2276.593) [-2269.597] -- 0:01:45
659000 -- (-2276.188) [-2276.550] (-2273.125) (-2280.968) * (-2272.112) (-2274.938) (-2280.648) [-2272.631] -- 0:01:45
659500 -- (-2272.627) (-2290.785) [-2265.302] (-2284.303) * (-2278.025) [-2276.399] (-2279.522) (-2278.401) -- 0:01:44
660000 -- (-2277.201) [-2271.401] (-2273.711) (-2276.416) * (-2285.969) (-2283.255) [-2275.629] (-2277.804) -- 0:01:44
Average standard deviation of split frequencies: 0.011749
660500 -- (-2280.591) (-2274.492) [-2268.253] (-2274.661) * (-2282.349) (-2278.980) (-2280.408) [-2279.869] -- 0:01:44
661000 -- (-2277.839) (-2289.275) (-2286.892) [-2274.797] * (-2272.754) [-2276.689] (-2273.858) (-2271.927) -- 0:01:44
661500 -- (-2272.733) (-2275.193) (-2274.685) [-2279.260] * (-2275.624) [-2272.369] (-2287.194) (-2276.355) -- 0:01:44
662000 -- (-2265.377) [-2265.507] (-2270.349) (-2280.201) * (-2284.562) (-2280.715) (-2274.527) [-2271.540] -- 0:01:44
662500 -- (-2292.005) [-2274.504] (-2277.480) (-2274.239) * (-2275.007) [-2267.629] (-2279.205) (-2274.649) -- 0:01:43
663000 -- [-2276.943] (-2276.541) (-2281.957) (-2276.765) * (-2276.227) [-2268.920] (-2277.636) (-2274.496) -- 0:01:43
663500 -- [-2266.940] (-2267.525) (-2277.161) (-2269.724) * (-2274.836) [-2262.779] (-2279.030) (-2270.082) -- 0:01:43
664000 -- (-2273.557) (-2268.445) (-2276.787) [-2271.694] * (-2271.031) (-2268.282) (-2283.010) [-2270.708] -- 0:01:43
664500 -- (-2279.557) [-2281.841] (-2275.978) (-2276.215) * (-2280.117) (-2272.396) [-2270.898] (-2271.911) -- 0:01:43
665000 -- [-2284.454] (-2278.112) (-2270.018) (-2279.075) * (-2281.159) [-2274.640] (-2281.139) (-2274.353) -- 0:01:43
Average standard deviation of split frequencies: 0.012174
665500 -- (-2270.740) (-2264.642) (-2283.752) [-2271.407] * (-2272.802) (-2273.714) [-2275.936] (-2275.416) -- 0:01:43
666000 -- (-2274.238) [-2275.560] (-2283.475) (-2282.817) * (-2269.379) (-2283.034) [-2276.705] (-2277.720) -- 0:01:42
666500 -- (-2275.886) [-2272.047] (-2276.989) (-2300.393) * (-2268.756) [-2267.610] (-2278.542) (-2272.090) -- 0:01:42
667000 -- (-2281.289) (-2267.728) [-2278.339] (-2286.478) * (-2275.685) (-2272.245) [-2268.634] (-2279.766) -- 0:01:42
667500 -- (-2277.131) (-2278.138) [-2277.287] (-2274.546) * (-2266.629) [-2269.514] (-2271.568) (-2286.580) -- 0:01:42
668000 -- (-2280.099) [-2271.619] (-2271.331) (-2271.256) * (-2270.133) [-2272.420] (-2283.383) (-2281.103) -- 0:01:42
668500 -- (-2274.403) (-2278.609) [-2265.882] (-2285.372) * [-2276.642] (-2291.565) (-2267.677) (-2282.848) -- 0:01:42
669000 -- [-2266.187] (-2277.371) (-2271.270) (-2294.198) * (-2279.787) (-2291.152) [-2274.724] (-2284.805) -- 0:01:41
669500 -- [-2266.877] (-2267.958) (-2273.513) (-2273.235) * (-2284.636) (-2285.464) [-2281.527] (-2286.464) -- 0:01:41
670000 -- (-2283.005) (-2281.658) [-2265.667] (-2275.238) * [-2277.438] (-2279.893) (-2286.275) (-2303.623) -- 0:01:41
Average standard deviation of split frequencies: 0.012793
670500 -- (-2277.025) (-2271.975) [-2267.997] (-2282.026) * (-2284.046) [-2269.586] (-2266.569) (-2274.375) -- 0:01:41
671000 -- (-2281.517) [-2271.876] (-2272.196) (-2268.330) * (-2270.092) (-2275.159) (-2266.263) [-2269.634] -- 0:01:41
671500 -- (-2276.439) (-2279.457) [-2265.537] (-2272.150) * (-2278.485) [-2269.391] (-2274.923) (-2279.009) -- 0:01:41
672000 -- (-2283.367) (-2273.243) [-2276.432] (-2275.577) * (-2264.019) (-2274.682) (-2276.126) [-2269.896] -- 0:01:41
672500 -- (-2282.215) (-2271.812) (-2293.530) [-2276.389] * [-2270.423] (-2269.144) (-2274.399) (-2280.091) -- 0:01:40
673000 -- (-2268.336) [-2271.341] (-2278.274) (-2281.271) * [-2265.699] (-2274.088) (-2277.058) (-2277.784) -- 0:01:40
673500 -- (-2279.853) (-2272.339) [-2269.438] (-2278.135) * [-2265.951] (-2271.842) (-2281.082) (-2280.777) -- 0:01:40
674000 -- (-2276.680) (-2273.893) (-2275.561) [-2262.020] * (-2282.089) [-2270.455] (-2273.776) (-2277.978) -- 0:01:40
674500 -- (-2278.543) [-2272.824] (-2271.987) (-2281.680) * (-2276.508) (-2276.422) [-2265.533] (-2275.735) -- 0:01:40
675000 -- (-2283.917) [-2279.180] (-2281.037) (-2266.381) * (-2281.523) (-2280.488) [-2276.265] (-2275.224) -- 0:01:40
Average standard deviation of split frequencies: 0.013157
675500 -- (-2277.330) (-2276.430) (-2276.849) [-2273.804] * (-2288.677) [-2276.386] (-2277.910) (-2273.998) -- 0:01:39
676000 -- [-2275.608] (-2291.988) (-2266.230) (-2264.392) * (-2289.666) [-2268.309] (-2283.606) (-2270.860) -- 0:01:39
676500 -- (-2280.821) (-2269.671) [-2276.358] (-2278.542) * [-2267.714] (-2272.444) (-2273.456) (-2282.643) -- 0:01:39
677000 -- (-2282.071) (-2272.882) (-2278.594) [-2281.282] * (-2282.555) (-2273.370) [-2280.025] (-2290.344) -- 0:01:39
677500 -- (-2279.159) (-2284.155) [-2269.749] (-2267.069) * [-2264.870] (-2279.069) (-2270.637) (-2273.594) -- 0:01:39
678000 -- (-2287.662) (-2279.728) [-2268.941] (-2271.837) * (-2277.781) (-2278.583) [-2276.006] (-2276.086) -- 0:01:39
678500 -- [-2284.649] (-2282.593) (-2276.405) (-2281.581) * (-2280.663) (-2278.972) [-2277.075] (-2276.614) -- 0:01:39
679000 -- (-2275.868) (-2279.659) [-2269.343] (-2290.835) * [-2267.329] (-2281.238) (-2282.023) (-2274.157) -- 0:01:38
679500 -- (-2278.908) (-2277.590) [-2264.813] (-2289.601) * [-2269.045] (-2274.270) (-2278.982) (-2282.345) -- 0:01:39
680000 -- (-2270.848) (-2271.699) (-2276.970) [-2266.899] * [-2271.360] (-2272.420) (-2282.307) (-2278.346) -- 0:01:38
Average standard deviation of split frequencies: 0.012512
680500 -- (-2279.798) [-2275.106] (-2284.054) (-2270.777) * (-2285.479) (-2268.989) (-2274.674) [-2270.475] -- 0:01:38
681000 -- (-2271.643) [-2277.745] (-2275.966) (-2281.406) * (-2272.065) (-2278.449) (-2280.562) [-2278.220] -- 0:01:38
681500 -- (-2271.693) [-2273.177] (-2279.314) (-2281.761) * (-2280.208) [-2270.965] (-2266.103) (-2289.257) -- 0:01:38
682000 -- (-2266.185) (-2276.355) (-2274.088) [-2271.108] * (-2269.882) [-2287.267] (-2270.549) (-2277.145) -- 0:01:37
682500 -- (-2277.119) (-2272.860) (-2275.593) [-2270.094] * (-2284.179) [-2279.246] (-2277.068) (-2275.526) -- 0:01:37
683000 -- [-2264.577] (-2268.987) (-2277.166) (-2268.161) * (-2269.405) (-2274.895) [-2268.899] (-2294.215) -- 0:01:37
683500 -- (-2284.123) [-2270.651] (-2285.231) (-2275.375) * [-2268.232] (-2269.033) (-2285.625) (-2273.082) -- 0:01:37
684000 -- (-2282.292) (-2276.241) (-2281.963) [-2270.760] * (-2276.057) (-2270.032) [-2270.354] (-2280.194) -- 0:01:37
684500 -- (-2273.303) [-2276.826] (-2288.025) (-2276.684) * (-2280.258) (-2272.329) [-2275.476] (-2273.456) -- 0:01:37
685000 -- (-2291.017) (-2275.585) [-2276.295] (-2275.699) * (-2275.101) [-2271.314] (-2270.127) (-2286.500) -- 0:01:37
Average standard deviation of split frequencies: 0.011453
685500 -- (-2273.424) (-2276.252) (-2277.055) [-2275.059] * (-2284.893) [-2269.782] (-2273.866) (-2275.875) -- 0:01:36
686000 -- (-2268.783) [-2270.709] (-2295.122) (-2276.478) * (-2276.241) [-2274.592] (-2286.088) (-2286.832) -- 0:01:36
686500 -- [-2280.107] (-2274.690) (-2268.866) (-2276.618) * (-2279.358) (-2266.531) (-2283.668) [-2271.773] -- 0:01:36
687000 -- (-2275.793) (-2279.426) (-2289.620) [-2271.812] * (-2281.499) (-2273.804) (-2277.728) [-2266.920] -- 0:01:36
687500 -- (-2285.267) (-2274.353) (-2276.090) [-2273.639] * (-2277.657) [-2267.027] (-2280.171) (-2276.865) -- 0:01:36
688000 -- (-2287.178) (-2280.931) (-2282.941) [-2275.968] * (-2282.531) (-2285.812) (-2282.694) [-2269.598] -- 0:01:36
688500 -- (-2288.560) (-2278.907) [-2282.376] (-2272.970) * [-2271.600] (-2271.305) (-2275.472) (-2273.488) -- 0:01:35
689000 -- (-2294.822) [-2279.853] (-2268.544) (-2271.897) * (-2272.165) (-2282.588) [-2275.344] (-2278.267) -- 0:01:35
689500 -- (-2279.757) [-2271.589] (-2266.944) (-2279.282) * (-2274.390) (-2275.411) [-2270.537] (-2285.633) -- 0:01:35
690000 -- (-2271.952) (-2268.842) [-2274.604] (-2283.162) * (-2265.919) [-2274.286] (-2280.036) (-2273.603) -- 0:01:35
Average standard deviation of split frequencies: 0.012104
690500 -- [-2280.031] (-2271.443) (-2280.817) (-2277.912) * (-2269.622) (-2273.600) [-2273.898] (-2279.561) -- 0:01:35
691000 -- (-2275.962) (-2289.677) (-2277.513) [-2263.506] * [-2276.180] (-2279.819) (-2278.865) (-2294.023) -- 0:01:35
691500 -- [-2276.072] (-2287.431) (-2274.861) (-2272.789) * (-2267.217) (-2289.249) [-2267.058] (-2286.572) -- 0:01:35
692000 -- [-2271.470] (-2272.304) (-2276.810) (-2266.828) * (-2273.365) (-2280.719) (-2268.706) [-2276.949] -- 0:01:34
692500 -- (-2263.102) [-2266.899] (-2276.580) (-2265.022) * (-2273.211) (-2282.764) (-2277.635) [-2268.789] -- 0:01:34
693000 -- (-2269.575) [-2271.022] (-2280.675) (-2275.743) * (-2270.973) [-2274.425] (-2282.949) (-2275.116) -- 0:01:34
693500 -- (-2279.569) (-2271.439) (-2277.788) [-2276.338] * (-2263.226) (-2278.739) [-2276.189] (-2284.924) -- 0:01:34
694000 -- (-2279.450) [-2274.626] (-2278.751) (-2275.431) * (-2275.166) (-2267.298) [-2271.400] (-2275.157) -- 0:01:34
694500 -- (-2277.094) [-2274.515] (-2281.601) (-2291.196) * [-2270.142] (-2274.009) (-2285.308) (-2282.678) -- 0:01:34
695000 -- [-2273.804] (-2273.453) (-2285.188) (-2285.843) * (-2275.165) (-2273.139) (-2276.832) [-2286.256] -- 0:01:33
Average standard deviation of split frequencies: 0.012778
695500 -- (-2279.569) (-2266.881) [-2275.438] (-2285.088) * [-2270.081] (-2270.666) (-2293.023) (-2283.884) -- 0:01:33
696000 -- (-2279.125) [-2275.815] (-2282.107) (-2270.539) * [-2271.436] (-2263.918) (-2285.483) (-2278.018) -- 0:01:33
696500 -- [-2276.641] (-2283.470) (-2280.444) (-2272.759) * (-2282.281) (-2269.289) (-2294.571) [-2278.350] -- 0:01:33
697000 -- (-2277.999) (-2282.137) [-2281.969] (-2276.275) * (-2290.032) (-2275.207) (-2278.074) [-2277.006] -- 0:01:33
697500 -- (-2284.200) [-2279.840] (-2272.679) (-2303.431) * [-2278.612] (-2276.295) (-2275.005) (-2280.523) -- 0:01:33
698000 -- (-2291.942) (-2272.605) (-2271.310) [-2270.438] * (-2277.298) [-2271.965] (-2288.820) (-2276.502) -- 0:01:33
698500 -- (-2281.344) (-2278.980) [-2268.667] (-2276.636) * (-2276.982) [-2274.846] (-2288.248) (-2280.685) -- 0:01:32
699000 -- (-2274.824) (-2283.809) (-2276.340) [-2286.409] * (-2273.457) (-2266.970) [-2269.700] (-2274.037) -- 0:01:32
699500 -- (-2273.712) (-2275.234) (-2275.881) [-2278.356] * (-2283.979) (-2274.211) [-2267.339] (-2279.363) -- 0:01:32
700000 -- (-2284.937) [-2282.098] (-2277.887) (-2287.242) * (-2276.383) (-2284.156) [-2266.535] (-2270.177) -- 0:01:32
Average standard deviation of split frequencies: 0.012065
700500 -- (-2274.872) (-2278.275) [-2270.722] (-2280.106) * (-2279.975) [-2264.140] (-2277.230) (-2275.885) -- 0:01:31
701000 -- (-2270.278) (-2273.266) [-2270.839] (-2280.025) * [-2282.226] (-2272.366) (-2271.347) (-2273.623) -- 0:01:32
701500 -- [-2273.478] (-2283.989) (-2271.557) (-2283.778) * (-2285.171) (-2274.815) [-2269.783] (-2280.693) -- 0:01:31
702000 -- (-2284.625) [-2280.830] (-2284.827) (-2273.025) * (-2274.027) (-2285.720) [-2271.221] (-2277.919) -- 0:01:31
702500 -- (-2280.340) (-2275.027) (-2276.810) [-2270.711] * (-2280.668) (-2277.736) (-2283.539) [-2279.528] -- 0:01:31
703000 -- (-2271.648) (-2284.977) (-2271.311) [-2279.197] * (-2291.154) [-2275.785] (-2283.200) (-2277.497) -- 0:01:31
703500 -- [-2265.860] (-2281.928) (-2274.739) (-2273.305) * (-2272.757) [-2274.046] (-2272.701) (-2272.924) -- 0:01:31
704000 -- (-2275.301) [-2284.860] (-2274.311) (-2281.695) * (-2282.074) (-2269.518) [-2270.937] (-2281.581) -- 0:01:30
704500 -- [-2266.659] (-2273.570) (-2279.810) (-2278.136) * (-2280.792) (-2273.175) [-2267.708] (-2274.832) -- 0:01:31
705000 -- [-2281.552] (-2277.746) (-2286.294) (-2281.193) * (-2277.043) (-2274.316) [-2269.494] (-2275.194) -- 0:01:30
Average standard deviation of split frequencies: 0.011040
705500 -- [-2280.501] (-2279.903) (-2270.720) (-2283.064) * (-2287.563) (-2284.432) [-2263.340] (-2278.937) -- 0:01:30
706000 -- (-2270.632) (-2301.401) (-2273.972) [-2272.752] * (-2284.044) (-2286.432) [-2269.432] (-2267.743) -- 0:01:30
706500 -- [-2270.118] (-2283.078) (-2273.190) (-2275.428) * (-2303.479) [-2269.312] (-2281.444) (-2271.417) -- 0:01:30
707000 -- [-2275.839] (-2278.142) (-2275.875) (-2271.392) * [-2279.432] (-2284.270) (-2281.829) (-2276.912) -- 0:01:29
707500 -- [-2267.165] (-2277.040) (-2276.895) (-2273.553) * (-2292.829) (-2284.189) (-2269.056) [-2267.612] -- 0:01:29
708000 -- (-2288.505) (-2269.944) (-2282.306) [-2267.847] * (-2282.397) [-2273.337] (-2281.671) (-2281.845) -- 0:01:29
708500 -- (-2275.746) [-2271.528] (-2280.157) (-2275.238) * (-2289.961) (-2271.617) (-2282.087) [-2284.190] -- 0:01:29
709000 -- [-2273.948] (-2267.592) (-2281.116) (-2274.763) * (-2288.859) (-2275.341) (-2284.444) [-2273.710] -- 0:01:29
709500 -- (-2275.505) [-2279.408] (-2274.066) (-2280.292) * (-2295.775) (-2279.052) (-2286.714) [-2270.586] -- 0:01:29
710000 -- (-2281.096) [-2271.893] (-2283.756) (-2275.028) * (-2278.545) (-2287.259) (-2281.155) [-2271.119] -- 0:01:29
Average standard deviation of split frequencies: 0.010923
710500 -- (-2274.104) [-2274.419] (-2290.734) (-2274.113) * (-2288.711) (-2281.052) [-2281.489] (-2273.827) -- 0:01:28
711000 -- (-2281.770) [-2272.823] (-2291.819) (-2277.564) * (-2290.637) (-2281.377) [-2272.955] (-2276.844) -- 0:01:28
711500 -- [-2266.102] (-2283.691) (-2278.235) (-2275.994) * (-2295.765) (-2269.341) (-2275.881) [-2271.718] -- 0:01:28
712000 -- [-2274.944] (-2282.296) (-2282.141) (-2288.268) * (-2284.541) (-2277.299) (-2270.545) [-2265.607] -- 0:01:28
712500 -- (-2277.970) (-2287.832) [-2269.231] (-2269.858) * (-2295.123) (-2273.499) (-2271.745) [-2270.736] -- 0:01:28
713000 -- (-2270.523) [-2264.900] (-2274.662) (-2283.809) * (-2283.635) (-2270.030) [-2269.045] (-2280.814) -- 0:01:28
713500 -- (-2279.249) (-2272.893) [-2270.800] (-2274.615) * (-2290.341) (-2283.922) (-2273.520) [-2265.762] -- 0:01:27
714000 -- [-2277.037] (-2278.014) (-2271.371) (-2280.283) * (-2283.054) (-2270.010) (-2272.875) [-2272.637] -- 0:01:27
714500 -- (-2282.407) (-2271.898) (-2282.990) [-2273.176] * (-2271.849) (-2273.905) (-2272.380) [-2273.331] -- 0:01:27
715000 -- (-2283.194) (-2280.900) (-2286.244) [-2273.213] * [-2270.771] (-2276.684) (-2278.718) (-2274.038) -- 0:01:27
Average standard deviation of split frequencies: 0.011193
715500 -- (-2277.414) (-2287.186) (-2271.032) [-2273.424] * [-2273.895] (-2288.923) (-2285.684) (-2268.426) -- 0:01:27
716000 -- (-2283.712) (-2284.011) [-2272.228] (-2278.715) * (-2271.053) (-2270.450) (-2284.970) [-2269.008] -- 0:01:27
716500 -- (-2279.852) (-2281.232) [-2274.205] (-2266.958) * [-2276.536] (-2272.928) (-2277.519) (-2269.019) -- 0:01:27
717000 -- (-2279.631) (-2270.557) [-2271.460] (-2280.081) * (-2291.015) (-2275.473) [-2275.328] (-2289.338) -- 0:01:26
717500 -- (-2273.001) (-2280.041) [-2272.125] (-2279.672) * [-2262.629] (-2265.350) (-2276.225) (-2273.611) -- 0:01:26
718000 -- (-2273.452) (-2279.903) [-2268.699] (-2296.697) * [-2272.671] (-2293.530) (-2274.496) (-2271.664) -- 0:01:26
718500 -- [-2275.483] (-2280.109) (-2283.688) (-2279.512) * [-2272.635] (-2279.564) (-2279.912) (-2273.539) -- 0:01:26
719000 -- (-2271.630) [-2283.714] (-2266.926) (-2285.180) * (-2268.587) (-2279.288) (-2263.682) [-2275.503] -- 0:01:26
719500 -- (-2285.660) (-2282.044) (-2270.529) [-2277.088] * [-2268.874] (-2280.637) (-2263.500) (-2278.456) -- 0:01:26
720000 -- (-2277.173) (-2272.861) (-2285.585) [-2271.778] * (-2267.192) [-2277.970] (-2287.492) (-2277.840) -- 0:01:25
Average standard deviation of split frequencies: 0.010640
720500 -- [-2274.240] (-2275.014) (-2276.035) (-2274.505) * (-2270.307) (-2275.804) [-2276.172] (-2279.407) -- 0:01:25
721000 -- (-2274.047) (-2275.431) [-2267.361] (-2279.384) * (-2278.804) [-2274.444] (-2277.657) (-2275.579) -- 0:01:25
721500 -- (-2282.197) (-2282.487) [-2273.133] (-2276.478) * [-2286.238] (-2280.207) (-2274.807) (-2283.451) -- 0:01:25
722000 -- (-2276.547) (-2279.046) [-2274.772] (-2288.201) * (-2273.776) [-2272.291] (-2281.025) (-2281.256) -- 0:01:25
722500 -- (-2273.111) (-2270.335) (-2278.670) [-2282.727] * (-2272.099) [-2271.840] (-2277.057) (-2284.070) -- 0:01:25
723000 -- (-2285.502) (-2284.946) (-2268.829) [-2270.376] * (-2264.692) (-2288.035) [-2266.593] (-2282.257) -- 0:01:25
723500 -- (-2285.076) (-2282.005) [-2279.932] (-2277.941) * (-2277.340) [-2281.404] (-2276.999) (-2281.341) -- 0:01:24
724000 -- (-2278.375) (-2270.250) [-2271.859] (-2273.367) * (-2271.830) (-2273.890) (-2281.775) [-2269.973] -- 0:01:24
724500 -- (-2284.013) (-2267.863) [-2266.344] (-2271.157) * (-2275.104) [-2274.745] (-2287.768) (-2270.593) -- 0:01:24
725000 -- (-2280.965) (-2274.120) (-2273.628) [-2274.793] * (-2275.557) [-2264.107] (-2298.401) (-2266.368) -- 0:01:24
Average standard deviation of split frequencies: 0.010865
725500 -- (-2275.123) [-2269.271] (-2276.830) (-2277.358) * (-2283.478) (-2271.623) (-2289.002) [-2275.451] -- 0:01:24
726000 -- [-2275.841] (-2281.791) (-2279.275) (-2285.519) * (-2286.624) (-2267.961) (-2288.790) [-2266.143] -- 0:01:24
726500 -- (-2284.507) (-2272.346) (-2285.724) [-2281.141] * (-2273.689) [-2275.023] (-2283.656) (-2278.000) -- 0:01:23
727000 -- (-2289.950) (-2268.748) [-2271.363] (-2271.778) * (-2278.174) (-2276.786) (-2280.942) [-2275.552] -- 0:01:23
727500 -- (-2287.414) [-2278.919] (-2277.237) (-2270.652) * (-2269.522) [-2270.061] (-2278.720) (-2272.358) -- 0:01:23
728000 -- (-2279.338) (-2271.040) [-2266.334] (-2285.292) * (-2273.187) [-2280.530] (-2276.006) (-2268.385) -- 0:01:23
728500 -- (-2288.138) (-2283.763) [-2265.605] (-2275.717) * (-2276.921) [-2269.408] (-2268.826) (-2279.142) -- 0:01:23
729000 -- (-2276.688) (-2281.007) (-2282.070) [-2277.919] * [-2275.374] (-2296.970) (-2278.752) (-2264.709) -- 0:01:23
729500 -- (-2287.881) (-2281.465) (-2276.525) [-2265.046] * (-2272.294) (-2283.439) (-2282.217) [-2264.350] -- 0:01:23
730000 -- [-2271.489] (-2276.508) (-2278.731) (-2272.981) * (-2265.513) [-2275.115] (-2281.192) (-2295.268) -- 0:01:22
Average standard deviation of split frequencies: 0.010237
730500 -- (-2274.194) (-2279.796) [-2271.733] (-2281.641) * (-2279.334) (-2271.152) (-2278.822) [-2265.581] -- 0:01:22
731000 -- (-2281.092) (-2274.769) (-2273.604) [-2276.628] * (-2289.065) (-2276.822) (-2279.012) [-2268.051] -- 0:01:22
731500 -- [-2268.088] (-2280.996) (-2280.736) (-2284.001) * (-2284.716) [-2270.302] (-2290.033) (-2274.499) -- 0:01:22
732000 -- [-2276.630] (-2292.032) (-2286.548) (-2281.396) * (-2271.326) (-2298.912) [-2271.702] (-2278.756) -- 0:01:22
732500 -- (-2286.157) [-2282.781] (-2282.370) (-2276.580) * (-2281.497) [-2274.387] (-2279.381) (-2293.274) -- 0:01:22
733000 -- (-2275.221) [-2270.898] (-2277.373) (-2265.950) * [-2270.239] (-2273.074) (-2288.945) (-2273.671) -- 0:01:21
733500 -- (-2269.163) [-2273.438] (-2271.928) (-2273.638) * [-2275.607] (-2272.562) (-2272.564) (-2265.341) -- 0:01:21
734000 -- (-2274.651) [-2268.975] (-2283.237) (-2284.540) * (-2293.910) (-2274.268) [-2261.617] (-2285.863) -- 0:01:21
734500 -- (-2276.452) (-2273.602) [-2277.388] (-2289.209) * (-2277.096) (-2277.284) [-2271.254] (-2276.470) -- 0:01:21
735000 -- [-2274.502] (-2267.626) (-2271.903) (-2285.888) * (-2272.502) (-2278.401) [-2269.835] (-2279.332) -- 0:01:21
Average standard deviation of split frequencies: 0.010205
735500 -- (-2282.820) [-2275.477] (-2273.456) (-2281.912) * (-2268.163) (-2273.202) (-2271.269) [-2270.970] -- 0:01:21
736000 -- (-2285.998) (-2282.197) [-2274.378] (-2276.294) * (-2279.945) (-2272.014) (-2285.776) [-2270.314] -- 0:01:21
736500 -- [-2272.030] (-2284.825) (-2271.329) (-2277.037) * (-2280.166) (-2271.749) [-2266.172] (-2275.841) -- 0:01:20
737000 -- (-2284.941) (-2273.506) [-2270.531] (-2272.310) * (-2281.098) (-2277.497) (-2278.359) [-2265.705] -- 0:01:20
737500 -- (-2270.435) (-2279.405) (-2269.774) [-2273.650] * (-2274.921) (-2271.462) [-2270.131] (-2272.216) -- 0:01:20
738000 -- (-2281.513) (-2292.577) [-2276.335] (-2276.372) * [-2277.202] (-2274.874) (-2276.429) (-2280.670) -- 0:01:20
738500 -- (-2273.308) (-2280.058) [-2265.384] (-2283.636) * (-2275.187) (-2271.351) [-2271.659] (-2270.636) -- 0:01:20
739000 -- (-2284.049) [-2278.590] (-2275.138) (-2277.596) * (-2278.180) [-2269.281] (-2272.200) (-2276.389) -- 0:01:20
739500 -- (-2282.336) (-2272.526) [-2274.560] (-2286.363) * (-2280.905) (-2279.084) (-2277.160) [-2281.213] -- 0:01:19
740000 -- (-2283.341) (-2277.348) (-2271.987) [-2271.238] * (-2274.324) (-2279.302) [-2274.816] (-2273.970) -- 0:01:19
Average standard deviation of split frequencies: 0.010098
740500 -- [-2279.038] (-2274.557) (-2276.533) (-2282.708) * (-2280.306) (-2280.641) [-2273.148] (-2267.672) -- 0:01:19
741000 -- (-2291.185) (-2276.349) [-2273.008] (-2286.046) * (-2293.861) [-2273.041] (-2281.881) (-2272.187) -- 0:01:19
741500 -- (-2278.208) (-2275.611) [-2277.179] (-2276.771) * (-2288.633) [-2268.788] (-2274.467) (-2279.313) -- 0:01:19
742000 -- [-2281.123] (-2275.993) (-2284.916) (-2280.730) * (-2284.261) (-2271.508) (-2281.034) [-2265.354] -- 0:01:18
742500 -- (-2287.236) (-2270.736) [-2267.405] (-2278.541) * (-2280.206) (-2271.852) (-2291.544) [-2273.777] -- 0:01:19
743000 -- (-2281.901) [-2267.197] (-2273.054) (-2293.465) * [-2275.114] (-2282.149) (-2275.284) (-2266.916) -- 0:01:18
743500 -- [-2274.065] (-2284.153) (-2275.587) (-2279.577) * (-2272.903) [-2273.177] (-2275.811) (-2279.194) -- 0:01:18
744000 -- [-2278.455] (-2270.760) (-2275.486) (-2282.428) * (-2269.052) [-2280.559] (-2276.135) (-2268.385) -- 0:01:18
744500 -- (-2264.556) [-2269.514] (-2274.065) (-2290.675) * (-2278.335) (-2289.803) (-2266.622) [-2271.011] -- 0:01:18
745000 -- [-2274.121] (-2272.539) (-2274.766) (-2287.301) * (-2275.113) [-2275.168] (-2280.934) (-2281.561) -- 0:01:18
Average standard deviation of split frequencies: 0.010237
745500 -- (-2273.087) (-2273.043) [-2268.718] (-2274.104) * [-2270.514] (-2283.908) (-2275.459) (-2276.503) -- 0:01:18
746000 -- [-2268.462] (-2273.102) (-2270.910) (-2279.666) * (-2284.773) [-2276.029] (-2276.073) (-2269.672) -- 0:01:17
746500 -- (-2276.288) (-2270.428) [-2277.405] (-2270.572) * (-2277.570) [-2276.701] (-2274.502) (-2281.784) -- 0:01:17
747000 -- (-2284.766) (-2278.642) [-2272.578] (-2275.772) * (-2279.029) (-2277.976) [-2270.830] (-2268.697) -- 0:01:17
747500 -- [-2270.050] (-2275.877) (-2284.480) (-2283.918) * [-2267.522] (-2279.579) (-2272.172) (-2281.734) -- 0:01:17
748000 -- (-2278.022) (-2277.828) [-2284.250] (-2271.388) * [-2270.342] (-2276.981) (-2275.255) (-2282.512) -- 0:01:17
748500 -- (-2274.507) (-2277.552) [-2289.623] (-2281.658) * (-2277.989) [-2267.191] (-2280.137) (-2278.618) -- 0:01:16
749000 -- (-2277.702) (-2280.469) [-2285.548] (-2273.420) * (-2266.966) [-2268.289] (-2272.684) (-2278.961) -- 0:01:17
749500 -- (-2271.024) (-2280.207) [-2270.980] (-2272.904) * [-2274.101] (-2279.123) (-2268.433) (-2272.442) -- 0:01:16
750000 -- [-2281.141] (-2276.457) (-2268.597) (-2290.432) * (-2278.364) (-2282.162) [-2272.506] (-2267.401) -- 0:01:16
Average standard deviation of split frequencies: 0.010383
750500 -- (-2274.032) [-2271.732] (-2287.146) (-2274.044) * (-2282.373) [-2275.656] (-2275.033) (-2278.497) -- 0:01:16
751000 -- [-2270.808] (-2263.074) (-2288.079) (-2274.446) * (-2271.919) (-2276.661) (-2289.178) [-2273.625] -- 0:01:16
751500 -- (-2278.374) (-2276.583) (-2281.944) [-2281.264] * [-2274.386] (-2278.769) (-2278.954) (-2267.221) -- 0:01:16
752000 -- (-2266.968) (-2279.024) (-2274.096) [-2266.966] * (-2274.762) [-2268.890] (-2281.248) (-2277.748) -- 0:01:15
752500 -- (-2279.370) (-2275.491) (-2270.564) [-2275.611] * (-2283.246) [-2274.068] (-2280.271) (-2271.149) -- 0:01:15
753000 -- (-2280.206) [-2267.050] (-2280.271) (-2283.353) * [-2285.239] (-2275.885) (-2276.582) (-2282.069) -- 0:01:15
753500 -- (-2277.492) [-2282.034] (-2284.777) (-2271.650) * [-2284.231] (-2278.825) (-2269.292) (-2279.244) -- 0:01:15
754000 -- (-2266.103) (-2275.749) (-2274.923) [-2270.104] * [-2282.416] (-2282.080) (-2275.232) (-2286.467) -- 0:01:15
754500 -- [-2272.813] (-2275.013) (-2270.728) (-2272.578) * (-2269.451) [-2269.595] (-2283.331) (-2281.983) -- 0:01:15
755000 -- [-2274.270] (-2273.975) (-2288.343) (-2274.599) * (-2271.180) [-2274.957] (-2287.390) (-2280.219) -- 0:01:14
Average standard deviation of split frequencies: 0.010143
755500 -- (-2281.334) (-2283.006) (-2269.680) [-2277.707] * (-2272.877) [-2279.974] (-2273.683) (-2279.867) -- 0:01:14
756000 -- (-2283.718) (-2285.946) (-2278.068) [-2273.585] * (-2275.542) [-2273.056] (-2287.056) (-2273.001) -- 0:01:14
756500 -- [-2272.768] (-2280.915) (-2279.545) (-2276.336) * (-2273.648) [-2270.676] (-2273.887) (-2277.089) -- 0:01:14
757000 -- (-2290.452) (-2282.888) (-2266.844) [-2277.132] * (-2284.877) (-2267.795) (-2268.464) [-2266.714] -- 0:01:14
757500 -- (-2277.968) (-2294.964) (-2275.113) [-2276.443] * [-2276.864] (-2281.743) (-2287.389) (-2283.458) -- 0:01:14
758000 -- (-2275.403) (-2287.688) [-2277.420] (-2289.872) * (-2275.535) (-2279.880) (-2280.163) [-2268.891] -- 0:01:14
758500 -- (-2274.227) (-2285.601) [-2284.428] (-2277.729) * (-2284.925) (-2285.180) [-2270.646] (-2278.248) -- 0:01:13
759000 -- (-2279.432) (-2270.089) (-2278.226) [-2289.914] * (-2281.160) [-2278.776] (-2280.423) (-2280.351) -- 0:01:13
759500 -- (-2290.383) [-2272.078] (-2284.435) (-2273.817) * (-2278.516) (-2289.559) (-2269.897) [-2264.913] -- 0:01:13
760000 -- (-2284.880) (-2279.849) (-2272.020) [-2267.832] * (-2272.813) (-2263.055) (-2276.437) [-2265.475] -- 0:01:13
Average standard deviation of split frequencies: 0.010453
760500 -- [-2276.577] (-2274.111) (-2271.841) (-2273.302) * [-2266.978] (-2282.053) (-2283.395) (-2278.293) -- 0:01:13
761000 -- (-2276.662) (-2279.618) [-2267.389] (-2273.814) * (-2273.141) [-2270.366] (-2282.459) (-2280.780) -- 0:01:13
761500 -- (-2279.964) (-2289.852) [-2273.238] (-2274.555) * (-2278.704) [-2275.124] (-2287.957) (-2271.205) -- 0:01:12
762000 -- [-2280.719] (-2278.413) (-2273.427) (-2275.607) * (-2279.125) [-2270.311] (-2272.437) (-2271.802) -- 0:01:13
762500 -- (-2279.069) (-2279.148) [-2282.571] (-2285.998) * (-2278.210) [-2277.259] (-2282.357) (-2283.101) -- 0:01:12
763000 -- (-2276.084) [-2281.862] (-2276.863) (-2275.282) * (-2277.764) (-2277.632) (-2267.164) [-2284.335] -- 0:01:12
763500 -- [-2277.761] (-2275.653) (-2279.101) (-2280.301) * (-2276.464) (-2284.019) (-2274.341) [-2279.576] -- 0:01:12
764000 -- [-2274.822] (-2281.660) (-2272.328) (-2285.005) * (-2291.258) (-2274.066) (-2269.766) [-2274.305] -- 0:01:12
764500 -- (-2272.550) (-2276.646) [-2272.148] (-2278.400) * [-2275.069] (-2272.201) (-2280.226) (-2269.131) -- 0:01:12
765000 -- (-2266.533) (-2272.146) [-2284.075] (-2276.373) * (-2281.116) (-2269.399) (-2273.117) [-2273.670] -- 0:01:11
Average standard deviation of split frequencies: 0.010134
765500 -- [-2274.282] (-2283.340) (-2272.207) (-2274.599) * (-2284.539) [-2268.959] (-2270.465) (-2287.541) -- 0:01:11
766000 -- (-2268.061) (-2278.772) [-2264.180] (-2277.318) * [-2281.253] (-2275.494) (-2272.876) (-2288.536) -- 0:01:11
766500 -- (-2274.978) (-2275.982) (-2282.531) [-2262.087] * (-2270.867) (-2282.042) [-2277.273] (-2289.632) -- 0:01:11
767000 -- (-2276.359) (-2283.570) [-2268.492] (-2273.125) * (-2276.238) [-2270.883] (-2277.662) (-2276.983) -- 0:01:11
767500 -- (-2273.520) (-2279.604) [-2267.772] (-2275.648) * (-2280.306) [-2279.464] (-2282.763) (-2281.235) -- 0:01:11
768000 -- (-2270.956) (-2277.647) [-2271.538] (-2272.120) * (-2277.941) (-2275.326) [-2273.804] (-2282.288) -- 0:01:10
768500 -- (-2271.922) (-2272.460) (-2279.716) [-2271.002] * (-2277.285) (-2278.790) [-2276.979] (-2272.562) -- 0:01:10
769000 -- [-2264.932] (-2273.646) (-2267.705) (-2271.652) * (-2284.202) (-2287.941) (-2270.969) [-2275.617] -- 0:01:10
769500 -- (-2273.157) (-2275.166) (-2273.303) [-2271.893] * (-2279.256) (-2267.639) (-2279.246) [-2284.623] -- 0:01:10
770000 -- [-2269.357] (-2273.484) (-2273.335) (-2277.075) * (-2277.237) (-2283.513) [-2271.450] (-2281.083) -- 0:01:10
Average standard deviation of split frequencies: 0.010439
770500 -- (-2267.693) (-2275.852) [-2267.599] (-2280.312) * (-2270.715) (-2283.444) [-2271.977] (-2276.517) -- 0:01:10
771000 -- [-2271.973] (-2269.792) (-2270.527) (-2292.009) * (-2274.447) (-2283.723) (-2284.868) [-2277.319] -- 0:01:10
771500 -- [-2272.422] (-2269.840) (-2285.882) (-2275.505) * [-2271.976] (-2276.421) (-2278.639) (-2272.541) -- 0:01:10
772000 -- (-2273.489) (-2276.854) (-2269.809) [-2277.530] * (-2275.977) (-2279.752) (-2280.853) [-2265.890] -- 0:01:09
772500 -- (-2292.258) (-2287.954) (-2270.397) [-2286.269] * [-2269.487] (-2269.260) (-2280.945) (-2276.204) -- 0:01:09
773000 -- (-2286.261) (-2282.397) [-2270.616] (-2271.890) * (-2270.463) [-2274.086] (-2273.047) (-2281.190) -- 0:01:09
773500 -- [-2269.263] (-2274.584) (-2273.382) (-2278.962) * (-2273.005) (-2273.309) [-2275.475] (-2284.462) -- 0:01:09
774000 -- (-2281.815) (-2280.826) (-2263.113) [-2273.964] * [-2283.845] (-2276.232) (-2276.829) (-2288.809) -- 0:01:09
774500 -- (-2283.942) (-2277.910) (-2276.091) [-2274.094] * (-2273.209) (-2290.735) [-2277.432] (-2274.352) -- 0:01:09
775000 -- (-2272.071) (-2278.574) [-2269.023] (-2281.777) * (-2274.700) (-2277.052) (-2274.662) [-2273.446] -- 0:01:09
Average standard deviation of split frequencies: 0.010813
775500 -- (-2280.802) (-2277.330) (-2275.552) [-2271.523] * (-2270.168) (-2279.853) [-2272.356] (-2279.376) -- 0:01:08
776000 -- (-2284.761) (-2274.837) (-2268.432) [-2279.898] * (-2277.010) [-2276.203] (-2268.488) (-2290.602) -- 0:01:08
776500 -- [-2275.546] (-2273.177) (-2282.608) (-2286.974) * (-2273.686) (-2267.754) [-2269.727] (-2283.665) -- 0:01:08
777000 -- [-2273.348] (-2277.866) (-2277.706) (-2280.537) * (-2268.639) [-2275.001] (-2301.355) (-2273.089) -- 0:01:08
777500 -- (-2277.127) [-2276.753] (-2289.314) (-2275.610) * [-2265.023] (-2284.690) (-2282.771) (-2269.699) -- 0:01:08
778000 -- (-2277.513) [-2269.042] (-2285.656) (-2281.105) * (-2275.006) (-2268.726) [-2274.549] (-2274.820) -- 0:01:08
778500 -- (-2283.079) [-2274.893] (-2266.655) (-2287.671) * (-2283.734) (-2273.607) (-2271.628) [-2268.679] -- 0:01:08
779000 -- (-2281.708) (-2280.565) [-2271.342] (-2276.886) * (-2269.348) (-2281.049) [-2268.559] (-2272.506) -- 0:01:07
779500 -- (-2280.444) [-2271.893] (-2276.796) (-2274.461) * (-2267.078) [-2271.974] (-2264.789) (-2274.879) -- 0:01:07
780000 -- (-2274.811) (-2274.815) (-2282.704) [-2267.785] * (-2283.761) (-2273.434) [-2266.608] (-2275.854) -- 0:01:07
Average standard deviation of split frequencies: 0.009863
780500 -- (-2285.532) (-2285.753) [-2277.780] (-2272.520) * (-2280.639) [-2271.682] (-2276.512) (-2282.145) -- 0:01:07
781000 -- (-2276.645) (-2274.111) (-2272.205) [-2271.432] * (-2279.301) (-2272.285) [-2273.598] (-2272.517) -- 0:01:07
781500 -- [-2271.292] (-2274.986) (-2273.313) (-2281.165) * [-2268.628] (-2293.453) (-2274.010) (-2284.551) -- 0:01:07
782000 -- [-2270.617] (-2279.600) (-2295.105) (-2275.009) * (-2274.517) (-2273.843) (-2289.269) [-2265.604] -- 0:01:06
782500 -- (-2273.664) (-2280.024) [-2270.602] (-2277.795) * [-2269.176] (-2277.665) (-2285.671) (-2273.224) -- 0:01:06
783000 -- (-2282.058) (-2274.253) [-2271.310] (-2282.685) * (-2273.702) [-2275.593] (-2282.365) (-2280.227) -- 0:01:06
783500 -- (-2273.523) (-2282.670) (-2269.976) [-2268.113] * (-2276.673) [-2270.491] (-2278.581) (-2280.654) -- 0:01:06
784000 -- (-2284.427) [-2264.839] (-2271.395) (-2288.375) * (-2271.004) [-2275.349] (-2279.086) (-2289.461) -- 0:01:06
784500 -- (-2274.665) [-2279.474] (-2279.500) (-2273.722) * (-2284.789) (-2272.678) [-2272.998] (-2280.261) -- 0:01:06
785000 -- (-2280.814) (-2282.589) [-2278.766] (-2276.719) * (-2291.518) [-2267.539] (-2269.842) (-2280.562) -- 0:01:06
Average standard deviation of split frequencies: 0.009676
785500 -- (-2278.901) [-2269.146] (-2280.546) (-2266.746) * (-2289.452) (-2269.904) (-2272.799) [-2269.467] -- 0:01:05
786000 -- (-2279.527) (-2278.757) [-2273.935] (-2281.850) * (-2283.332) (-2291.898) (-2269.001) [-2271.432] -- 0:01:05
786500 -- [-2276.130] (-2289.473) (-2277.627) (-2275.651) * (-2267.893) [-2271.691] (-2270.632) (-2275.211) -- 0:01:05
787000 -- (-2274.092) (-2274.698) [-2270.904] (-2296.581) * (-2279.104) (-2269.522) [-2273.585] (-2267.467) -- 0:01:05
787500 -- (-2282.908) (-2280.929) (-2282.532) [-2280.525] * (-2271.269) (-2284.091) (-2273.880) [-2265.367] -- 0:01:05
788000 -- (-2277.965) [-2267.564] (-2274.727) (-2270.053) * (-2280.527) [-2274.187] (-2273.542) (-2270.689) -- 0:01:05
788500 -- (-2270.413) [-2267.504] (-2272.091) (-2268.849) * (-2271.870) (-2273.503) [-2267.436] (-2277.439) -- 0:01:04
789000 -- (-2281.089) (-2280.980) [-2274.893] (-2268.957) * [-2270.553] (-2269.402) (-2274.452) (-2283.563) -- 0:01:04
789500 -- (-2277.960) (-2274.495) (-2274.578) [-2274.701] * (-2275.262) (-2274.671) (-2268.618) [-2266.173] -- 0:01:04
790000 -- (-2265.117) (-2285.932) (-2294.061) [-2271.186] * (-2269.704) [-2271.588] (-2279.005) (-2280.777) -- 0:01:04
Average standard deviation of split frequencies: 0.009778
790500 -- (-2273.842) (-2269.280) (-2287.238) [-2263.157] * (-2275.740) (-2276.907) (-2267.286) [-2261.418] -- 0:01:04
791000 -- (-2287.411) [-2275.351] (-2275.398) (-2278.068) * (-2276.388) (-2279.768) (-2274.958) [-2269.607] -- 0:01:04
791500 -- [-2272.880] (-2280.389) (-2281.475) (-2264.401) * (-2279.901) (-2272.399) [-2274.169] (-2263.392) -- 0:01:04
792000 -- (-2271.539) [-2271.182] (-2287.672) (-2279.805) * (-2273.139) (-2275.715) [-2273.329] (-2281.286) -- 0:01:03
792500 -- (-2273.404) (-2267.254) (-2283.737) [-2276.910] * [-2273.831] (-2269.396) (-2279.602) (-2282.691) -- 0:01:03
793000 -- (-2273.848) (-2271.685) [-2267.414] (-2279.783) * (-2270.094) (-2275.500) (-2274.720) [-2277.970] -- 0:01:03
793500 -- (-2271.018) (-2284.020) [-2269.491] (-2276.363) * (-2277.161) (-2282.677) (-2276.414) [-2273.421] -- 0:01:03
794000 -- (-2285.834) (-2272.112) [-2269.114] (-2282.087) * (-2285.327) [-2268.147] (-2288.691) (-2286.318) -- 0:01:03
794500 -- (-2287.594) [-2269.642] (-2282.783) (-2282.585) * (-2284.632) (-2271.974) (-2278.086) [-2269.068] -- 0:01:03
795000 -- (-2282.890) (-2267.282) [-2270.632] (-2272.885) * (-2275.141) (-2274.466) (-2276.742) [-2267.198] -- 0:01:02
Average standard deviation of split frequencies: 0.009673
795500 -- (-2283.093) [-2266.977] (-2287.799) (-2276.977) * (-2273.996) (-2276.827) [-2274.548] (-2287.764) -- 0:01:02
796000 -- [-2271.342] (-2280.702) (-2275.484) (-2279.232) * (-2274.755) (-2275.524) (-2273.530) [-2277.506] -- 0:01:02
796500 -- (-2295.267) (-2278.447) [-2274.685] (-2273.044) * (-2269.087) (-2273.505) (-2273.439) [-2282.159] -- 0:01:02
797000 -- (-2293.511) (-2270.105) [-2271.061] (-2273.790) * (-2273.413) [-2272.027] (-2283.545) (-2280.189) -- 0:01:02
797500 -- (-2275.767) [-2281.230] (-2283.259) (-2290.387) * (-2273.203) [-2272.026] (-2276.353) (-2274.955) -- 0:01:02
798000 -- (-2268.062) [-2275.717] (-2278.336) (-2271.912) * (-2285.904) [-2269.060] (-2285.696) (-2278.811) -- 0:01:02
798500 -- [-2264.591] (-2268.409) (-2268.039) (-2273.689) * (-2266.649) [-2270.694] (-2300.388) (-2269.600) -- 0:01:01
799000 -- (-2285.913) [-2273.781] (-2270.744) (-2273.382) * (-2269.880) [-2270.888] (-2299.514) (-2266.600) -- 0:01:01
799500 -- (-2272.381) [-2263.371] (-2270.852) (-2284.011) * (-2270.567) [-2279.442] (-2299.224) (-2276.677) -- 0:01:01
800000 -- (-2271.296) (-2280.635) [-2269.764] (-2279.559) * [-2277.328] (-2289.769) (-2281.958) (-2275.884) -- 0:01:01
Average standard deviation of split frequencies: 0.009577
800500 -- (-2270.530) [-2283.681] (-2269.406) (-2273.715) * [-2275.432] (-2293.716) (-2282.592) (-2277.638) -- 0:01:01
801000 -- (-2275.682) (-2275.188) (-2286.775) [-2266.582] * [-2271.355] (-2275.524) (-2280.955) (-2293.143) -- 0:01:01
801500 -- (-2272.529) (-2277.341) [-2289.341] (-2269.468) * (-2270.465) [-2280.102] (-2278.295) (-2281.584) -- 0:01:00
802000 -- (-2275.298) (-2271.034) (-2276.764) [-2279.228] * (-2272.913) (-2281.097) [-2274.941] (-2282.857) -- 0:01:00
802500 -- (-2277.069) (-2276.985) [-2274.172] (-2271.334) * [-2266.246] (-2293.357) (-2283.174) (-2275.140) -- 0:01:00
803000 -- (-2278.703) (-2283.811) [-2274.205] (-2276.176) * (-2275.497) (-2272.174) (-2289.763) [-2282.993] -- 0:01:00
803500 -- (-2279.226) [-2270.985] (-2279.322) (-2279.973) * (-2280.926) (-2272.063) (-2282.613) [-2278.102] -- 0:01:00
804000 -- [-2275.887] (-2270.440) (-2271.597) (-2270.581) * (-2278.199) [-2274.752] (-2283.346) (-2274.330) -- 0:01:00
804500 -- (-2276.704) [-2270.215] (-2274.378) (-2282.982) * [-2274.041] (-2285.101) (-2271.252) (-2278.904) -- 0:01:00
805000 -- (-2274.744) (-2273.563) (-2276.067) [-2266.030] * (-2280.763) (-2281.017) (-2275.612) [-2272.961] -- 0:00:59
Average standard deviation of split frequencies: 0.009904
805500 -- (-2271.115) [-2268.540] (-2278.327) (-2272.116) * (-2276.367) [-2274.395] (-2274.982) (-2282.937) -- 0:00:59
806000 -- (-2269.708) (-2268.767) (-2276.152) [-2283.499] * (-2279.933) [-2270.948] (-2275.510) (-2274.593) -- 0:00:59
806500 -- (-2281.841) (-2272.515) [-2278.485] (-2272.949) * [-2276.230] (-2272.646) (-2270.877) (-2279.288) -- 0:00:59
807000 -- [-2268.718] (-2266.608) (-2288.301) (-2276.358) * (-2280.717) [-2277.917] (-2269.326) (-2276.481) -- 0:00:59
807500 -- (-2275.822) (-2276.110) [-2273.485] (-2267.750) * (-2283.914) (-2268.969) [-2270.195] (-2274.452) -- 0:00:59
808000 -- [-2272.220] (-2279.026) (-2271.704) (-2272.346) * (-2274.810) (-2267.968) (-2279.773) [-2270.098] -- 0:00:58
808500 -- [-2279.563] (-2275.071) (-2281.965) (-2268.443) * [-2274.236] (-2292.562) (-2284.816) (-2274.102) -- 0:00:58
809000 -- (-2272.649) (-2292.920) [-2268.790] (-2280.230) * (-2280.106) [-2274.987] (-2268.217) (-2269.066) -- 0:00:58
809500 -- (-2278.122) (-2277.702) (-2277.233) [-2270.908] * [-2265.366] (-2282.880) (-2280.261) (-2264.563) -- 0:00:58
810000 -- (-2271.903) (-2276.466) [-2278.120] (-2272.358) * (-2274.524) (-2286.911) [-2271.735] (-2269.585) -- 0:00:58
Average standard deviation of split frequencies: 0.009886
810500 -- (-2266.418) (-2274.732) (-2269.016) [-2272.145] * (-2279.485) [-2277.565] (-2268.575) (-2281.900) -- 0:00:58
811000 -- (-2274.107) (-2282.088) (-2267.845) [-2273.702] * (-2290.067) [-2276.861] (-2269.315) (-2275.899) -- 0:00:58
811500 -- (-2274.616) (-2288.671) [-2270.858] (-2271.012) * [-2277.642] (-2280.623) (-2276.808) (-2276.983) -- 0:00:57
812000 -- (-2289.131) (-2277.769) (-2266.837) [-2266.018] * (-2278.572) (-2269.788) [-2278.829] (-2279.633) -- 0:00:57
812500 -- (-2284.015) [-2271.222] (-2271.793) (-2279.125) * (-2280.376) (-2274.389) [-2269.984] (-2275.742) -- 0:00:57
813000 -- [-2265.009] (-2266.808) (-2282.812) (-2278.241) * (-2273.920) [-2273.110] (-2270.462) (-2279.497) -- 0:00:57
813500 -- (-2281.379) (-2276.661) [-2273.086] (-2278.518) * (-2289.325) (-2284.178) (-2281.366) [-2273.782] -- 0:00:57
814000 -- [-2274.050] (-2273.596) (-2273.776) (-2274.122) * [-2280.341] (-2282.591) (-2267.802) (-2290.790) -- 0:00:57
814500 -- (-2279.874) (-2275.293) (-2271.850) [-2276.463] * (-2288.542) (-2297.004) (-2276.144) [-2278.446] -- 0:00:56
815000 -- (-2272.375) [-2268.833] (-2269.983) (-2279.832) * (-2285.826) [-2286.305] (-2276.273) (-2277.119) -- 0:00:56
Average standard deviation of split frequencies: 0.010514
815500 -- [-2264.648] (-2272.840) (-2272.349) (-2273.073) * (-2293.139) (-2287.657) (-2276.367) [-2276.615] -- 0:00:56
816000 -- [-2264.280] (-2290.690) (-2278.579) (-2266.579) * (-2273.620) (-2283.305) (-2272.212) [-2269.715] -- 0:00:56
816500 -- (-2271.751) [-2277.019] (-2278.943) (-2278.201) * (-2270.053) [-2277.908] (-2279.810) (-2276.402) -- 0:00:56
817000 -- (-2267.751) (-2279.664) [-2261.572] (-2281.631) * (-2273.825) (-2287.013) [-2265.881] (-2281.001) -- 0:00:55
817500 -- (-2271.153) [-2281.697] (-2271.533) (-2285.438) * (-2282.647) (-2291.783) (-2278.056) [-2260.075] -- 0:00:56
818000 -- (-2285.434) [-2271.568] (-2273.045) (-2273.363) * [-2268.682] (-2282.553) (-2284.631) (-2271.713) -- 0:00:55
818500 -- (-2269.919) (-2272.227) (-2273.204) [-2273.594] * (-2288.025) (-2294.373) [-2269.266] (-2273.933) -- 0:00:55
819000 -- (-2281.163) [-2269.225] (-2264.059) (-2273.426) * (-2273.939) [-2271.900] (-2284.535) (-2274.944) -- 0:00:55
819500 -- (-2269.974) (-2272.983) [-2268.666] (-2288.843) * (-2279.027) (-2272.776) (-2281.764) [-2269.087] -- 0:00:55
820000 -- (-2282.235) (-2277.401) [-2273.191] (-2282.288) * (-2290.972) (-2271.900) (-2280.877) [-2270.945] -- 0:00:55
Average standard deviation of split frequencies: 0.010799
820500 -- (-2278.161) [-2268.247] (-2278.766) (-2276.283) * (-2289.674) (-2280.381) (-2283.796) [-2269.709] -- 0:00:54
821000 -- (-2269.971) (-2269.866) [-2273.561] (-2272.663) * (-2280.114) (-2265.376) [-2274.182] (-2262.249) -- 0:00:54
821500 -- (-2281.257) (-2272.128) [-2271.680] (-2280.476) * [-2274.976] (-2289.530) (-2271.800) (-2272.028) -- 0:00:54
822000 -- [-2271.153] (-2272.619) (-2275.337) (-2289.944) * [-2278.739] (-2287.194) (-2266.506) (-2271.208) -- 0:00:54
822500 -- [-2268.349] (-2288.601) (-2289.578) (-2271.227) * (-2281.088) (-2283.450) [-2268.780] (-2281.733) -- 0:00:54
823000 -- (-2275.666) (-2288.713) (-2283.078) [-2281.377] * (-2276.939) [-2270.905] (-2279.891) (-2273.199) -- 0:00:54
823500 -- (-2271.748) (-2296.331) [-2270.025] (-2275.804) * [-2272.873] (-2272.284) (-2283.633) (-2266.524) -- 0:00:54
824000 -- (-2275.251) [-2273.613] (-2272.086) (-2285.390) * (-2267.990) [-2271.976] (-2279.545) (-2265.344) -- 0:00:54
824500 -- (-2276.153) (-2278.836) (-2282.089) [-2274.329] * (-2264.094) [-2273.061] (-2282.814) (-2271.063) -- 0:00:53
825000 -- (-2281.423) (-2272.401) [-2266.507] (-2287.859) * (-2274.699) (-2272.315) (-2275.463) [-2274.478] -- 0:00:53
Average standard deviation of split frequencies: 0.010881
825500 -- (-2284.311) [-2276.250] (-2270.463) (-2283.566) * [-2274.637] (-2275.763) (-2272.059) (-2283.989) -- 0:00:53
826000 -- (-2278.554) [-2268.122] (-2276.434) (-2279.537) * (-2273.339) (-2275.338) (-2280.360) [-2266.852] -- 0:00:53
826500 -- (-2274.870) (-2275.430) (-2270.404) [-2271.901] * (-2277.024) (-2277.781) [-2279.152] (-2267.674) -- 0:00:53
827000 -- (-2266.552) (-2283.681) [-2269.219] (-2283.966) * [-2273.336] (-2270.152) (-2280.548) (-2266.367) -- 0:00:52
827500 -- (-2272.514) (-2272.611) (-2273.282) [-2269.435] * (-2283.075) (-2271.498) [-2269.493] (-2273.171) -- 0:00:52
828000 -- [-2269.204] (-2273.236) (-2275.830) (-2289.506) * [-2269.874] (-2280.121) (-2273.731) (-2274.243) -- 0:00:52
828500 -- (-2284.128) (-2277.011) [-2276.748] (-2278.130) * [-2282.336] (-2275.544) (-2279.175) (-2292.016) -- 0:00:52
829000 -- (-2270.366) (-2280.983) [-2273.232] (-2284.852) * (-2268.001) [-2270.495] (-2267.817) (-2276.437) -- 0:00:52
829500 -- (-2280.594) [-2273.244] (-2275.981) (-2269.919) * (-2268.129) (-2271.610) [-2271.200] (-2277.891) -- 0:00:52
830000 -- [-2273.965] (-2276.678) (-2277.873) (-2280.163) * [-2270.749] (-2265.322) (-2276.739) (-2276.299) -- 0:00:52
Average standard deviation of split frequencies: 0.010707
830500 -- [-2278.410] (-2282.104) (-2280.515) (-2285.031) * (-2271.127) [-2279.347] (-2284.996) (-2272.170) -- 0:00:51
831000 -- [-2275.868] (-2267.310) (-2270.783) (-2279.838) * [-2273.081] (-2272.345) (-2282.623) (-2270.143) -- 0:00:51
831500 -- (-2274.013) (-2277.819) (-2283.022) [-2270.900] * (-2289.253) [-2269.853] (-2274.037) (-2274.456) -- 0:00:51
832000 -- [-2271.787] (-2274.244) (-2278.817) (-2278.087) * [-2280.415] (-2275.012) (-2274.227) (-2284.097) -- 0:00:51
832500 -- [-2271.872] (-2277.816) (-2269.736) (-2276.350) * (-2269.243) (-2273.808) [-2287.643] (-2280.427) -- 0:00:51
833000 -- (-2272.526) (-2279.135) [-2272.172] (-2278.668) * (-2282.101) [-2273.825] (-2269.440) (-2280.015) -- 0:00:51
833500 -- (-2274.382) (-2276.431) (-2277.193) [-2270.518] * (-2287.949) (-2278.658) (-2279.987) [-2277.211] -- 0:00:50
834000 -- [-2263.201] (-2270.476) (-2277.056) (-2276.749) * (-2276.256) (-2290.661) (-2269.057) [-2273.383] -- 0:00:50
834500 -- (-2272.329) (-2270.587) [-2272.973] (-2272.961) * (-2277.200) (-2277.589) (-2282.802) [-2276.160] -- 0:00:50
835000 -- (-2278.995) (-2266.181) [-2273.647] (-2271.042) * [-2276.142] (-2277.900) (-2271.971) (-2279.266) -- 0:00:50
Average standard deviation of split frequencies: 0.011578
835500 -- (-2276.562) (-2283.417) (-2274.122) [-2267.671] * (-2289.979) (-2275.935) (-2285.181) [-2270.788] -- 0:00:50
836000 -- (-2271.440) [-2277.857] (-2285.121) (-2271.094) * (-2287.625) [-2269.877] (-2286.211) (-2284.104) -- 0:00:50
836500 -- (-2273.567) (-2286.285) (-2280.656) [-2268.384] * (-2284.079) [-2283.006] (-2277.908) (-2280.859) -- 0:00:50
837000 -- (-2275.835) (-2298.682) (-2276.986) [-2265.455] * (-2274.562) (-2269.594) (-2267.207) [-2274.345] -- 0:00:49
837500 -- (-2281.279) (-2287.302) [-2275.575] (-2280.189) * (-2286.600) (-2279.113) [-2269.787] (-2274.603) -- 0:00:49
838000 -- (-2266.346) (-2293.674) [-2278.925] (-2280.444) * (-2270.218) (-2277.084) [-2268.221] (-2277.409) -- 0:00:49
838500 -- [-2267.399] (-2270.957) (-2287.849) (-2267.691) * [-2273.049] (-2270.531) (-2273.847) (-2275.380) -- 0:00:49
839000 -- (-2272.296) (-2282.453) (-2270.388) [-2272.844] * (-2268.809) (-2276.438) [-2271.337] (-2268.343) -- 0:00:49
839500 -- (-2274.149) [-2277.129] (-2274.241) (-2268.913) * (-2273.365) [-2276.986] (-2274.755) (-2275.040) -- 0:00:49
840000 -- [-2274.946] (-2279.985) (-2286.769) (-2284.848) * (-2281.241) (-2267.442) [-2264.661] (-2285.495) -- 0:00:48
Average standard deviation of split frequencies: 0.011439
840500 -- (-2277.980) [-2277.673] (-2272.964) (-2289.763) * (-2281.732) [-2274.470] (-2273.646) (-2265.833) -- 0:00:48
841000 -- (-2277.531) [-2276.062] (-2285.410) (-2274.311) * [-2270.306] (-2275.505) (-2271.534) (-2286.188) -- 0:00:48
841500 -- [-2270.385] (-2273.166) (-2283.968) (-2264.990) * [-2279.776] (-2280.218) (-2263.328) (-2275.660) -- 0:00:48
842000 -- (-2274.130) (-2276.337) (-2287.900) [-2272.089] * [-2271.191] (-2276.597) (-2265.514) (-2284.627) -- 0:00:48
842500 -- (-2278.647) [-2270.844] (-2276.406) (-2270.036) * [-2267.786] (-2289.325) (-2283.464) (-2278.396) -- 0:00:48
843000 -- (-2279.755) [-2265.931] (-2274.972) (-2273.172) * (-2277.416) (-2278.461) (-2288.353) [-2271.035] -- 0:00:48
843500 -- (-2270.767) (-2284.618) (-2271.465) [-2272.315] * (-2265.989) [-2270.982] (-2281.863) (-2288.340) -- 0:00:47
844000 -- [-2278.425] (-2274.278) (-2272.362) (-2280.096) * (-2277.527) (-2285.283) (-2274.000) [-2267.849] -- 0:00:47
844500 -- [-2266.604] (-2280.778) (-2276.186) (-2278.599) * (-2277.341) [-2274.084] (-2274.456) (-2281.428) -- 0:00:47
845000 -- (-2280.379) [-2272.807] (-2269.363) (-2288.753) * [-2266.820] (-2281.877) (-2288.525) (-2274.269) -- 0:00:47
Average standard deviation of split frequencies: 0.011702
845500 -- (-2277.547) (-2272.198) [-2273.843] (-2284.251) * (-2270.515) [-2279.269] (-2282.552) (-2279.998) -- 0:00:47
846000 -- (-2277.834) [-2275.467] (-2281.038) (-2285.058) * (-2274.341) (-2286.577) [-2273.136] (-2279.499) -- 0:00:47
846500 -- [-2271.570] (-2268.786) (-2269.891) (-2275.193) * (-2274.098) [-2273.985] (-2279.217) (-2274.575) -- 0:00:46
847000 -- (-2279.243) (-2278.830) (-2274.428) [-2272.702] * [-2267.376] (-2280.164) (-2276.279) (-2287.574) -- 0:00:46
847500 -- (-2289.643) [-2268.681] (-2283.594) (-2279.110) * (-2290.945) (-2275.199) [-2272.585] (-2277.637) -- 0:00:46
848000 -- (-2274.431) (-2275.343) (-2283.557) [-2270.363] * (-2272.945) [-2270.121] (-2277.017) (-2279.895) -- 0:00:46
848500 -- (-2276.221) [-2269.662] (-2275.263) (-2284.934) * (-2275.105) (-2284.979) (-2274.968) [-2273.835] -- 0:00:46
849000 -- (-2274.915) [-2274.575] (-2270.570) (-2275.242) * (-2276.777) (-2277.589) [-2268.937] (-2277.251) -- 0:00:46
849500 -- (-2281.771) (-2273.002) [-2276.984] (-2279.001) * (-2280.926) (-2276.998) (-2275.661) [-2280.477] -- 0:00:46
850000 -- (-2271.897) (-2277.507) (-2277.900) [-2269.881] * (-2267.376) (-2282.779) (-2271.828) [-2271.010] -- 0:00:45
Average standard deviation of split frequencies: 0.011711
850500 -- (-2277.963) [-2277.473] (-2275.952) (-2270.180) * (-2274.572) (-2268.463) [-2273.349] (-2278.974) -- 0:00:45
851000 -- (-2280.379) [-2273.061] (-2269.284) (-2266.301) * (-2272.930) [-2269.262] (-2281.360) (-2273.760) -- 0:00:45
851500 -- (-2291.314) (-2271.751) (-2272.810) [-2270.830] * (-2277.940) (-2282.652) [-2268.181] (-2284.020) -- 0:00:45
852000 -- (-2278.486) (-2269.577) [-2269.240] (-2276.868) * [-2270.892] (-2284.937) (-2271.931) (-2269.828) -- 0:00:45
852500 -- (-2275.212) (-2279.727) [-2276.375] (-2282.137) * (-2279.648) [-2269.876] (-2277.027) (-2274.334) -- 0:00:45
853000 -- (-2274.130) [-2270.151] (-2285.472) (-2280.920) * (-2276.389) (-2274.954) [-2275.065] (-2267.541) -- 0:00:44
853500 -- (-2281.672) (-2272.245) [-2267.362] (-2279.173) * (-2275.369) [-2268.724] (-2277.613) (-2282.245) -- 0:00:44
854000 -- (-2275.571) (-2277.165) [-2279.901] (-2275.686) * [-2266.736] (-2278.662) (-2272.838) (-2279.468) -- 0:00:44
854500 -- (-2272.646) [-2269.973] (-2280.992) (-2272.744) * [-2270.775] (-2287.731) (-2266.642) (-2291.924) -- 0:00:44
855000 -- [-2263.756] (-2276.684) (-2279.213) (-2277.647) * (-2271.590) [-2281.040] (-2283.351) (-2274.259) -- 0:00:44
Average standard deviation of split frequencies: 0.012152
855500 -- (-2272.177) [-2275.014] (-2271.043) (-2266.444) * [-2279.421] (-2285.647) (-2268.329) (-2273.942) -- 0:00:44
856000 -- (-2265.682) (-2290.467) (-2278.765) [-2271.841] * (-2276.095) (-2280.686) [-2264.419] (-2268.249) -- 0:00:44
856500 -- [-2283.477] (-2275.425) (-2269.620) (-2280.027) * (-2278.943) [-2273.578] (-2272.738) (-2276.216) -- 0:00:43
857000 -- (-2267.090) (-2275.854) (-2285.506) [-2277.200] * (-2282.445) [-2274.125] (-2270.968) (-2274.034) -- 0:00:43
857500 -- [-2274.883] (-2291.375) (-2272.863) (-2279.953) * (-2280.760) (-2278.809) (-2269.992) [-2268.996] -- 0:00:43
858000 -- (-2278.321) (-2277.490) (-2275.017) [-2264.983] * (-2271.738) (-2275.218) (-2282.538) [-2276.086] -- 0:00:43
858500 -- (-2301.249) (-2282.120) [-2280.656] (-2281.339) * [-2275.872] (-2274.925) (-2276.191) (-2274.787) -- 0:00:43
859000 -- [-2288.164] (-2283.482) (-2282.815) (-2263.796) * (-2271.687) (-2285.266) [-2269.257] (-2275.640) -- 0:00:43
859500 -- (-2286.272) (-2291.059) [-2266.210] (-2275.165) * (-2287.405) [-2276.122] (-2269.841) (-2287.543) -- 0:00:42
860000 -- [-2275.945] (-2297.370) (-2272.158) (-2270.872) * (-2270.721) (-2277.019) [-2276.437] (-2279.171) -- 0:00:42
Average standard deviation of split frequencies: 0.011721
860500 -- (-2284.849) (-2294.653) (-2275.507) [-2269.947] * (-2287.776) [-2266.215] (-2276.658) (-2278.164) -- 0:00:42
861000 -- (-2290.886) (-2291.758) (-2278.587) [-2274.125] * (-2289.153) (-2266.552) [-2277.551] (-2276.487) -- 0:00:42
861500 -- (-2283.412) [-2277.509] (-2282.663) (-2282.995) * [-2265.291] (-2281.682) (-2282.344) (-2282.689) -- 0:00:42
862000 -- (-2283.617) (-2272.117) [-2264.975] (-2281.220) * (-2274.558) (-2275.168) (-2273.099) [-2285.102] -- 0:00:42
862500 -- (-2271.836) (-2272.520) [-2261.203] (-2290.328) * (-2282.079) (-2284.978) (-2277.982) [-2280.698] -- 0:00:42
863000 -- (-2287.916) (-2271.366) (-2277.884) [-2282.583] * (-2277.189) (-2286.104) (-2281.258) [-2274.729] -- 0:00:41
863500 -- (-2278.709) (-2276.495) (-2276.485) [-2271.605] * (-2282.248) (-2281.783) [-2270.921] (-2277.851) -- 0:00:41
864000 -- (-2276.369) (-2276.829) [-2288.363] (-2268.253) * (-2272.778) (-2275.726) (-2268.727) [-2269.962] -- 0:00:41
864500 -- (-2286.689) (-2267.457) [-2265.483] (-2269.445) * (-2274.312) [-2267.079] (-2290.236) (-2281.757) -- 0:00:41
865000 -- (-2275.101) (-2275.159) (-2269.433) [-2268.617] * (-2284.034) (-2274.102) (-2277.275) [-2266.971] -- 0:00:41
Average standard deviation of split frequencies: 0.012157
865500 -- (-2276.123) (-2275.838) (-2283.143) [-2264.064] * (-2281.043) [-2277.204] (-2274.526) (-2269.146) -- 0:00:41
866000 -- (-2277.608) [-2271.886] (-2271.082) (-2267.876) * (-2290.402) [-2275.870] (-2274.373) (-2276.133) -- 0:00:41
866500 -- (-2275.249) (-2275.737) (-2284.656) [-2265.362] * [-2267.406] (-2281.870) (-2269.783) (-2270.325) -- 0:00:40
867000 -- [-2278.411] (-2273.004) (-2273.375) (-2272.917) * (-2268.835) [-2272.039] (-2278.764) (-2272.539) -- 0:00:40
867500 -- [-2276.214] (-2270.663) (-2281.048) (-2267.011) * [-2273.850] (-2271.538) (-2279.297) (-2277.017) -- 0:00:40
868000 -- (-2288.392) [-2278.796] (-2284.093) (-2276.787) * (-2273.725) [-2269.517] (-2275.560) (-2287.372) -- 0:00:40
868500 -- [-2271.401] (-2274.994) (-2277.669) (-2286.851) * (-2283.322) (-2267.955) (-2277.101) [-2283.605] -- 0:00:40
869000 -- [-2287.258] (-2277.380) (-2276.338) (-2283.948) * (-2288.584) (-2271.615) [-2276.878] (-2291.479) -- 0:00:40
869500 -- (-2271.418) [-2284.405] (-2279.256) (-2277.833) * (-2273.702) [-2269.937] (-2284.805) (-2266.531) -- 0:00:39
870000 -- (-2280.095) (-2287.470) [-2282.071] (-2283.246) * (-2278.894) (-2273.882) (-2276.332) [-2269.441] -- 0:00:39
Average standard deviation of split frequencies: 0.011514
870500 -- (-2268.590) [-2273.219] (-2278.823) (-2275.763) * (-2281.475) [-2268.694] (-2274.422) (-2278.272) -- 0:00:39
871000 -- (-2274.947) [-2277.391] (-2277.308) (-2276.766) * (-2280.118) (-2278.666) (-2274.675) [-2263.895] -- 0:00:39
871500 -- [-2264.532] (-2281.741) (-2272.674) (-2292.001) * (-2289.119) (-2275.973) (-2278.944) [-2281.071] -- 0:00:39
872000 -- (-2275.789) (-2275.920) [-2280.146] (-2287.907) * (-2279.977) (-2274.931) (-2289.233) [-2277.195] -- 0:00:39
872500 -- (-2273.952) (-2274.814) (-2279.151) [-2276.228] * [-2273.467] (-2288.991) (-2280.731) (-2279.197) -- 0:00:39
873000 -- [-2268.761] (-2272.277) (-2276.718) (-2274.723) * [-2272.132] (-2280.657) (-2275.784) (-2279.789) -- 0:00:38
873500 -- (-2277.329) (-2280.705) (-2277.520) [-2263.578] * (-2283.796) (-2293.294) [-2266.600] (-2272.846) -- 0:00:38
874000 -- (-2270.822) (-2278.341) (-2276.094) [-2277.030] * (-2281.513) (-2267.661) [-2266.831] (-2278.528) -- 0:00:38
874500 -- [-2275.841] (-2282.099) (-2284.368) (-2286.162) * (-2288.426) [-2275.070] (-2272.452) (-2281.553) -- 0:00:38
875000 -- [-2269.657] (-2285.447) (-2285.693) (-2275.711) * (-2282.178) (-2269.181) [-2277.603] (-2281.967) -- 0:00:38
Average standard deviation of split frequencies: 0.011444
875500 -- (-2266.351) (-2280.177) (-2275.227) [-2267.989] * (-2274.759) [-2276.144] (-2269.939) (-2275.861) -- 0:00:37
876000 -- (-2281.953) [-2268.435] (-2272.175) (-2275.653) * (-2294.266) [-2275.248] (-2269.122) (-2273.940) -- 0:00:37
876500 -- (-2275.115) (-2279.034) (-2269.992) [-2265.820] * (-2277.753) (-2275.706) [-2268.857] (-2276.969) -- 0:00:37
877000 -- (-2281.007) [-2276.611] (-2275.290) (-2283.966) * [-2274.123] (-2281.201) (-2278.889) (-2269.245) -- 0:00:37
877500 -- (-2277.135) (-2288.943) (-2283.618) [-2280.200] * (-2281.575) (-2276.831) [-2279.319] (-2284.802) -- 0:00:37
878000 -- (-2272.891) [-2277.105] (-2276.898) (-2274.754) * [-2280.625] (-2283.081) (-2278.182) (-2269.983) -- 0:00:37
878500 -- (-2283.622) (-2271.911) (-2286.081) [-2273.894] * [-2268.504] (-2286.135) (-2268.280) (-2286.467) -- 0:00:37
879000 -- (-2287.162) [-2272.569] (-2288.562) (-2272.875) * [-2270.038] (-2283.252) (-2295.590) (-2272.954) -- 0:00:36
879500 -- [-2269.763] (-2277.778) (-2274.996) (-2276.649) * [-2273.429] (-2274.229) (-2280.563) (-2279.802) -- 0:00:36
880000 -- (-2277.378) [-2267.488] (-2288.894) (-2264.970) * (-2275.413) (-2274.591) [-2276.378] (-2287.754) -- 0:00:36
Average standard deviation of split frequencies: 0.011526
880500 -- (-2284.685) [-2278.066] (-2287.552) (-2266.329) * (-2283.892) (-2272.099) [-2274.336] (-2292.987) -- 0:00:36
881000 -- [-2284.771] (-2267.364) (-2279.378) (-2280.925) * (-2285.205) [-2269.358] (-2282.645) (-2270.887) -- 0:00:36
881500 -- (-2284.117) [-2272.782] (-2275.253) (-2277.011) * (-2278.284) (-2281.579) (-2280.358) [-2269.348] -- 0:00:36
882000 -- (-2277.989) (-2276.938) [-2273.015] (-2272.744) * (-2273.346) (-2286.379) [-2277.102] (-2271.804) -- 0:00:35
882500 -- (-2276.872) [-2281.979] (-2270.122) (-2280.773) * (-2278.801) (-2275.990) (-2281.100) [-2268.825] -- 0:00:35
883000 -- (-2281.984) (-2276.453) (-2277.495) [-2271.566] * (-2276.608) (-2272.672) (-2276.614) [-2277.037] -- 0:00:35
883500 -- (-2267.932) [-2270.088] (-2273.029) (-2271.979) * (-2274.965) [-2267.584] (-2272.040) (-2275.325) -- 0:00:35
884000 -- [-2271.550] (-2278.594) (-2277.304) (-2271.050) * (-2282.524) (-2277.977) [-2269.044] (-2270.354) -- 0:00:35
884500 -- (-2285.318) (-2272.111) (-2284.633) [-2269.274] * [-2269.544] (-2286.154) (-2276.499) (-2279.764) -- 0:00:35
885000 -- (-2275.392) [-2264.326] (-2277.075) (-2276.001) * (-2276.954) (-2280.531) [-2270.444] (-2289.086) -- 0:00:35
Average standard deviation of split frequencies: 0.011492
885500 -- (-2264.905) (-2280.749) [-2271.007] (-2273.846) * (-2284.316) (-2270.266) [-2267.605] (-2286.282) -- 0:00:35
886000 -- [-2266.241] (-2281.608) (-2286.351) (-2270.249) * (-2269.122) (-2274.521) [-2278.697] (-2277.300) -- 0:00:34
886500 -- (-2287.319) [-2266.424] (-2277.123) (-2279.870) * (-2266.307) (-2278.635) [-2278.124] (-2271.529) -- 0:00:34
887000 -- [-2274.577] (-2277.856) (-2280.828) (-2286.294) * [-2271.316] (-2285.503) (-2280.658) (-2278.694) -- 0:00:34
887500 -- (-2270.108) (-2272.683) (-2292.485) [-2282.343] * [-2270.181] (-2272.161) (-2276.918) (-2279.642) -- 0:00:34
888000 -- [-2272.570] (-2283.163) (-2277.639) (-2276.767) * (-2282.551) (-2274.158) [-2271.242] (-2287.170) -- 0:00:34
888500 -- (-2267.724) [-2273.094] (-2277.126) (-2271.420) * (-2269.532) (-2269.755) [-2269.283] (-2269.967) -- 0:00:34
889000 -- (-2270.492) [-2272.315] (-2278.003) (-2291.093) * (-2271.378) (-2270.736) (-2272.005) [-2263.844] -- 0:00:33
889500 -- (-2281.531) (-2279.807) [-2275.897] (-2277.900) * (-2276.903) (-2274.205) [-2264.976] (-2289.975) -- 0:00:33
890000 -- [-2268.143] (-2275.591) (-2283.391) (-2287.603) * (-2272.541) [-2265.905] (-2274.562) (-2278.693) -- 0:00:33
Average standard deviation of split frequencies: 0.010727
890500 -- [-2266.825] (-2282.911) (-2284.256) (-2271.507) * (-2276.660) (-2270.868) [-2264.867] (-2275.848) -- 0:00:33
891000 -- [-2272.769] (-2283.418) (-2273.360) (-2276.485) * (-2285.080) (-2279.788) (-2265.575) [-2262.657] -- 0:00:33
891500 -- (-2267.125) (-2273.830) (-2283.099) [-2270.752] * (-2269.905) (-2282.865) [-2271.991] (-2278.612) -- 0:00:33
892000 -- (-2275.142) [-2267.314] (-2281.566) (-2275.855) * [-2267.198] (-2268.863) (-2271.640) (-2290.067) -- 0:00:32
892500 -- (-2282.183) [-2273.204] (-2276.207) (-2287.971) * (-2275.959) [-2282.206] (-2275.798) (-2272.940) -- 0:00:32
893000 -- (-2280.092) (-2274.387) [-2276.907] (-2284.571) * (-2300.342) (-2277.363) (-2273.300) [-2264.629] -- 0:00:32
893500 -- [-2280.114] (-2274.053) (-2278.464) (-2280.347) * [-2270.998] (-2272.962) (-2271.297) (-2283.391) -- 0:00:32
894000 -- (-2272.147) (-2279.536) (-2284.191) [-2270.324] * [-2274.342] (-2283.858) (-2282.865) (-2275.043) -- 0:00:32
894500 -- (-2281.882) [-2283.199] (-2280.791) (-2270.876) * (-2281.908) (-2274.651) [-2273.680] (-2272.738) -- 0:00:32
895000 -- (-2273.244) (-2275.389) [-2280.964] (-2274.178) * (-2278.183) (-2271.085) (-2278.983) [-2278.041] -- 0:00:32
Average standard deviation of split frequencies: 0.010593
895500 -- (-2269.869) (-2279.862) (-2282.512) [-2268.091] * (-2291.260) (-2268.785) (-2275.910) [-2286.567] -- 0:00:31
896000 -- [-2276.126] (-2280.259) (-2272.788) (-2265.541) * (-2281.384) [-2277.302] (-2273.160) (-2288.165) -- 0:00:31
896500 -- (-2276.253) (-2278.484) [-2271.253] (-2277.593) * (-2278.137) (-2274.450) [-2268.219] (-2292.944) -- 0:00:31
897000 -- (-2272.738) (-2296.437) (-2266.622) [-2273.383] * (-2275.097) (-2279.860) [-2278.927] (-2292.286) -- 0:00:31
897500 -- [-2271.133] (-2272.042) (-2275.652) (-2271.256) * (-2283.062) (-2271.222) [-2269.710] (-2273.884) -- 0:00:31
898000 -- (-2265.967) (-2277.285) (-2270.922) [-2270.858] * (-2275.642) [-2280.552] (-2266.095) (-2278.152) -- 0:00:31
898500 -- (-2272.687) [-2265.398] (-2279.824) (-2278.980) * (-2269.257) (-2280.060) [-2274.023] (-2283.162) -- 0:00:30
899000 -- (-2264.684) (-2285.872) (-2277.530) [-2269.634] * (-2285.222) (-2273.850) (-2273.441) [-2270.762] -- 0:00:30
899500 -- (-2268.339) (-2276.468) (-2300.676) [-2281.401] * (-2277.410) [-2264.435] (-2270.162) (-2280.244) -- 0:00:30
900000 -- (-2270.817) [-2267.759] (-2280.984) (-2286.885) * (-2285.508) (-2281.959) (-2274.972) [-2272.287] -- 0:00:30
Average standard deviation of split frequencies: 0.010468
900500 -- (-2268.065) (-2271.069) [-2278.617] (-2287.261) * (-2273.760) (-2276.750) (-2281.961) [-2272.176] -- 0:00:30
901000 -- (-2288.194) [-2284.167] (-2279.998) (-2286.576) * (-2275.458) [-2274.085] (-2267.758) (-2280.751) -- 0:00:30
901500 -- (-2271.392) [-2282.769] (-2291.607) (-2287.728) * (-2274.725) (-2270.068) [-2271.700] (-2282.296) -- 0:00:30
902000 -- [-2273.600] (-2274.508) (-2269.384) (-2277.586) * [-2272.095] (-2281.771) (-2271.047) (-2280.665) -- 0:00:29
902500 -- (-2266.957) (-2275.654) (-2270.016) [-2271.452] * (-2277.937) (-2271.179) (-2275.659) [-2264.449] -- 0:00:29
903000 -- [-2284.263] (-2274.109) (-2284.318) (-2274.186) * (-2276.849) (-2269.220) (-2280.333) [-2277.988] -- 0:00:29
903500 -- [-2274.541] (-2278.636) (-2278.059) (-2275.034) * (-2284.515) (-2269.662) (-2289.820) [-2272.877] -- 0:00:29
904000 -- [-2268.280] (-2279.603) (-2268.053) (-2291.708) * (-2273.181) [-2274.771] (-2281.380) (-2280.748) -- 0:00:29
904500 -- [-2269.454] (-2280.941) (-2276.387) (-2273.606) * [-2265.122] (-2267.991) (-2278.945) (-2275.477) -- 0:00:29
905000 -- (-2266.105) (-2277.771) [-2278.244] (-2273.961) * (-2273.541) [-2261.473] (-2277.325) (-2278.393) -- 0:00:28
Average standard deviation of split frequencies: 0.010580
905500 -- (-2272.846) (-2275.210) (-2275.830) [-2273.086] * [-2266.823] (-2276.667) (-2279.996) (-2266.910) -- 0:00:28
906000 -- [-2269.564] (-2280.259) (-2274.019) (-2285.262) * [-2266.297] (-2274.677) (-2291.298) (-2273.776) -- 0:00:28
906500 -- (-2280.607) (-2273.775) [-2274.073] (-2282.094) * [-2275.730] (-2276.884) (-2276.058) (-2274.788) -- 0:00:28
907000 -- (-2270.614) [-2271.676] (-2277.311) (-2274.652) * [-2275.627] (-2275.613) (-2281.087) (-2285.068) -- 0:00:28
907500 -- (-2271.597) (-2291.409) (-2279.034) [-2275.642] * (-2272.095) (-2282.686) (-2282.460) [-2269.823] -- 0:00:28
908000 -- (-2273.781) (-2283.888) [-2272.208] (-2288.891) * (-2271.252) [-2270.833] (-2275.484) (-2263.623) -- 0:00:28
908500 -- [-2269.628] (-2275.868) (-2290.016) (-2270.407) * (-2276.602) (-2279.572) [-2273.558] (-2276.434) -- 0:00:27
909000 -- (-2269.658) (-2282.127) [-2274.144] (-2291.785) * (-2264.988) [-2278.958] (-2276.655) (-2278.101) -- 0:00:27
909500 -- (-2277.904) [-2278.648] (-2277.783) (-2281.045) * (-2271.513) (-2281.172) [-2269.171] (-2277.415) -- 0:00:27
910000 -- (-2269.223) [-2272.027] (-2272.942) (-2284.955) * (-2274.634) (-2282.661) [-2265.375] (-2279.443) -- 0:00:27
Average standard deviation of split frequencies: 0.010595
910500 -- (-2280.195) (-2288.336) (-2278.272) [-2278.263] * (-2273.539) (-2268.135) [-2272.307] (-2281.382) -- 0:00:27
911000 -- (-2277.974) [-2274.906] (-2276.042) (-2278.826) * (-2281.035) (-2265.788) (-2277.689) [-2270.849] -- 0:00:27
911500 -- (-2281.910) (-2291.748) [-2287.494] (-2269.368) * (-2282.204) (-2278.110) (-2277.442) [-2274.507] -- 0:00:26
912000 -- (-2283.948) (-2274.853) (-2285.482) [-2270.210] * [-2269.990] (-2272.992) (-2272.800) (-2278.354) -- 0:00:26
912500 -- (-2272.861) [-2268.600] (-2291.056) (-2285.094) * (-2282.413) (-2270.131) (-2274.184) [-2275.735] -- 0:00:26
913000 -- (-2275.917) (-2274.636) [-2274.696] (-2280.700) * (-2283.069) (-2287.281) (-2280.944) [-2275.105] -- 0:00:26
913500 -- (-2276.167) (-2280.991) (-2279.418) [-2279.916] * (-2284.765) (-2288.126) [-2283.636] (-2294.278) -- 0:00:26
914000 -- (-2276.010) [-2275.054] (-2279.051) (-2272.421) * [-2271.363] (-2268.059) (-2269.172) (-2270.945) -- 0:00:26
914500 -- (-2273.541) (-2267.763) (-2275.456) [-2264.811] * (-2277.930) [-2268.683] (-2273.165) (-2280.988) -- 0:00:26
915000 -- [-2270.777] (-2264.761) (-2279.996) (-2267.814) * (-2278.043) [-2263.230] (-2262.747) (-2284.059) -- 0:00:25
Average standard deviation of split frequencies: 0.010361
915500 -- [-2275.205] (-2269.139) (-2284.006) (-2267.997) * (-2272.681) (-2274.724) (-2282.791) [-2273.553] -- 0:00:25
916000 -- (-2270.414) (-2269.464) [-2271.814] (-2285.858) * (-2279.858) [-2270.984] (-2298.025) (-2274.948) -- 0:00:25
916500 -- [-2270.619] (-2267.887) (-2279.571) (-2272.345) * (-2280.125) (-2272.196) (-2279.143) [-2271.076] -- 0:00:25
917000 -- (-2274.756) (-2269.067) (-2270.111) [-2272.165] * (-2266.348) (-2276.699) [-2271.921] (-2277.678) -- 0:00:25
917500 -- [-2277.655] (-2272.428) (-2269.943) (-2269.680) * (-2266.845) [-2273.431] (-2269.038) (-2285.396) -- 0:00:25
918000 -- (-2278.077) (-2278.356) [-2279.226] (-2268.568) * (-2288.136) (-2285.744) [-2267.099] (-2277.143) -- 0:00:24
918500 -- [-2272.024] (-2273.397) (-2294.382) (-2279.258) * (-2271.858) [-2283.975] (-2284.911) (-2269.860) -- 0:00:24
919000 -- (-2274.317) [-2272.784] (-2272.072) (-2269.588) * [-2275.226] (-2281.328) (-2269.171) (-2276.700) -- 0:00:24
919500 -- (-2272.963) (-2285.747) (-2273.683) [-2268.471] * (-2288.444) [-2277.043] (-2270.124) (-2282.163) -- 0:00:24
920000 -- (-2283.945) [-2278.588] (-2281.370) (-2270.699) * (-2271.743) (-2272.628) (-2266.135) [-2268.883] -- 0:00:24
Average standard deviation of split frequencies: 0.011401
920500 -- (-2280.981) (-2288.408) [-2270.126] (-2271.005) * (-2272.766) (-2277.607) (-2271.744) [-2268.636] -- 0:00:24
921000 -- (-2278.656) [-2275.779] (-2274.539) (-2267.600) * [-2269.947] (-2278.844) (-2282.049) (-2272.122) -- 0:00:24
921500 -- (-2282.028) (-2288.407) [-2277.952] (-2272.402) * (-2275.476) (-2272.340) (-2284.384) [-2270.048] -- 0:00:23
922000 -- (-2279.926) (-2277.549) [-2270.649] (-2268.671) * (-2277.170) (-2276.607) [-2276.584] (-2276.998) -- 0:00:23
922500 -- (-2273.156) (-2282.180) (-2264.929) [-2286.246] * (-2278.216) (-2281.676) [-2281.525] (-2285.816) -- 0:00:23
923000 -- (-2275.251) (-2277.650) (-2277.008) [-2279.228] * [-2269.879] (-2280.070) (-2274.073) (-2275.089) -- 0:00:23
923500 -- (-2283.719) (-2272.472) (-2265.639) [-2271.912] * [-2274.110] (-2284.288) (-2276.689) (-2283.309) -- 0:00:23
924000 -- [-2283.669] (-2271.367) (-2279.168) (-2277.899) * (-2276.463) [-2266.621] (-2277.111) (-2274.018) -- 0:00:23
924500 -- (-2273.188) (-2276.656) (-2289.299) [-2279.233] * (-2276.977) [-2273.040] (-2277.523) (-2281.889) -- 0:00:22
925000 -- [-2281.252] (-2278.123) (-2269.060) (-2292.526) * (-2283.566) (-2270.962) (-2274.612) [-2276.190] -- 0:00:22
Average standard deviation of split frequencies: 0.011064
925500 -- (-2265.190) (-2302.001) (-2273.340) [-2276.897] * [-2283.592] (-2269.211) (-2280.053) (-2279.645) -- 0:00:22
926000 -- (-2270.208) [-2278.945] (-2284.902) (-2288.812) * (-2269.658) [-2268.294] (-2273.598) (-2270.178) -- 0:00:22
926500 -- (-2275.403) (-2266.712) [-2264.193] (-2279.643) * (-2272.431) [-2275.409] (-2287.355) (-2276.222) -- 0:00:22
927000 -- (-2273.305) (-2263.058) (-2283.287) [-2268.529] * (-2280.558) (-2285.229) (-2284.029) [-2279.692] -- 0:00:22
927500 -- (-2267.628) (-2274.164) [-2266.203] (-2272.420) * (-2294.490) [-2267.810] (-2286.052) (-2273.139) -- 0:00:22
928000 -- (-2272.231) (-2282.682) (-2276.933) [-2271.109] * (-2290.990) [-2264.000] (-2276.997) (-2281.136) -- 0:00:21
928500 -- (-2280.786) [-2278.743] (-2279.182) (-2279.286) * (-2285.005) (-2270.911) [-2277.438] (-2278.998) -- 0:00:21
929000 -- (-2277.133) (-2283.964) [-2275.482] (-2286.789) * (-2277.689) (-2271.237) (-2273.831) [-2277.334] -- 0:00:21
929500 -- [-2281.233] (-2282.154) (-2264.940) (-2285.333) * (-2276.454) [-2273.794] (-2288.258) (-2280.794) -- 0:00:21
930000 -- (-2272.020) (-2279.366) (-2265.616) [-2275.704] * (-2262.905) [-2265.764] (-2275.365) (-2281.044) -- 0:00:21
Average standard deviation of split frequencies: 0.010536
930500 -- (-2286.546) (-2278.890) [-2268.155] (-2271.565) * (-2281.668) (-2267.704) [-2272.921] (-2273.137) -- 0:00:21
931000 -- [-2270.520] (-2274.539) (-2276.055) (-2289.863) * [-2268.466] (-2275.254) (-2283.055) (-2280.324) -- 0:00:20
931500 -- (-2272.068) [-2274.891] (-2272.546) (-2276.902) * [-2266.807] (-2281.081) (-2276.536) (-2271.713) -- 0:00:20
932000 -- [-2273.248] (-2276.596) (-2280.340) (-2281.876) * (-2274.787) (-2283.259) [-2277.113] (-2275.818) -- 0:00:20
932500 -- (-2283.937) (-2289.069) [-2266.000] (-2287.054) * [-2273.212] (-2272.455) (-2275.349) (-2279.628) -- 0:00:20
933000 -- (-2275.221) [-2272.691] (-2274.457) (-2283.755) * (-2289.642) (-2276.574) [-2273.297] (-2275.578) -- 0:00:20
933500 -- (-2280.343) [-2276.714] (-2277.885) (-2286.316) * (-2276.164) (-2270.519) [-2270.564] (-2275.415) -- 0:00:20
934000 -- [-2271.694] (-2277.892) (-2272.551) (-2269.701) * (-2279.106) [-2269.681] (-2280.818) (-2276.502) -- 0:00:20
934500 -- [-2271.707] (-2268.719) (-2278.828) (-2269.887) * (-2275.796) (-2279.517) [-2280.961] (-2283.755) -- 0:00:19
935000 -- (-2268.096) [-2269.520] (-2288.061) (-2277.305) * (-2280.699) (-2283.150) [-2271.107] (-2270.694) -- 0:00:19
Average standard deviation of split frequencies: 0.010845
935500 -- (-2274.875) (-2272.458) (-2281.016) [-2264.056] * (-2272.986) (-2271.446) [-2268.995] (-2287.462) -- 0:00:19
936000 -- (-2271.404) (-2270.472) [-2269.442] (-2276.528) * [-2276.372] (-2283.995) (-2274.315) (-2276.193) -- 0:00:19
936500 -- (-2284.140) (-2281.143) (-2271.472) [-2268.172] * (-2282.197) (-2280.073) [-2273.900] (-2280.427) -- 0:00:19
937000 -- [-2271.491] (-2279.656) (-2282.502) (-2281.359) * (-2282.865) (-2283.502) (-2282.416) [-2281.836] -- 0:00:19
937500 -- (-2265.769) (-2275.800) (-2298.611) [-2276.058] * (-2272.293) (-2271.379) [-2277.340] (-2283.272) -- 0:00:19
938000 -- [-2268.061] (-2278.140) (-2280.310) (-2276.946) * (-2273.217) [-2273.912] (-2281.530) (-2279.049) -- 0:00:18
938500 -- (-2274.350) (-2284.783) (-2277.062) [-2276.643] * (-2269.736) (-2272.693) (-2275.171) [-2278.845] -- 0:00:18
939000 -- (-2281.278) [-2272.314] (-2269.201) (-2275.649) * (-2277.723) [-2272.148] (-2273.167) (-2270.742) -- 0:00:18
939500 -- (-2269.011) (-2274.880) (-2277.222) [-2264.754] * (-2279.723) (-2271.860) (-2281.227) [-2268.205] -- 0:00:18
940000 -- (-2275.487) [-2287.950] (-2275.381) (-2281.542) * (-2278.751) (-2279.462) (-2278.348) [-2273.575] -- 0:00:18
Average standard deviation of split frequencies: 0.010090
940500 -- (-2284.642) [-2271.282] (-2269.836) (-2276.485) * (-2277.669) [-2279.837] (-2266.174) (-2285.419) -- 0:00:18
941000 -- (-2262.651) (-2274.952) (-2277.493) [-2273.657] * (-2271.376) (-2275.581) [-2277.762] (-2294.582) -- 0:00:17
941500 -- (-2271.980) (-2270.627) [-2272.511] (-2270.807) * (-2281.301) (-2273.210) [-2271.222] (-2279.756) -- 0:00:17
942000 -- (-2273.565) (-2272.829) (-2289.164) [-2272.345] * (-2272.216) (-2287.933) [-2274.958] (-2277.079) -- 0:00:17
942500 -- [-2272.351] (-2274.835) (-2289.958) (-2290.221) * (-2272.658) (-2273.913) [-2270.045] (-2274.411) -- 0:00:17
943000 -- (-2279.506) [-2277.040] (-2278.799) (-2281.866) * (-2272.347) (-2281.492) [-2265.947] (-2277.755) -- 0:00:17
943500 -- (-2275.519) (-2280.021) (-2281.306) [-2277.676] * (-2272.389) (-2286.642) [-2265.005] (-2276.947) -- 0:00:17
944000 -- (-2274.183) (-2280.322) [-2272.071] (-2279.509) * [-2263.878] (-2295.041) (-2271.583) (-2273.494) -- 0:00:17
944500 -- [-2272.642] (-2279.879) (-2281.262) (-2275.899) * (-2287.913) [-2279.034] (-2268.344) (-2273.824) -- 0:00:16
945000 -- [-2271.458] (-2270.018) (-2281.757) (-2280.040) * (-2278.766) (-2268.377) (-2268.299) [-2278.506] -- 0:00:16
Average standard deviation of split frequencies: 0.010166
945500 -- (-2274.970) (-2273.485) (-2274.819) [-2271.321] * (-2290.351) [-2269.423] (-2273.653) (-2276.746) -- 0:00:16
946000 -- (-2283.600) (-2280.763) (-2270.961) [-2275.541] * (-2280.258) (-2284.373) (-2274.147) [-2269.813] -- 0:00:16
946500 -- [-2290.322] (-2276.703) (-2280.195) (-2273.565) * (-2292.660) (-2282.624) [-2277.449] (-2277.496) -- 0:00:16
947000 -- (-2282.720) [-2273.226] (-2289.001) (-2275.151) * (-2274.566) (-2279.521) (-2279.426) [-2271.483] -- 0:00:16
947500 -- (-2268.508) (-2287.726) (-2274.591) [-2269.374] * (-2282.455) (-2281.815) [-2269.936] (-2279.416) -- 0:00:15
948000 -- (-2275.627) (-2274.568) [-2273.858] (-2278.534) * [-2279.739] (-2267.821) (-2274.329) (-2275.000) -- 0:00:15
948500 -- [-2276.407] (-2281.003) (-2275.937) (-2282.083) * (-2280.486) (-2291.823) (-2262.702) [-2277.957] -- 0:00:15
949000 -- (-2278.789) [-2275.395] (-2279.163) (-2267.058) * [-2279.066] (-2284.070) (-2267.311) (-2271.549) -- 0:00:15
949500 -- [-2274.007] (-2277.756) (-2270.985) (-2281.542) * [-2277.698] (-2280.085) (-2277.412) (-2271.571) -- 0:00:15
950000 -- [-2279.140] (-2270.768) (-2276.286) (-2276.347) * (-2278.863) (-2284.505) (-2290.065) [-2273.798] -- 0:00:15
Average standard deviation of split frequencies: 0.009851
950500 -- (-2280.430) [-2277.407] (-2280.701) (-2284.520) * (-2276.405) (-2290.192) [-2269.505] (-2276.826) -- 0:00:14
951000 -- (-2286.719) (-2274.368) [-2274.855] (-2284.592) * (-2268.611) (-2282.736) [-2277.847] (-2283.812) -- 0:00:14
951500 -- (-2277.438) (-2266.181) (-2272.266) [-2277.344] * (-2271.045) [-2283.172] (-2274.130) (-2283.349) -- 0:00:14
952000 -- [-2281.242] (-2282.722) (-2274.254) (-2275.732) * [-2272.174] (-2291.923) (-2277.127) (-2277.423) -- 0:00:14
952500 -- (-2291.680) (-2290.428) (-2287.920) [-2269.681] * (-2277.021) [-2271.850] (-2285.808) (-2274.326) -- 0:00:14
953000 -- (-2277.526) (-2272.775) (-2281.262) [-2281.119] * (-2283.161) (-2272.925) [-2279.844] (-2269.700) -- 0:00:14
953500 -- [-2276.437] (-2289.785) (-2276.890) (-2275.951) * (-2281.233) (-2279.562) [-2269.566] (-2277.822) -- 0:00:14
954000 -- (-2277.053) (-2273.524) (-2275.499) [-2275.903] * [-2284.506] (-2281.647) (-2275.522) (-2273.342) -- 0:00:13
954500 -- [-2280.132] (-2278.920) (-2271.856) (-2276.635) * (-2284.336) (-2277.170) [-2281.062] (-2266.261) -- 0:00:13
955000 -- (-2273.608) (-2279.112) (-2276.018) [-2276.407] * (-2277.010) [-2273.899] (-2284.983) (-2267.836) -- 0:00:13
Average standard deviation of split frequencies: 0.009270
955500 -- (-2276.603) [-2274.866] (-2269.585) (-2304.139) * (-2274.638) (-2276.202) (-2274.010) [-2275.646] -- 0:00:13
956000 -- (-2275.904) (-2289.643) [-2268.244] (-2274.843) * [-2274.819] (-2269.178) (-2278.953) (-2273.242) -- 0:00:13
956500 -- (-2281.491) (-2295.075) (-2267.526) [-2275.866] * (-2289.935) (-2271.851) (-2276.069) [-2265.611] -- 0:00:13
957000 -- (-2274.976) (-2276.430) [-2275.418] (-2268.420) * (-2288.506) [-2270.697] (-2276.565) (-2277.602) -- 0:00:13
957500 -- (-2270.701) (-2276.829) (-2283.401) [-2280.199] * (-2279.453) (-2285.320) [-2268.481] (-2274.980) -- 0:00:12
958000 -- (-2280.673) [-2269.123] (-2285.988) (-2277.143) * (-2286.627) (-2281.035) [-2261.564] (-2286.018) -- 0:00:12
958500 -- (-2270.774) [-2272.839] (-2268.667) (-2279.755) * (-2278.916) [-2270.956] (-2275.295) (-2282.373) -- 0:00:12
959000 -- (-2302.473) (-2272.742) (-2272.844) [-2274.478] * (-2280.592) [-2271.280] (-2273.749) (-2282.578) -- 0:00:12
959500 -- (-2286.453) (-2276.925) [-2277.814] (-2286.130) * [-2277.119] (-2273.287) (-2274.276) (-2272.178) -- 0:00:12
960000 -- (-2269.454) [-2271.213] (-2288.711) (-2288.413) * (-2277.999) (-2284.330) (-2270.360) [-2275.395] -- 0:00:12
Average standard deviation of split frequencies: 0.008767
960500 -- (-2274.331) (-2272.773) [-2271.508] (-2284.354) * [-2288.435] (-2282.861) (-2275.816) (-2267.085) -- 0:00:11
961000 -- [-2273.413] (-2277.169) (-2282.871) (-2273.087) * (-2282.423) (-2279.247) (-2282.626) [-2275.876] -- 0:00:11
961500 -- (-2279.645) (-2279.234) (-2277.781) [-2270.602] * (-2285.015) (-2278.849) (-2274.899) [-2262.915] -- 0:00:11
962000 -- (-2280.278) (-2268.015) (-2274.798) [-2274.338] * (-2272.547) (-2278.141) [-2274.740] (-2280.119) -- 0:00:11
962500 -- (-2276.408) [-2271.710] (-2272.951) (-2288.826) * (-2272.065) [-2265.647] (-2276.391) (-2279.574) -- 0:00:11
963000 -- (-2286.077) (-2275.738) [-2272.618] (-2266.824) * (-2278.718) (-2279.298) (-2287.094) [-2266.691] -- 0:00:11
963500 -- (-2274.309) [-2268.470] (-2278.565) (-2281.600) * [-2275.886] (-2271.488) (-2273.070) (-2275.987) -- 0:00:11
964000 -- (-2279.997) (-2277.536) [-2276.069] (-2283.656) * (-2273.443) [-2283.737] (-2278.619) (-2271.137) -- 0:00:10
964500 -- (-2289.490) [-2271.105] (-2271.661) (-2298.403) * (-2275.883) (-2277.537) (-2285.239) [-2268.500] -- 0:00:10
965000 -- [-2269.318] (-2278.559) (-2275.143) (-2291.717) * (-2265.790) (-2280.831) [-2282.717] (-2268.467) -- 0:00:10
Average standard deviation of split frequencies: 0.008751
965500 -- [-2262.720] (-2289.271) (-2272.993) (-2276.403) * [-2276.775] (-2277.325) (-2276.026) (-2269.862) -- 0:00:10
966000 -- (-2276.391) (-2278.692) [-2277.225] (-2282.011) * [-2275.941] (-2282.502) (-2274.277) (-2274.947) -- 0:00:10
966500 -- (-2271.918) (-2274.379) [-2267.456] (-2274.795) * (-2271.144) [-2270.552] (-2272.344) (-2273.669) -- 0:00:10
967000 -- [-2272.050] (-2281.069) (-2280.743) (-2271.279) * (-2282.716) [-2271.674] (-2282.387) (-2269.825) -- 0:00:09
967500 -- (-2287.920) (-2281.507) (-2274.460) [-2265.135] * (-2281.569) (-2285.786) [-2273.235] (-2273.545) -- 0:00:09
968000 -- (-2273.847) (-2280.988) [-2278.848] (-2271.712) * (-2280.324) [-2269.876] (-2278.470) (-2277.187) -- 0:00:09
968500 -- (-2277.339) [-2276.532] (-2268.352) (-2276.919) * (-2285.607) (-2284.755) [-2271.384] (-2265.105) -- 0:00:09
969000 -- [-2267.367] (-2282.951) (-2283.253) (-2282.944) * (-2295.409) (-2278.553) [-2269.387] (-2276.162) -- 0:00:09
969500 -- [-2274.449] (-2264.621) (-2272.400) (-2279.844) * [-2270.700] (-2268.331) (-2283.585) (-2277.621) -- 0:00:09
970000 -- (-2285.096) [-2266.869] (-2288.170) (-2280.641) * (-2271.966) (-2279.030) [-2264.048] (-2296.462) -- 0:00:09
Average standard deviation of split frequencies: 0.008386
970500 -- [-2263.212] (-2271.175) (-2281.827) (-2278.647) * (-2273.063) (-2289.803) (-2277.555) [-2268.543] -- 0:00:08
971000 -- (-2275.398) (-2275.740) [-2273.658] (-2275.514) * (-2270.763) (-2275.863) (-2274.906) [-2271.285] -- 0:00:08
971500 -- (-2271.652) [-2273.216] (-2273.017) (-2275.811) * (-2280.524) (-2288.020) [-2272.678] (-2268.113) -- 0:00:08
972000 -- (-2277.953) (-2268.638) (-2274.297) [-2272.062] * (-2283.047) (-2278.742) [-2267.063] (-2275.712) -- 0:00:08
972500 -- (-2270.147) (-2275.248) (-2277.158) [-2272.114] * (-2266.986) (-2271.723) (-2279.017) [-2271.292] -- 0:00:08
973000 -- [-2268.936] (-2281.725) (-2274.494) (-2263.746) * [-2270.476] (-2277.929) (-2267.221) (-2282.451) -- 0:00:08
973500 -- (-2281.896) (-2286.929) (-2274.894) [-2276.480] * [-2270.323] (-2279.737) (-2273.930) (-2279.135) -- 0:00:08
974000 -- (-2275.409) [-2280.453] (-2281.237) (-2283.867) * (-2281.866) (-2282.581) (-2279.670) [-2272.402] -- 0:00:07
974500 -- (-2272.106) (-2282.486) [-2280.132] (-2270.409) * (-2275.790) (-2275.701) (-2282.826) [-2270.018] -- 0:00:07
975000 -- (-2285.954) (-2285.321) [-2273.130] (-2267.234) * (-2274.524) [-2279.841] (-2271.910) (-2268.835) -- 0:00:07
Average standard deviation of split frequencies: 0.008372
975500 -- [-2278.279] (-2283.483) (-2270.901) (-2273.197) * (-2270.333) (-2275.305) [-2277.083] (-2277.530) -- 0:00:07
976000 -- (-2291.090) (-2273.871) (-2277.262) [-2264.005] * (-2280.183) [-2285.370] (-2275.459) (-2274.342) -- 0:00:07
976500 -- [-2289.809] (-2278.602) (-2277.336) (-2276.152) * (-2278.831) (-2273.157) (-2279.589) [-2266.410] -- 0:00:07
977000 -- (-2284.299) (-2288.338) [-2268.099] (-2280.861) * (-2273.486) (-2291.504) (-2286.164) [-2265.973] -- 0:00:06
977500 -- (-2284.685) (-2289.388) [-2266.169] (-2278.809) * (-2271.443) [-2267.939] (-2287.645) (-2279.296) -- 0:00:06
978000 -- (-2271.597) (-2290.546) (-2271.931) [-2271.802] * (-2281.799) (-2279.139) (-2283.404) [-2274.845] -- 0:00:06
978500 -- (-2268.312) (-2292.897) (-2277.378) [-2277.339] * [-2267.679] (-2273.018) (-2280.181) (-2285.120) -- 0:00:06
979000 -- (-2276.846) (-2285.550) [-2273.535] (-2279.107) * (-2279.061) (-2284.053) [-2275.089] (-2276.545) -- 0:00:06
979500 -- (-2278.209) [-2269.219] (-2269.910) (-2282.544) * (-2271.859) [-2265.584] (-2274.641) (-2290.164) -- 0:00:06
980000 -- (-2287.989) (-2277.828) [-2276.246] (-2282.920) * (-2269.886) (-2271.321) (-2287.663) [-2268.944] -- 0:00:06
Average standard deviation of split frequencies: 0.008108
980500 -- (-2276.247) [-2282.188] (-2271.334) (-2273.261) * (-2270.152) [-2278.145] (-2269.028) (-2266.268) -- 0:00:05
981000 -- (-2279.139) (-2275.605) (-2266.981) [-2281.934] * (-2274.953) (-2275.018) (-2276.560) [-2270.358] -- 0:00:05
981500 -- [-2280.482] (-2274.402) (-2281.840) (-2279.323) * (-2273.268) (-2281.430) (-2281.932) [-2270.928] -- 0:00:05
982000 -- (-2279.734) (-2272.093) (-2284.994) [-2278.046] * (-2272.190) (-2276.466) [-2269.923] (-2283.925) -- 0:00:05
982500 -- (-2264.075) (-2275.416) [-2273.234] (-2275.001) * (-2278.065) (-2280.514) (-2282.224) [-2268.782] -- 0:00:05
983000 -- [-2269.495] (-2274.429) (-2275.639) (-2291.688) * (-2267.112) (-2281.891) (-2264.626) [-2270.844] -- 0:00:05
983500 -- (-2272.666) [-2273.435] (-2276.196) (-2297.318) * (-2267.052) (-2287.028) (-2266.211) [-2267.284] -- 0:00:04
984000 -- (-2287.070) [-2283.609] (-2275.001) (-2288.244) * (-2272.600) [-2282.465] (-2274.773) (-2280.380) -- 0:00:04
984500 -- (-2267.839) [-2272.740] (-2266.855) (-2280.961) * (-2277.566) (-2285.326) [-2275.722] (-2274.221) -- 0:00:04
985000 -- [-2275.914] (-2281.948) (-2269.477) (-2270.493) * (-2280.043) (-2274.549) [-2269.176] (-2276.967) -- 0:00:04
Average standard deviation of split frequencies: 0.007841
985500 -- [-2270.154] (-2278.493) (-2277.278) (-2279.596) * [-2279.290] (-2282.532) (-2277.041) (-2293.207) -- 0:00:04
986000 -- (-2285.590) (-2267.075) [-2267.877] (-2283.107) * (-2281.403) (-2274.525) [-2274.114] (-2280.908) -- 0:00:04
986500 -- [-2268.027] (-2272.259) (-2276.057) (-2300.511) * (-2281.038) (-2268.824) [-2265.581] (-2295.247) -- 0:00:04
987000 -- [-2271.541] (-2281.195) (-2278.879) (-2278.311) * (-2269.239) (-2281.054) [-2272.490] (-2284.593) -- 0:00:03
987500 -- [-2265.917] (-2275.199) (-2275.471) (-2274.695) * (-2273.712) (-2276.881) (-2277.591) [-2273.216] -- 0:00:03
988000 -- (-2281.821) (-2275.798) [-2282.453] (-2277.045) * [-2281.509] (-2267.588) (-2278.689) (-2276.211) -- 0:00:03
988500 -- (-2274.544) (-2275.746) [-2280.725] (-2283.166) * (-2269.897) [-2266.857] (-2282.102) (-2277.645) -- 0:00:03
989000 -- (-2297.569) (-2276.516) [-2271.726] (-2282.151) * (-2276.925) (-2278.742) [-2277.620] (-2266.863) -- 0:00:03
989500 -- (-2267.866) [-2270.404] (-2272.965) (-2281.313) * (-2278.152) (-2278.551) (-2279.767) [-2278.493] -- 0:00:03
990000 -- [-2271.390] (-2268.007) (-2275.325) (-2270.000) * [-2278.991] (-2269.402) (-2284.534) (-2289.358) -- 0:00:03
Average standard deviation of split frequencies: 0.007804
990500 -- (-2280.027) (-2275.312) [-2278.230] (-2276.628) * (-2277.987) (-2277.622) [-2278.414] (-2269.889) -- 0:00:02
991000 -- [-2281.261] (-2271.343) (-2284.643) (-2273.113) * (-2275.576) (-2277.505) (-2276.018) [-2276.023] -- 0:00:02
991500 -- (-2291.229) [-2284.112] (-2280.242) (-2272.128) * [-2281.174] (-2275.889) (-2288.986) (-2284.726) -- 0:00:02
992000 -- (-2280.572) (-2270.348) (-2273.204) [-2283.819] * (-2275.445) (-2274.338) [-2276.840] (-2284.347) -- 0:00:02
992500 -- (-2273.445) [-2276.997] (-2273.178) (-2280.145) * (-2285.364) (-2268.662) [-2279.288] (-2278.527) -- 0:00:02
993000 -- [-2268.659] (-2274.328) (-2273.476) (-2284.612) * (-2282.054) [-2272.512] (-2282.851) (-2280.922) -- 0:00:02
993500 -- (-2275.944) (-2279.989) (-2268.921) [-2271.873] * (-2279.311) (-2270.711) (-2264.725) [-2270.134] -- 0:00:01
994000 -- [-2278.389] (-2268.076) (-2274.896) (-2287.595) * (-2280.826) (-2279.907) (-2274.581) [-2276.310] -- 0:00:01
994500 -- [-2268.924] (-2284.853) (-2281.267) (-2276.412) * (-2280.263) [-2276.694] (-2279.098) (-2267.149) -- 0:00:01
995000 -- [-2269.041] (-2277.402) (-2277.172) (-2272.675) * (-2289.967) (-2282.554) (-2273.964) [-2268.486] -- 0:00:01
Average standard deviation of split frequencies: 0.006626
995500 -- [-2266.723] (-2275.658) (-2276.585) (-2277.147) * (-2279.987) (-2281.982) [-2272.064] (-2261.709) -- 0:00:01
996000 -- (-2296.457) [-2279.002] (-2274.914) (-2273.934) * (-2269.749) (-2272.202) (-2284.723) [-2271.181] -- 0:00:01
996500 -- (-2271.702) (-2269.503) (-2285.080) [-2267.939] * [-2270.573] (-2276.752) (-2275.484) (-2275.045) -- 0:00:01
997000 -- (-2273.238) [-2275.905] (-2272.700) (-2279.284) * (-2275.658) (-2283.372) [-2263.111] (-2273.541) -- 0:00:00
997500 -- (-2271.515) (-2279.485) (-2272.784) [-2273.787] * (-2277.308) (-2282.689) (-2266.589) [-2273.459] -- 0:00:00
998000 -- (-2274.792) (-2275.096) (-2288.419) [-2267.956] * (-2285.554) [-2271.875] (-2273.178) (-2266.008) -- 0:00:00
998500 -- (-2291.371) [-2265.492] (-2277.849) (-2276.588) * (-2280.442) (-2272.495) (-2278.014) [-2273.918] -- 0:00:00
999000 -- (-2277.940) (-2275.658) (-2283.873) [-2271.177] * (-2286.322) [-2266.815] (-2297.161) (-2280.826) -- 0:00:00
999500 -- [-2272.926] (-2276.377) (-2291.850) (-2274.044) * (-2273.769) (-2276.632) (-2284.124) [-2286.281] -- 0:00:00
1000000 -- [-2277.226] (-2279.696) (-2280.759) (-2279.837) * (-2274.910) (-2283.516) (-2283.308) [-2275.794] -- 0:00:00
Average standard deviation of split frequencies: 0.006752
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2277.225633 -- 27.373248
Chain 1 -- -2277.225626 -- 27.373248
Chain 2 -- -2279.695955 -- 27.231982
Chain 2 -- -2279.695955 -- 27.231982
Chain 3 -- -2280.759257 -- 25.516380
Chain 3 -- -2280.759259 -- 25.516380
Chain 4 -- -2279.837053 -- 25.585266
Chain 4 -- -2279.837059 -- 25.585266
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2274.910115 -- 22.573177
Chain 1 -- -2274.910115 -- 22.573177
Chain 2 -- -2283.515575 -- 25.100590
Chain 2 -- -2283.515577 -- 25.100590
Chain 3 -- -2283.307828 -- 28.120560
Chain 3 -- -2283.307829 -- 28.120560
Chain 4 -- -2275.794190 -- 25.690007
Chain 4 -- -2275.794190 -- 25.690007
Analysis completed in 5 mins 3 seconds
Analysis used 302.85 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2258.27
Likelihood of best state for "cold" chain of run 2 was -2259.10
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
48.8 % ( 44 %) Dirichlet(Revmat{all})
65.2 % ( 47 %) Slider(Revmat{all})
24.6 % ( 23 %) Dirichlet(Pi{all})
27.1 % ( 26 %) Slider(Pi{all})
56.7 % ( 32 %) Multiplier(Alpha{1,2})
45.0 % ( 23 %) Multiplier(Alpha{3})
35.0 % ( 19 %) Slider(Pinvar{all})
13.3 % ( 10 %) ExtSPR(Tau{all},V{all})
4.1 % ( 4 %) ExtTBR(Tau{all},V{all})
19.3 % ( 23 %) NNI(Tau{all},V{all})
17.0 % ( 16 %) ParsSPR(Tau{all},V{all})
26.8 % ( 19 %) Multiplier(V{all})
44.5 % ( 40 %) Nodeslider(V{all})
25.8 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
48.7 % ( 37 %) Dirichlet(Revmat{all})
65.7 % ( 53 %) Slider(Revmat{all})
24.7 % ( 24 %) Dirichlet(Pi{all})
27.1 % ( 22 %) Slider(Pi{all})
56.8 % ( 24 %) Multiplier(Alpha{1,2})
44.8 % ( 29 %) Multiplier(Alpha{3})
35.0 % ( 19 %) Slider(Pinvar{all})
13.3 % ( 10 %) ExtSPR(Tau{all},V{all})
4.1 % ( 5 %) ExtTBR(Tau{all},V{all})
19.0 % ( 24 %) NNI(Tau{all},V{all})
17.0 % ( 19 %) ParsSPR(Tau{all},V{all})
26.8 % ( 22 %) Multiplier(V{all})
44.5 % ( 53 %) Nodeslider(V{all})
25.7 % ( 19 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166719 0.75 0.54
3 | 167246 166241 0.77
4 | 167166 166120 166508
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.73 0.51 0.35
2 | 166808 0.75 0.55
3 | 166568 166854 0.77
4 | 166749 166684 166337
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2270.51
| 2 |
| 2 2 2 2 2 |
| 2 2 1 11 2 |
|2 2 1 1 1 1 12 1 2 2 |
| 2 22 2 1 2 2 1 1 |
| 1 12 2 1* 221 22 1 2 |
| * 1 1 11 2 2 2 11 2 2 |
| * 2 1 * 2 2 * 2 11 1 2 |
|1 2 2 2 1 1 2 1 1 2 |
| 1 1 1 22 1 1 1 1 2 1|
| 1 2 1 1 2 2 1 2 1 |
| 1 2 2 1 2|
| 2 1 1 1 2 11 |
| 1 1 1 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2275.68
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2266.17 -2284.86
2 -2265.95 -2284.74
--------------------------------------
TOTAL -2266.06 -2284.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.388850 0.003261 0.282135 0.497652 0.384365 1312.29 1397.93 1.000
r(A<->C){all} 0.118751 0.001152 0.060245 0.190239 0.115789 848.97 932.21 1.000
r(A<->G){all} 0.247701 0.002851 0.148755 0.355528 0.245181 471.46 516.19 1.000
r(A<->T){all} 0.111127 0.001423 0.041648 0.184680 0.107305 777.09 799.93 1.000
r(C<->G){all} 0.065652 0.000415 0.029946 0.107426 0.063244 844.44 944.36 1.000
r(C<->T){all} 0.445810 0.003740 0.322958 0.563454 0.446044 672.17 746.40 1.000
r(G<->T){all} 0.010958 0.000105 0.000022 0.031156 0.007902 782.15 813.64 1.000
pi(A){all} 0.241819 0.000149 0.217424 0.265722 0.241292 1266.11 1281.69 1.000
pi(C){all} 0.306077 0.000175 0.280298 0.331841 0.306253 1162.05 1280.55 1.000
pi(G){all} 0.270149 0.000173 0.244127 0.295796 0.270271 1262.34 1311.24 1.000
pi(T){all} 0.181955 0.000121 0.160300 0.202828 0.181911 1185.48 1279.24 1.000
alpha{1,2} 0.045390 0.000683 0.000112 0.086819 0.047038 1048.01 1140.40 1.000
alpha{3} 2.455511 0.675468 1.067352 4.100930 2.337238 1389.62 1445.31 1.000
pinvar{all} 0.746716 0.000690 0.694248 0.797080 0.747571 1285.60 1323.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- ....*******
13 -- .........**
14 -- ...********
15 -- .....**....
16 -- ..*********
17 -- .....**.***
18 -- ........***
19 -- ....*..*...
20 -- .....**..**
21 -- .....******
22 -- ....****.**
23 -- ....***.***
24 -- .....***.**
25 -- .*.********
26 -- .**........
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2998 0.998668 0.000000 0.998668 0.998668 2
13 2986 0.994670 0.000000 0.994670 0.994670 2
14 2986 0.994670 0.003769 0.992005 0.997335 2
15 2570 0.856096 0.009422 0.849434 0.862758 2
16 2314 0.770819 0.007537 0.765490 0.776149 2
17 2263 0.753831 0.013662 0.744171 0.763491 2
18 1779 0.592605 0.001413 0.591606 0.593604 2
19 1061 0.353431 0.007066 0.348434 0.358428 2
20 989 0.329447 0.001413 0.328448 0.330446 2
21 934 0.311126 0.012248 0.302465 0.319787 2
22 639 0.212858 0.024026 0.195869 0.229847 2
23 547 0.182212 0.008951 0.175883 0.188541 2
24 348 0.115923 0.006595 0.111259 0.120586 2
25 345 0.114923 0.001413 0.113924 0.115923 2
26 336 0.111925 0.003769 0.109260 0.114590 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.017699 0.000042 0.006629 0.030342 0.016939 1.000 2
length{all}[2] 0.003809 0.000008 0.000001 0.009393 0.003098 1.000 2
length{all}[3] 0.002055 0.000004 0.000000 0.006222 0.001438 1.000 2
length{all}[4] 0.005183 0.000013 0.000005 0.012266 0.004474 1.000 2
length{all}[5] 0.034612 0.000118 0.015276 0.056011 0.033278 1.002 2
length{all}[6] 0.019804 0.000053 0.007373 0.034960 0.018848 1.001 2
length{all}[7] 0.006613 0.000017 0.000706 0.015042 0.005819 1.000 2
length{all}[8] 0.074675 0.000391 0.042270 0.115567 0.072075 1.000 2
length{all}[9] 0.100150 0.000660 0.053912 0.150931 0.097364 1.000 2
length{all}[10] 0.011701 0.000034 0.001276 0.022770 0.010848 1.000 2
length{all}[11] 0.016446 0.000048 0.004422 0.030034 0.015331 1.000 2
length{all}[12] 0.031241 0.000155 0.007714 0.054879 0.030067 1.002 2
length{all}[13] 0.018763 0.000092 0.002589 0.037219 0.017392 1.000 2
length{all}[14] 0.008332 0.000021 0.000932 0.017411 0.007511 1.000 2
length{all}[15] 0.006764 0.000022 0.000006 0.015410 0.005804 1.000 2
length{all}[16] 0.003521 0.000007 0.000018 0.008990 0.002869 1.000 2
length{all}[17] 0.012130 0.000039 0.000901 0.023688 0.011124 1.000 2
length{all}[18] 0.010870 0.000054 0.000018 0.024181 0.009683 1.000 2
length{all}[19] 0.005031 0.000020 0.000010 0.013406 0.003803 1.000 2
length{all}[20] 0.010040 0.000046 0.000031 0.023062 0.008910 1.000 2
length{all}[21] 0.005883 0.000031 0.000010 0.016795 0.004319 0.999 2
length{all}[22] 0.016717 0.000082 0.003097 0.036968 0.014716 1.000 2
length{all}[23] 0.004809 0.000021 0.000007 0.013689 0.003367 0.999 2
length{all}[24] 0.006750 0.000027 0.000029 0.017733 0.005273 1.002 2
length{all}[25] 0.001877 0.000003 0.000005 0.005816 0.001323 1.006 2
length{all}[26] 0.002055 0.000005 0.000003 0.006273 0.001316 1.001 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006752
Maximum standard deviation of split frequencies = 0.024026
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
+ /------------------------------------------------------------ C3 (3)
| |
| | /-------------------------------------------------- C4 (4)
\----77---+ |
| | /---------------------------------------- C5 (5)
| | |
\----99---+ | /---------- C6 (6)
| | /---------86--------+
| | | \---------- C7 (7)
| | |
\---100---+----75---+ /-------------------- C9 (9)
| | |
| \----59---+ /---------- C10 (10)
| \----99---+
| \---------- C11 (11)
|
\---------------------------------------- C8 (8)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
|- C2 (2)
|
+/- C3 (3)
||
|| /-- C4 (4)
\+ |
| | /--------------- C5 (5)
| | |
\---+ | /--------- C6 (6)
| | /--+
| | | \--- C7 (7)
| | |
\------------+----+ /-------------------------------------------- C9 (9)
| | |
| \----+ /----- C10 (10)
| \-------+
| \------- C11 (11)
|
\--------------------------------- C8 (8)
|--------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (210 trees sampled):
50 % credible set contains 6 trees
90 % credible set contains 49 trees
95 % credible set contains 87 trees
99 % credible set contains 180 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 1098
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sequences read..
Counting site patterns.. 0:00
139 patterns at 366 / 366 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
135664 bytes for conP
18904 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
542656 bytes for conP, adjusted
0.020558 0.004621 0.001779 0.000967 0.007375 0.006085 0.035976 0.042513 0.007053 0.006257 0.020797 0.010140 0.002983 0.079763 0.022289 0.015616 0.018228 0.075665 0.300000 1.300000
ntime & nrate & np: 18 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 20
lnL0 = -2513.670212
Iterating by ming2
Initial: fx= 2513.670212
x= 0.02056 0.00462 0.00178 0.00097 0.00737 0.00608 0.03598 0.04251 0.00705 0.00626 0.02080 0.01014 0.00298 0.07976 0.02229 0.01562 0.01823 0.07567 0.30000 1.30000
1 h-m-p 0.0000 0.0000 865.4153 ++ 2512.042530 m 0.0000 25 | 1/20
2 h-m-p 0.0000 0.0000 511.2362 +YYCCC 2509.659904 4 0.0000 55 | 1/20
3 h-m-p 0.0000 0.0000 1549.5328 YCCCC 2508.355756 4 0.0000 85 | 1/20
4 h-m-p 0.0000 0.0000 1114.2938 +YYCCC 2505.291475 4 0.0000 115 | 1/20
5 h-m-p 0.0000 0.0000 2151.5828 YCYCCC 2502.048176 5 0.0000 146 | 1/20
6 h-m-p 0.0000 0.0001 1837.6091 ++ 2477.336730 m 0.0001 169 | 1/20
7 h-m-p 0.0000 0.0000 92189.3754 ++ 2472.001898 m 0.0000 192 | 1/20
8 h-m-p 0.0000 0.0001 4233.0599 +YYYYCYCCC 2449.067357 8 0.0001 227 | 1/20
9 h-m-p 0.0000 0.0001 1402.4853 +CYCCC 2435.854761 4 0.0001 258 | 1/20
10 h-m-p 0.0000 0.0000 8781.5634 +YYYCCC 2416.731508 5 0.0000 289 | 1/20
11 h-m-p 0.0000 0.0000 2613.0248 YCYCCC 2411.129262 5 0.0000 320 | 1/20
12 h-m-p 0.0000 0.0000 780.1515 +YYCCCC 2409.150898 5 0.0000 352 | 1/20
13 h-m-p 0.0000 0.0001 1852.1395 +YYCCC 2403.131958 4 0.0000 382 | 1/20
14 h-m-p 0.0000 0.0002 1082.6422 YCYCCC 2394.794781 5 0.0001 413 | 1/20
15 h-m-p 0.0001 0.0004 377.6530 CCCCC 2391.372165 4 0.0001 444 | 1/20
16 h-m-p 0.0001 0.0010 823.7845 ++ 2221.025476 m 0.0010 467 | 2/20
17 h-m-p 0.0002 0.0011 109.1442 YCCC 2220.496838 3 0.0001 495 | 2/20
18 h-m-p 0.0013 0.0374 12.2797 CCC 2220.448021 2 0.0004 522 | 2/20
19 h-m-p 0.0028 0.0215 1.7727 +YYCCC 2219.629285 4 0.0082 552 | 2/20
20 h-m-p 0.0005 0.0032 28.7165 +CYCCC 2200.962509 4 0.0028 584 | 2/20
21 h-m-p 0.1276 0.6380 0.2246 +YYCCC 2188.244068 4 0.4533 614 | 2/20
22 h-m-p 0.6324 3.1620 0.0476 CCYC 2184.069539 3 0.6389 660 | 2/20
23 h-m-p 0.2314 1.1568 0.0698 +YYYYYC 2176.234338 5 0.9096 707 | 2/20
24 h-m-p 0.3744 1.8720 0.1688 YCCCC 2172.780562 4 0.9018 755 | 2/20
25 h-m-p 0.5688 2.8442 0.0535 CYCCC 2171.641468 4 0.9601 803 | 2/20
26 h-m-p 0.7738 4.3956 0.0664 CCC 2170.821102 2 1.1802 848 | 2/20
27 h-m-p 1.4099 8.0000 0.0556 YCCC 2170.216281 3 2.5330 894 | 2/20
28 h-m-p 1.4768 7.3839 0.0302 CCCC 2169.919583 3 2.0068 941 | 2/20
29 h-m-p 1.6000 8.0000 0.0040 CCC 2169.800253 2 1.6814 986 | 2/20
30 h-m-p 1.6000 8.0000 0.0040 CYC 2169.718706 2 1.7176 1030 | 2/20
31 h-m-p 0.5046 8.0000 0.0138 +YC 2169.565934 1 4.4184 1073 | 2/20
32 h-m-p 1.6000 8.0000 0.0238 YC 2169.371760 1 3.3042 1115 | 2/20
33 h-m-p 1.6000 8.0000 0.0422 YCC 2169.177183 2 2.5323 1159 | 2/20
34 h-m-p 1.6000 8.0000 0.0244 CC 2169.073918 1 2.0714 1202 | 2/20
35 h-m-p 1.6000 8.0000 0.0049 YC 2168.983386 1 3.2041 1244 | 2/20
36 h-m-p 1.6000 8.0000 0.0066 +YC 2168.876944 1 4.6053 1287 | 2/20
37 h-m-p 1.6000 8.0000 0.0156 YC 2168.718661 1 3.5541 1329 | 2/20
38 h-m-p 1.6000 8.0000 0.0133 YCC 2168.597243 2 2.7065 1373 | 2/20
39 h-m-p 1.6000 8.0000 0.0150 CC 2168.557400 1 1.9076 1416 | 2/20
40 h-m-p 1.6000 8.0000 0.0071 YC 2168.535680 1 3.5890 1458 | 2/20
41 h-m-p 1.6000 8.0000 0.0035 +YC 2168.494182 1 4.4198 1501 | 2/20
42 h-m-p 1.2035 8.0000 0.0128 CC 2168.481220 1 1.8880 1544 | 2/20
43 h-m-p 1.6000 8.0000 0.0028 CC 2168.476309 1 2.3986 1587 | 2/20
44 h-m-p 1.6000 8.0000 0.0002 C 2168.475594 0 1.4860 1628 | 2/20
45 h-m-p 1.5035 8.0000 0.0002 +YC 2168.475385 1 4.3297 1671 | 2/20
46 h-m-p 1.6000 8.0000 0.0001 YC 2168.475073 1 3.3941 1713 | 2/20
47 h-m-p 0.3042 8.0000 0.0010 +Y 2168.474983 0 2.2988 1755 | 2/20
48 h-m-p 1.6000 8.0000 0.0002 Y 2168.474966 0 2.6156 1796 | 2/20
49 h-m-p 1.6000 8.0000 0.0001 C 2168.474962 0 1.5260 1837 | 2/20
50 h-m-p 1.6000 8.0000 0.0001 Y 2168.474962 0 2.7174 1878 | 2/20
51 h-m-p 1.6000 8.0000 0.0000 C 2168.474962 0 1.4238 1919 | 2/20
52 h-m-p 1.6000 8.0000 0.0000 ---Y 2168.474962 0 0.0063 1963 | 2/20
53 h-m-p 0.0160 8.0000 0.0000 C 2168.474962 0 0.0160 2004 | 2/20
54 h-m-p 0.0160 8.0000 0.0000 -------------.. | 2/20
55 h-m-p 0.0035 1.7506 0.0106 ------------ | 2/20
56 h-m-p 0.0035 1.7506 0.0106 ------------
Out..
lnL = -2168.474962
2159 lfun, 2159 eigenQcodon, 38862 P(t)
Time used: 0:13
Model 1: NearlyNeutral
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
0.020558 0.004621 0.001779 0.000967 0.007375 0.006085 0.035976 0.042513 0.007053 0.006257 0.020797 0.010140 0.002983 0.079763 0.022289 0.015616 0.018228 0.075665 2.133129 0.652999 0.498354
ntime & nrate & np: 18 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.011850
np = 21
lnL0 = -2339.585838
Iterating by ming2
Initial: fx= 2339.585838
x= 0.02056 0.00462 0.00178 0.00097 0.00737 0.00608 0.03598 0.04251 0.00705 0.00626 0.02080 0.01014 0.00298 0.07976 0.02229 0.01562 0.01823 0.07567 2.13313 0.65300 0.49835
1 h-m-p 0.0000 0.0000 809.8887 ++ 2338.115306 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 385.1291 +YCYCCC 2337.027402 5 0.0000 101 | 1/21
3 h-m-p 0.0000 0.0000 848.7650 CCC 2336.561695 2 0.0000 149 | 1/21
4 h-m-p 0.0000 0.0000 449.9111 CCC 2336.006918 2 0.0000 197 | 1/21
5 h-m-p 0.0000 0.0001 453.3975 +YCCCC 2334.343044 4 0.0000 249 | 1/21
6 h-m-p 0.0000 0.0002 590.4640 +YYCYCCC 2327.185708 6 0.0001 303 | 1/21
7 h-m-p 0.0000 0.0000 6370.2002 +YYCYCYC 2313.691050 6 0.0000 357 | 1/21
8 h-m-p 0.0000 0.0000 50396.5971 ++ 2259.866370 m 0.0000 401 | 1/21
9 h-m-p -0.0000 -0.0000 469320.4877
h-m-p: -4.30085078e-24 -2.15042539e-23 4.69320488e+05 2259.866370
.. | 1/21
10 h-m-p 0.0000 0.0001 16078.0418 YCYYYYCCCC 2240.120056 10 0.0000 500 | 1/21
11 h-m-p 0.0000 0.0001 669.4505 ++ 2215.911159 m 0.0001 544 | 1/21
12 h-m-p 0.0000 0.0000 12275.6014 ++ 2196.712112 m 0.0000 588 | 2/21
13 h-m-p 0.0000 0.0001 559.2602 +CCCC 2188.020037 3 0.0001 639 | 2/21
14 h-m-p 0.0000 0.0000 3561.5833 YCC 2186.713341 2 0.0000 685 | 2/21
15 h-m-p 0.0000 0.0000 1015.6637 ++ 2184.128741 m 0.0000 728 | 3/21
16 h-m-p 0.0000 0.0001 334.9938 YCCCC 2182.682087 4 0.0001 778 | 3/21
17 h-m-p 0.0000 0.0002 343.5655 CCC 2181.574189 2 0.0000 824 | 3/21
18 h-m-p 0.0001 0.0004 233.4235 +YCCC 2177.849307 3 0.0002 872 | 3/21
19 h-m-p 0.0001 0.0003 259.1810 CCC 2176.692675 2 0.0001 918 | 3/21
20 h-m-p 0.0000 0.0002 156.4728 YCCCC 2175.216683 4 0.0001 967 | 3/21
21 h-m-p 0.0000 0.0002 192.5727 +YCYCCC 2172.900008 5 0.0001 1018 | 3/21
22 h-m-p 0.0000 0.0002 114.5330 +YYYCCC 2170.864172 5 0.0001 1068 | 3/21
23 h-m-p 0.0000 0.0001 247.7408 CCCC 2170.301695 3 0.0000 1116 | 3/21
24 h-m-p 0.0000 0.0001 193.7114 CCCC 2169.979393 3 0.0000 1164 | 3/21
25 h-m-p 0.0005 0.0039 11.5746 YC 2169.973156 1 0.0001 1207 | 3/21
26 h-m-p 0.0001 0.0086 10.1686 YC 2169.964538 1 0.0002 1250 | 3/21
27 h-m-p 0.0040 0.0798 0.4994 CC 2169.919560 1 0.0059 1294 | 3/21
28 h-m-p 0.0002 0.0011 15.9381 CC 2169.908563 1 0.0001 1338 | 3/21
29 h-m-p 0.0110 5.4754 0.3964 +++CCC 2169.155770 2 0.6184 1387 | 3/21
30 h-m-p 0.2120 6.5043 1.1561 CCC 2168.881360 2 0.2031 1433 | 3/21
31 h-m-p 1.1727 5.8635 0.0215 CCCC 2168.726154 3 1.4299 1481 | 3/21
32 h-m-p 1.6000 8.0000 0.0065 CCC 2168.607464 2 1.9529 1527 | 3/21
33 h-m-p 1.6000 8.0000 0.0070 CC 2168.571879 1 1.4537 1571 | 3/21
34 h-m-p 1.6000 8.0000 0.0054 CC 2168.544823 1 2.4702 1615 | 3/21
35 h-m-p 1.6000 8.0000 0.0016 YC 2168.518722 1 3.0709 1658 | 3/21
36 h-m-p 1.6000 8.0000 0.0028 +YC 2168.489174 1 4.4583 1702 | 3/21
37 h-m-p 1.6000 8.0000 0.0010 YC 2168.451973 1 3.5392 1745 | 3/21
38 h-m-p 0.4928 8.0000 0.0068 +C 2168.432084 0 1.8408 1788 | 3/21
39 h-m-p 1.6000 8.0000 0.0030 CC 2168.429464 1 1.4592 1832 | 3/21
40 h-m-p 1.6000 8.0000 0.0013 C 2168.428961 0 2.0050 1874 | 3/21
41 h-m-p 1.6000 8.0000 0.0009 C 2168.428856 0 1.7693 1916 | 3/21
42 h-m-p 1.6000 8.0000 0.0000 Y 2168.428846 0 1.1232 1958 | 3/21
43 h-m-p 0.4280 8.0000 0.0001 +C 2168.428845 0 1.5280 2001 | 3/21
44 h-m-p 1.6000 8.0000 0.0000 C 2168.428845 0 1.3791 2043 | 3/21
45 h-m-p 1.6000 8.0000 0.0000 Y 2168.428845 0 0.8549 2085 | 3/21
46 h-m-p 1.6000 8.0000 0.0000 C 2168.428845 0 0.5856 2127 | 3/21
47 h-m-p 1.6000 8.0000 0.0000 C 2168.428845 0 0.4000 2169 | 3/21
48 h-m-p 1.0221 8.0000 0.0000 C 2168.428845 0 0.2426 2211 | 3/21
49 h-m-p 0.2819 8.0000 0.0000 -----C 2168.428845 0 0.0001 2258
Out..
lnL = -2168.428845
2259 lfun, 6777 eigenQcodon, 81324 P(t)
Time used: 0:38
Model 2: PositiveSelection
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
initial w for M2:NSpselection reset.
0.020558 0.004621 0.001779 0.000967 0.007375 0.006085 0.035976 0.042513 0.007053 0.006257 0.020797 0.010140 0.002983 0.079763 0.022289 0.015616 0.018228 0.075665 2.132487 1.001601 0.301958 0.109127 2.014820
ntime & nrate & np: 18 3 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.728485
np = 23
lnL0 = -2334.754594
Iterating by ming2
Initial: fx= 2334.754594
x= 0.02056 0.00462 0.00178 0.00097 0.00737 0.00608 0.03598 0.04251 0.00705 0.00626 0.02080 0.01014 0.00298 0.07976 0.02229 0.01562 0.01823 0.07567 2.13249 1.00160 0.30196 0.10913 2.01482
1 h-m-p 0.0000 0.0000 896.8689 ++ 2332.691335 m 0.0000 51 | 1/23
2 h-m-p 0.0000 0.0000 472.5293 +YYCYC 2330.736468 4 0.0000 106 | 1/23
3 h-m-p 0.0000 0.0000 1634.2029 YCCC 2329.649211 3 0.0000 159 | 1/23
4 h-m-p 0.0000 0.0004 426.7572 +CYCCC 2326.349551 4 0.0001 215 | 1/23
5 h-m-p 0.0000 0.0002 513.6629 +YYCYC 2320.029152 4 0.0001 269 | 1/23
6 h-m-p 0.0000 0.0000 1100.1178 ++ 2313.146327 m 0.0000 317 | 2/23
7 h-m-p 0.0001 0.0003 654.1323 CCCC 2312.174482 3 0.0000 371 | 2/23
8 h-m-p 0.0001 0.0003 331.2761 YCCC 2310.879387 3 0.0001 423 | 2/23
9 h-m-p 0.0000 0.0001 810.4206 YCYCCC 2309.360821 5 0.0001 478 | 2/23
10 h-m-p 0.0000 0.0001 505.4693 +YYCCCC 2307.748588 5 0.0001 534 | 2/23
11 h-m-p 0.0001 0.0016 612.3168 ++YYCCC 2288.892247 4 0.0009 589 | 2/23
12 h-m-p 0.0001 0.0006 962.6683 +YCCC 2278.068230 3 0.0004 642 | 2/23
13 h-m-p 0.0001 0.0007 358.4309 +YYCCCC 2271.771446 5 0.0004 698 | 2/23
14 h-m-p 0.0004 0.0021 302.4191 YCCCC 2261.618365 4 0.0009 752 | 2/23
15 h-m-p 0.0002 0.0008 203.7858 +YYYCCC 2252.297038 5 0.0006 807 | 2/23
16 h-m-p 0.0001 0.0005 378.6538 YCYCCC 2245.195303 5 0.0003 862 | 2/23
17 h-m-p 0.0000 0.0002 224.4610 CCCCC 2244.665015 4 0.0000 917 | 2/23
18 h-m-p 0.0001 0.0006 67.3280 YCC 2244.541743 2 0.0001 967 | 2/23
19 h-m-p 0.0001 0.0043 80.1524 ++YCC 2243.356702 2 0.0008 1019 | 2/23
20 h-m-p 0.0106 0.1731 5.7793 ++YYCYCCC 2229.741567 6 0.1426 1077 | 2/23
21 h-m-p 0.0486 0.2429 5.9172 +YYCCCC 2212.070476 5 0.1530 1133 | 2/23
22 h-m-p 0.0536 0.2682 2.0414 CYCCC 2208.448222 4 0.1024 1187 | 2/23
23 h-m-p 0.0441 0.2411 4.7446 +CYCCC 2197.438166 4 0.1916 1242 | 2/23
24 h-m-p 0.0955 0.4776 1.2222 +YCYCCC 2186.795685 5 0.2772 1298 | 2/23
25 h-m-p 0.2939 1.4750 1.1527 +YCCCC 2180.814149 4 0.7727 1353 | 2/23
26 h-m-p 0.0917 0.4586 1.6593 +YCYCCC 2178.577235 5 0.2538 1409 | 2/23
27 h-m-p 0.3032 5.3646 1.3890 YCCC 2177.117388 3 0.5402 1461 | 2/23
28 h-m-p 0.8025 4.0124 0.8331 YYC 2175.712751 2 0.6936 1510 | 2/23
29 h-m-p 0.6773 3.3867 0.6432 CCCC 2174.646782 3 0.7924 1563 | 2/23
30 h-m-p 0.3361 2.2192 1.5165 YCCC 2172.843789 3 0.6916 1615 | 2/23
31 h-m-p 0.3505 1.7523 0.9775 CCCC 2171.353858 3 0.5526 1668 | 2/23
32 h-m-p 0.6860 3.4300 0.7056 CCCC 2170.032805 3 1.0258 1721 | 2/23
33 h-m-p 0.3634 1.8169 0.4361 CCCC 2169.449295 3 0.6520 1774 | 2/23
34 h-m-p 1.3750 6.8751 0.0907 YCCC 2169.109408 3 0.6958 1826 | 2/23
35 h-m-p 0.6258 8.0000 0.1009 +YCC 2168.949230 2 1.8345 1877 | 2/23
36 h-m-p 0.9251 8.0000 0.2001 YC 2168.794065 1 1.9988 1925 | 2/23
37 h-m-p 1.6000 8.0000 0.1698 YCC 2168.675791 2 2.7257 1975 | 2/23
38 h-m-p 1.2589 8.0000 0.3675 CC 2168.605379 1 1.6779 2024 | 2/23
39 h-m-p 1.6000 8.0000 0.2354 YCC 2168.547309 2 2.4577 2074 | 2/23
40 h-m-p 1.6000 8.0000 0.3498 YCC 2168.485504 2 2.9695 2124 | 2/23
41 h-m-p 1.6000 8.0000 0.4519 CCC 2168.452727 2 2.0858 2175 | 2/23
42 h-m-p 1.6000 8.0000 0.5091 YC 2168.441602 1 1.2388 2223 | 2/23
43 h-m-p 1.3391 8.0000 0.4709 C 2168.435715 0 1.3391 2270 | 2/23
44 h-m-p 1.5300 8.0000 0.4122 CC 2168.432241 1 1.9598 2319 | 2/23
45 h-m-p 1.6000 8.0000 0.4898 CC 2168.429195 1 2.0100 2368 | 2/23
46 h-m-p 1.6000 8.0000 0.3891 C 2168.428067 0 1.9059 2415 | 2/23
47 h-m-p 1.6000 8.0000 0.3526 CC 2168.427379 1 2.1453 2464 | 2/23
48 h-m-p 1.6000 8.0000 0.3189 YC 2168.426902 1 2.7465 2512 | 2/23
49 h-m-p 1.6000 8.0000 0.3273 YC 2168.426480 1 2.9608 2560 | 2/23
50 h-m-p 1.6000 8.0000 0.2461 C 2168.426389 0 1.7017 2607 | 2/23
51 h-m-p 1.6000 8.0000 0.1835 Y 2168.426338 0 3.3482 2654 | 2/23
52 h-m-p 1.6000 8.0000 0.2863 Y 2168.426299 0 2.8758 2701 | 2/23
53 h-m-p 1.6000 8.0000 0.4239 Y 2168.426268 0 2.6433 2748 | 2/23
54 h-m-p 1.6000 8.0000 0.4298 C 2168.426255 0 2.4132 2795 | 2/23
55 h-m-p 1.6000 8.0000 0.4767 Y 2168.426247 0 2.7291 2842 | 2/23
56 h-m-p 1.6000 8.0000 0.4395 C 2168.426244 0 1.8445 2889 | 2/23
57 h-m-p 1.6000 8.0000 0.3000 Y 2168.426244 0 2.7216 2936 | 2/23
58 h-m-p 1.6000 8.0000 0.2512 Y 2168.426243 0 3.7358 2983 | 2/23
59 h-m-p 1.6000 8.0000 0.4888 Y 2168.426243 0 2.7925 3030 | 2/23
60 h-m-p 1.6000 8.0000 0.3873 C 2168.426243 0 2.1593 3077 | 2/23
61 h-m-p 1.6000 8.0000 0.4432 +Y 2168.426242 0 4.1092 3125 | 2/23
62 h-m-p 1.6000 8.0000 0.3879 C 2168.426242 0 1.6652 3172 | 2/23
63 h-m-p 1.4441 8.0000 0.4473 +Y 2168.426242 0 4.2338 3220 | 2/23
64 h-m-p 1.6000 8.0000 0.5586 C 2168.426242 0 2.2857 3267 | 2/23
65 h-m-p 1.6000 8.0000 0.0518 C 2168.426242 0 0.5872 3314 | 2/23
66 h-m-p 0.0160 8.0000 6.3606 Y 2168.426242 0 0.0026 3361 | 2/23
67 h-m-p 0.3070 8.0000 0.0538 -C 2168.426242 0 0.0192 3409 | 2/23
68 h-m-p 1.1545 8.0000 0.0009 ----------------.. | 2/23
69 h-m-p 0.0160 8.0000 0.0013 -----------Y 2168.426242 0 0.0000 3528 | 2/23
70 h-m-p 0.0160 8.0000 0.0025 -------------.. | 2/23
71 h-m-p 0.0160 8.0000 0.0013 -------------
Out..
lnL = -2168.426242
3645 lfun, 14580 eigenQcodon, 196830 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2220.455779 S = -2193.014050 -19.000190
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 139 patterns 1:40
did 20 / 139 patterns 1:40
did 30 / 139 patterns 1:40
did 40 / 139 patterns 1:40
did 50 / 139 patterns 1:41
did 60 / 139 patterns 1:41
did 70 / 139 patterns 1:41
did 80 / 139 patterns 1:41
did 90 / 139 patterns 1:41
did 100 / 139 patterns 1:41
did 110 / 139 patterns 1:41
did 120 / 139 patterns 1:41
did 130 / 139 patterns 1:41
did 139 / 139 patterns 1:41
Time used: 1:41
Model 3: discrete
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
0.020558 0.004621 0.001779 0.000967 0.007375 0.006085 0.035976 0.042513 0.007053 0.006257 0.020797 0.010140 0.002983 0.079763 0.022289 0.015616 0.018228 0.075665 2.132469 0.898262 0.025525 0.000050 0.000113 0.000175
ntime & nrate & np: 18 4 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.363317
np = 24
lnL0 = -2173.029719
Iterating by ming2
Initial: fx= 2173.029719
x= 0.02056 0.00462 0.00178 0.00097 0.00737 0.00608 0.03598 0.04251 0.00705 0.00626 0.02080 0.01014 0.00298 0.07976 0.02229 0.01562 0.01823 0.07567 2.13247 0.89826 0.02553 0.00005 0.00011 0.00017
1 h-m-p 0.0000 0.0000 783.0860 ++ 2172.917223 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0000 890.4571 ++ 2172.718511 m 0.0000 104 | 2/24
3 h-m-p 0.0000 0.0000 2193.4090 ++ 2172.609265 m 0.0000 154 | 3/24
4 h-m-p 0.0000 0.0000 2136.6523 ++ 2172.441042 m 0.0000 203 | 4/24
5 h-m-p 0.0000 0.0003 128.6817 +CC 2172.181833 1 0.0000 254 | 4/24
6 h-m-p 0.0001 0.0007 108.7441 CCC 2172.051181 2 0.0000 305 | 4/24
7 h-m-p 0.0000 0.0002 81.3250 CYY 2171.970754 2 0.0000 355 | 4/24
8 h-m-p 0.0001 0.0025 36.2178 YCC 2171.940659 2 0.0001 405 | 4/24
9 h-m-p 0.0001 0.0006 36.5747 YC 2171.921944 1 0.0000 453 | 4/24
10 h-m-p 0.0002 0.0038 7.6591 CC 2171.907279 1 0.0002 502 | 4/24
11 h-m-p 0.0002 0.0021 10.2017 CCC 2171.870516 2 0.0002 553 | 4/24
12 h-m-p 0.0001 0.0015 37.5753 CYC 2171.817818 2 0.0001 603 | 4/24
13 h-m-p 0.0002 0.0022 12.3534 +CCCC 2170.923986 3 0.0009 657 | 4/24
14 h-m-p 0.0001 0.0004 64.2389 CCCC 2170.615963 3 0.0001 710 | 4/24
15 h-m-p 0.0002 0.0012 37.1557 CCC 2170.516596 2 0.0001 761 | 4/24
16 h-m-p 0.0003 0.0058 17.5152 CC 2170.501445 1 0.0001 810 | 4/24
17 h-m-p 0.0002 0.0034 12.0644 YC 2170.496843 1 0.0001 858 | 4/24
18 h-m-p 0.0006 0.0305 1.6970 C 2170.496410 0 0.0001 905 | 4/24
19 h-m-p 0.0013 0.6677 0.1744 ++++YYYCC 2169.067383 4 0.3268 961 | 4/24
20 h-m-p 0.2689 1.4313 0.2119 YCC 2168.590823 2 0.4318 1011 | 4/24
21 h-m-p 0.2418 5.2381 0.3785 CYC 2168.549586 2 0.2775 1061 | 4/24
22 h-m-p 0.9109 4.5547 0.0509 CCC 2168.448609 2 0.9647 1112 | 4/24
23 h-m-p 1.6000 8.0000 0.0097 YCC 2168.433086 2 1.0270 1162 | 4/24
24 h-m-p 0.5889 8.0000 0.0169 CC 2168.429690 1 0.6816 1211 | 4/24
25 h-m-p 0.9910 8.0000 0.0116 CC 2168.426953 1 1.3093 1260 | 4/24
26 h-m-p 1.6000 8.0000 0.0033 C 2168.426375 0 1.4529 1307 | 4/24
27 h-m-p 1.6000 8.0000 0.0018 C 2168.426259 0 1.7876 1354 | 4/24
28 h-m-p 1.6000 8.0000 0.0007 Y 2168.426243 0 1.2039 1401 | 4/24
29 h-m-p 1.6000 8.0000 0.0001 Y 2168.426242 0 1.0365 1448 | 4/24
30 h-m-p 1.6000 8.0000 0.0000 Y 2168.426242 0 0.9512 1495 | 4/24
31 h-m-p 1.6000 8.0000 0.0000 Y 2168.426242 0 0.6650 1542 | 4/24
32 h-m-p 1.6000 8.0000 0.0000 C 2168.426242 0 0.4000 1589 | 4/24
33 h-m-p 0.7751 8.0000 0.0000 C 2168.426242 0 0.2500 1636 | 4/24
34 h-m-p 0.3632 8.0000 0.0000 -Y 2168.426242 0 0.0227 1684
Out..
lnL = -2168.426242
1685 lfun, 6740 eigenQcodon, 90990 P(t)
Time used: 2:08
Model 7: beta
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
0.020558 0.004621 0.001779 0.000967 0.007375 0.006085 0.035976 0.042513 0.007053 0.006257 0.020797 0.010140 0.002983 0.079763 0.022289 0.015616 0.018228 0.075665 2.132471 0.649633 1.679063
ntime & nrate & np: 18 1 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.949046
np = 21
lnL0 = -2262.423368
Iterating by ming2
Initial: fx= 2262.423368
x= 0.02056 0.00462 0.00178 0.00097 0.00737 0.00608 0.03598 0.04251 0.00705 0.00626 0.02080 0.01014 0.00298 0.07976 0.02229 0.01562 0.01823 0.07567 2.13247 0.64963 1.67906
1 h-m-p 0.0000 0.0000 790.8079 ++ 2260.929905 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 383.0039 +YCYCCC 2260.028026 5 0.0000 101 | 1/21
3 h-m-p 0.0000 0.0000 818.3216 CCCC 2259.472332 3 0.0000 151 | 1/21
4 h-m-p 0.0000 0.0001 312.1701 YCC 2258.927469 2 0.0000 198 | 1/21
5 h-m-p 0.0000 0.0002 342.9432 YCCC 2257.744573 3 0.0001 247 | 1/21
6 h-m-p 0.0001 0.0003 263.4045 YCCCC 2256.114517 4 0.0001 298 | 1/21
7 h-m-p 0.0000 0.0002 865.4393 +YCCCC 2252.757312 4 0.0001 350 | 1/21
8 h-m-p 0.0000 0.0001 823.1311 +YYYCCC 2249.064441 5 0.0001 402 | 1/21
9 h-m-p 0.0000 0.0001 2997.3710 +YYYCCC 2234.935079 5 0.0001 454 | 1/21
10 h-m-p 0.0000 0.0000 11917.6429 ++ 2205.531135 m 0.0000 498 | 2/21
11 h-m-p 0.0000 0.0000 910.1921 CCCCC 2205.002796 4 0.0000 550 | 2/21
12 h-m-p 0.0000 0.0002 418.3942 CYCC 2204.395390 3 0.0000 598 | 2/21
13 h-m-p 0.0001 0.0004 92.8608 YYC 2204.089246 2 0.0001 643 | 2/21
14 h-m-p 0.0001 0.0004 70.4880 YC 2204.002581 1 0.0000 687 | 2/21
15 h-m-p 0.0000 0.0009 80.7207 +YCCC 2203.495700 3 0.0003 736 | 2/21
16 h-m-p 0.0000 0.0006 563.2949 +
QuantileBeta(0.15, 0.00500, 2.20756) = 1.188967e-160 2000 rounds
YYYCCCCC 2201.424984 7 0.0002 791 | 2/21
17 h-m-p 0.0002 0.0043 535.6835
QuantileBeta(0.15, 0.00500, 2.40568) = 1.068249e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.61331) = 6.586401e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.24739) = 5.479754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14911) = 7.727277e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.25096) = 7.444533e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.26396) = 7.409911e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.43863) = 6.974037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26950) = 7.395259e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.35406) = 7.178503e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
C 2179.494710 4 0.0024 842
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.394076e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26994) = 7.652200e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27009) = 7.393685e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26980) = 7.394466e-161 2000 rounds
| 2/21
18 h-m-p 0.0002 0.0012 58.6558
QuantileBeta(0.15, 0.00500, 3.28070) = 7.365797e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31297) = 7.282240e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27824) = 7.372240e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.27971) = 7.368393e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.27984) = 7.368044e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.28027) = 7.366920e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
C 2179.306785 3 0.0002 889
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.368030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27985) = 7.625245e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28000) = 7.367641e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.27970) = 7.368418e-161 2000 rounds
| 2/21
19 h-m-p 0.0001 0.0013 115.7375
QuantileBeta(0.15, 0.00500, 3.28889) = 7.344417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31600) = 7.274474e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28744) = 7.348194e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.28364) = 7.358099e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347709e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.28825) = 7.346063e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
C 2179.170854 2 0.0001 936
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.347706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28762) = 7.604212e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28777) = 7.347320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28748) = 7.348093e-161 2000 rounds
| 2/21
20 h-m-p 0.0079 1.4402 1.4617
QuantileBeta(0.15, 0.00500, 3.29042) = 7.340425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29881) = 7.318669e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.33236) = 7.232912e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.46658) = 6.908997e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.79778) = 6.221046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41217) = 7.036752e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.43976) = 6.971397e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.44059) = 6.969448e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.45358) = 6.939091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44117) = 6.968081e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.44737) = 6.953556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
C 2175.762534 4 0.4335 988
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 6.968042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44119) = 7.211294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44134) = 6.967685e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44103) = 6.968398e-161 2000 rounds
| 2/21
21 h-m-p 0.3587 1.7936 1.5150
QuantileBeta(0.15, 0.00500, 3.33745) = 7.220080e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02624) = 8.098184e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35404) = 7.178568e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.18185) = 7.634096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34113) = 7.210832e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211984e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.33906) = 7.216030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
C 2173.638663 3 0.3476 1036
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.211988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34067) = 7.463756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34082) = 7.211612e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34052) = 7.212363e-161 2000 rounds
| 2/21
22 h-m-p 0.3422 1.7110 0.2509
QuantileBeta(0.15, 0.00500, 3.31060) = 7.288301e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22039) = 7.527199e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30198) = 7.310484e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.26118) = 7.417267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29452) = 7.329779e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.27785) = 7.373264e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29354) = 7.332325e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.28569) = 7.352738e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29332) = 7.332885e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.28951) = 7.342798e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
C 2171.110502 4 0.5390 1087
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.332927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29331) = 7.588917e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29345) = 7.332541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29316) = 7.333312e-161 2000 rounds
| 2/21
23 h-m-p 0.4675 2.3374 0.0659
QuantileBeta(0.15, 0.00500, 3.29614) = 7.325583e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30463) = 7.303638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29616) = 7.325521e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.30040) = 7.314563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29646) = 7.324739e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.29843) = 7.319648e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324698e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.29745) = 7.322172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
C 2170.434237 3 0.5245 1136
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.324687e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29648) = 7.580390e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29663) = 7.324303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29633) = 7.325072e-161 2000 rounds
| 2/21
24 h-m-p 0.1755 8.0000 0.1970
QuantileBeta(0.15, 0.00500, 3.32470) = 7.252320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40935) = 7.043515e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.74794) = 6.315720e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.58256) = 5.032438e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59010) = 6.635415e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.58930) = 6.637121e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.49932) = 6.834308e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58653) = 6.643023e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.54292) = 6.737314e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
C 2169.684454 3 1.8039 1186
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.643117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58648) = 6.875026e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58664) = 6.642786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.58633) = 6.643448e-161 2000 rounds
| 2/21
25 h-m-p 0.7136 3.5679 0.1889
QuantileBeta(0.15, 0.00500, 3.72121) = 6.367680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.12540) = 5.662889e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.83080) = 6.159876e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.84556) = 6.132919e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.98548) = 5.888570e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86516) = 6.097480e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.92532) = 5.991210e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86744) = 6.093376e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.89638) = 6.041863e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
C 2169.085822 4 1.4911 1236
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.092353e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86801) = 6.305035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86818) = 6.092063e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86785) = 6.092643e-161 2000 rounds
| 2/21
26 h-m-p 1.2110 6.0552 0.2270
QuantileBeta(0.15, 0.00500, 4.09946) = 5.703411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.79381) = 4.786121e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00818) = 5.850749e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.00464) = 5.856607e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.93633) = 5.972162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00025) = 5.863909e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.96829) = 5.917542e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
C 2168.795537 3 0.6908 1284
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 5.864273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00003) = 6.068993e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00019) = 5.864000e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99986) = 5.864547e-161 2000 rounds
| 2/21
27 h-m-p 1.6000 8.0000 0.0902
QuantileBeta(0.15, 0.00500, 4.12728) = 5.659968e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50905) = 5.124195e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11636) = 5.676948e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.05819) = 5.769095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11229) = 5.683304e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.08524) = 5.725879e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
C 2168.680311 2 1.4100 1331
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.683478e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11218) = 5.881886e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11234) = 5.683217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11201) = 5.683739e-161 2000 rounds
| 2/21
28 h-m-p 1.6000 8.0000 0.0535
QuantileBeta(0.15, 0.00500, 4.19048) = 5.563697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42538) = 5.232774e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22134) = 5.517850e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.32336) = 5.371543e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22532) = 5.511997e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.27434) = 5.440866e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
C 2168.604861 2 2.3243 1378
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.511112e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22592) = 5.703503e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22609) = 5.510863e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22576) = 5.511361e-161 2000 rounds
| 2/21
29 h-m-p 1.6000 8.0000 0.0026
QuantileBeta(0.15, 0.00500, 4.22312) = 5.515238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21470) = 5.527655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22194) = 5.516971e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.21832) = 5.522308e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22184) = 5.517116e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.22008) = 5.519711e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
C 2168.554569 2 2.3360 1425
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.517139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22183) = 5.709740e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22200) = 5.516889e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22166) = 5.517388e-161 2000 rounds
| 2/21
30 h-m-p 0.3042 8.0000 0.0199
QuantileBeta(0.15, 0.00500, 4.21811) = 5.522615e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.20697) = 5.539111e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.16238) = 5.606088e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18901) = 5.565890e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
C 2168.505598 1 2.6919 1470
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.565982e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18895) = 5.760288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18912) = 5.565729e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.18878) = 5.566234e-161 2000 rounds
| 2/21
31 h-m-p 1.6000 8.0000 0.0273
QuantileBeta(0.15, 0.00500, 4.22828) = 5.507656e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34626) = 5.339769e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24911) = 5.477249e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.29768) = 5.407638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
C 2168.465819 1 2.4187 1515
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.478278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24840) = 5.669523e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24857) = 5.478031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.24823) = 5.478525e-161 2000 rounds
| 2/21
32 h-m-p 1.6000 8.0000 0.0258
QuantileBeta(0.15, 0.00500, 4.28941) = 5.419374e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.41242) = 5.250007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29512) = 5.411270e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.35377) = 5.329422e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
C 2168.447030 1 1.8110 1560
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.411699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29482) = 5.600620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29499) = 5.411457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29464) = 5.411941e-161 2000 rounds
| 2/21
33 h-m-p 1.6000 8.0000 0.0032
QuantileBeta(0.15, 0.00500, 4.29660) = 5.409173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30195) = 5.401608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29758) = 5.407787e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.29976) = 5.404695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
C 2168.430048 1 2.4921 1605
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.407765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29759) = 5.596548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29776) = 5.407523e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29742) = 5.408007e-161 2000 rounds
| 2/21
34 h-m-p 0.7822 8.0000 0.0101
QuantileBeta(0.15, 0.00500, 4.28981) = 5.418799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.26647) = 5.452172e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28590) = 5.424362e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.27618) = 5.438232e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
C 2168.426690 1 1.1764 1650
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.424376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28589) = 5.613739e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28606) = 5.424133e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28572) = 5.424619e-161 2000 rounds
| 2/21
35 h-m-p 1.6000 8.0000 0.0034
QuantileBeta(0.15, 0.00500, 4.28104) = 5.431289e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.26649) = 5.452134e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
C 2168.426242 0 1.3312 1693
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.430126e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28186) = 5.619690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28203) = 5.429883e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28169) = 5.430370e-161 2000 rounds
| 2/21
36 h-m-p 1.6000 8.0000 0.0007
QuantileBeta(0.15, 0.00500, 4.28284) = 5.428726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28578) = 5.424529e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
C 2168.426043 0 1.8028 1736
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.428548e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28296) = 5.618057e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28313) = 5.428305e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28279) = 5.428792e-161 2000 rounds
| 2/21
37 h-m-p 0.8856 8.0000 0.0014
QuantileBeta(0.15, 0.00500, 4.28410) = 5.426923e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28752) = 5.422054e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
Y 2168.426014 0 1.4941 1779
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.425807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28489) = 5.615220e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28506) = 5.425564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28471) = 5.426050e-161 2000 rounds
| 2/21
38 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 4.28476) = 5.425987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426526e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
C 2168.426008 0 1.3481 1822
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.425959e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28478) = 5.615377e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28495) = 5.425715e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28461) = 5.426202e-161 2000 rounds
| 2/21
39 h-m-p 0.5188 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 4.28462) = 5.426192e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28412) = 5.426894e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.28225) = 5.429566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
Y 2168.426006 0 1.3253 1866
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426556e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.615995e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28453) = 5.426313e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28419) = 5.426799e-161 2000 rounds
| 2/21
40 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28437) = 5.426535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
C 2168.426006 0 1.6499 1909
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28436) = 5.615990e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28453) = 5.426307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28419) = 5.426794e-161 2000 rounds
| 2/21
41 h-m-p 1.2949 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426529e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28442) = 5.426464e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
C 2168.426006 0 1.5960 1952
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.426524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28438) = 5.615962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28455) = 5.426281e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28421) = 5.426767e-161 2000 rounds
| 2/21
42 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426513e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28441) = 5.426479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
Y 2168.426006 0 1.0613 1995
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426516e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28439) = 5.615954e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28456) = 5.426273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28422) = 5.426760e-161 2000 rounds
| 2/21
43 h-m-p 0.9668 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.28439) = 5.426509e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28441) = 5.426486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
Y 2168.426006 0 2.4051 2038
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.426498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28440) = 5.615935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28457) = 5.426254e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28423) = 5.426741e-161 2000 rounds
| 2/21
44 h-m-p 0.6978 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.28441) = 5.426479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28445) = 5.426422e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.28455) = 5.426282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
Y 2168.426006 0 4.1668 2082
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.426385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28448) = 5.615819e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28465) = 5.426142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28431) = 5.426628e-161 2000 rounds
| 2/21
45 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.28455) = 5.426290e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28475) = 5.426006e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
+ 2168.426006 m 8.0000 2125
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.425911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28481) = 5.615327e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28498) = 5.425668e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28464) = 5.426154e-161 2000 rounds
| 2/21
46 h-m-p 0.9756 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 4.28515) = 5.425436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28615) = 5.424013e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
+ 2168.426006 m 8.0000 2168
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.422022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28754) = 5.611303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28772) = 5.421779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28737) = 5.422264e-161 2000 rounds
| 2/21
47 h-m-p 0.9615 8.0000 0.0028
QuantileBeta(0.15, 0.00500, 4.29028) = 5.418138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.29847) = 5.406521e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
+ 2168.426005 m 8.0000 2211
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.389878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31028) = 5.578037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31045) = 5.389638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.31010) = 5.390119e-161 2000 rounds
| 2/21
48 h-m-p 0.2657 8.0000 0.0855
QuantileBeta(0.15, 0.00500, 4.33301) = 5.358113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40120) = 5.265018e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.67397) = 4.922817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
Y 2168.426000 0 2.4154 2255
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.114229e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51691) = 5.292765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51708) = 5.114007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51673) = 5.114452e-161 2000 rounds
| 2/21
49 h-m-p 1.6000 8.0000 0.0763
QuantileBeta(0.15, 0.00500, 4.63905) = 4.964124e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.00550) = 4.562302e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
+ 2168.425967 m 8.0000 2298
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.442411e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12764) = 4.597494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12783) = 4.442231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.12745) = 4.442591e-161 2000 rounds
| 2/21
50 h-m-p 0.5992 8.0000 1.0192
QuantileBeta(0.15, 0.00500, 5.73838) = 3.926374e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.57059) = 2.911261e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 13.28106) = 1.611714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
Y 2168.425898 0 4.1777 2342
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.317511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38542) = 2.398414e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38569) = 2.317441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.38515) = 2.317581e-161 2000 rounds
| 2/21
51 h-m-p 1.6000 8.0000 0.7492
QuantileBeta(0.15, 0.00500, 10.58418) = 2.042324e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.18047) = 1.505822e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
C 2168.425846 0 2.1994 2385
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 1.955336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03327) = 2.023597e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03357) = 1.955281e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.03297) = 1.955391e-161 2000 rounds
| 2/21
52 h-m-p 1.2930 8.0000 1.2744
QuantileBeta(0.15, 0.00500, 12.68112) = 1.691035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.62466) = 1.203105e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 21.22856) = 9.940010e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
Y 2168.425821 0 3.5468 2429
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.368561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55340) = 1.416337e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55377) = 1.368527e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.55303) = 1.368594e-161 2000 rounds
| 2/21
53 h-m-p 1.6000 8.0000 1.7717
QuantileBeta(0.15, 0.00500, 18.38806) = 1.151781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 26.89205) = 7.807469e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 29.72671) = 7.050375e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
Y 2168.425797 0 4.0002 2473
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.306306e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64049) = 9.631186e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64096) = 9.306110e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.64003) = 9.306502e-162 2000 rounds
| 2/21
54 h-m-p 1.6000 8.0000 3.2460
QuantileBeta(0.15, 0.00500, 27.83407) = 7.538453e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.41482) = 3.868595e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
Y 2168.425783 0 3.2602 2516
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.073338e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22290) = 5.246828e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22350) = 5.073245e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.22231) = 5.073430e-162 2000 rounds
| 2/21
55 h-m-p 1.6000 8.0000 4.6727
QuantileBeta(0.15, 0.00500, 40.69927) = 4.129897e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
Y 2168.425772 0 3.1096 2559
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 2.102377e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75335) = 3.633582e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75410) = 2.102343e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 47.75259) = 2.102411e-162 2000 rounds
| 2/21
56 h-m-p 1.5249 7.6244 6.7214
QuantileBeta(0.15, 0.00500, 58.00268) = 7.304087e-163 2000 rounds
Y 2168.425765 0 3.2898 2602 | 2/21
57 h-m-p 0.5726 2.8632 10.1757 ++ 2168.425760 m 2.8632 2645 | 3/21
58 h-m-p 1.6000 8.0000 0.0000 Y 2168.425760 0 0.9755 2688 | 3/21
59 h-m-p 1.6000 8.0000 0.0000 -Y 2168.425760 0 0.1000 2731
Out..
lnL = -2168.425760
2732 lfun, 30052 eigenQcodon, 491760 P(t)
Time used: 5:24
Model 8: beta&w>1
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
initial w for M8:NSbetaw>1 reset.
0.020558 0.004621 0.001779 0.000967 0.007375 0.006085 0.035976 0.042513 0.007053 0.006257 0.020797 0.010140 0.002983 0.079763 0.022289 0.015616 0.018228 0.075665 2.132464 0.900000 0.578325 1.546757 2.928793
ntime & nrate & np: 18 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.962941
np = 23
lnL0 = -2299.759714
Iterating by ming2
Initial: fx= 2299.759714
x= 0.02056 0.00462 0.00178 0.00097 0.00737 0.00608 0.03598 0.04251 0.00705 0.00626 0.02080 0.01014 0.00298 0.07976 0.02229 0.01562 0.01823 0.07567 2.13246 0.90000 0.57833 1.54676 2.92879
1 h-m-p 0.0000 0.0000 1010.7459 ++ 2296.808633 m 0.0000 51 | 1/23
2 h-m-p 0.0000 0.0000 851.2204 +YCYYCCC 2290.889054 6 0.0000 110 | 1/23
3 h-m-p 0.0000 0.0000 7875.4754 +CCYC 2284.642300 3 0.0000 164 | 1/23
4 h-m-p 0.0000 0.0001 1307.6351 ++ 2262.586030 m 0.0001 212 | 2/23
5 h-m-p 0.0000 0.0002 228.4424 +YCYCC 2260.813042 4 0.0001 267 | 2/23
6 h-m-p 0.0000 0.0001 333.0578 YCCCC 2259.567695 4 0.0001 321 | 2/23
7 h-m-p 0.0000 0.0001 990.9385 +YCCC 2256.507194 3 0.0001 374 | 2/23
8 h-m-p 0.0000 0.0002 881.2359 YCCC 2253.931077 3 0.0001 426 | 2/23
9 h-m-p 0.0000 0.0002 1075.5350 +YYCCCC 2246.006444 5 0.0001 482 | 2/23
10 h-m-p 0.0000 0.0001 3691.5696 +CYYYCYCYCY 2228.264374 10 0.0001 544 | 2/23
11 h-m-p 0.0000 0.0000 78054.5136 +YCYC 2227.080802 3 0.0000 596 | 2/23
12 h-m-p 0.0001 0.0005 68.8438 CCC 2227.044235 2 0.0000 647 | 1/23
13 h-m-p 0.0000 0.0003 315.0100 +YCCC 2224.539201 3 0.0001 700 | 1/23
14 h-m-p 0.0000 0.0002 87.9731 YYC 2224.406244 2 0.0000 750 | 1/23
15 h-m-p 0.0000 0.0009 105.9868 +CYC 2224.073449 2 0.0001 802 | 1/23
16 h-m-p 0.0001 0.0011 131.5328 CCC 2223.858332 2 0.0001 854 | 1/23
17 h-m-p 0.0001 0.0023 102.2379 YCCC 2223.358997 3 0.0003 907 | 1/23
18 h-m-p 0.0001 0.0043 224.7105 ++CYC 2217.162808 2 0.0021 960 | 1/23
19 h-m-p 0.0002 0.0010 615.1074 +YYCCCC 2210.499924 5 0.0007 1017 | 1/23
20 h-m-p 0.0039 0.0194 47.6055 CCCCC 2208.071206 4 0.0047 1073 | 1/23
21 h-m-p 0.0014 0.0069 77.2343 +YCYCCC 2204.289502 5 0.0042 1130 | 1/23
22 h-m-p 0.0631 0.3157 1.8625 ++ 2197.423371 m 0.3157 1178 | 2/23
23 h-m-p 0.0715 0.3576 2.9428 +YCCCC 2188.177420 4 0.1941 1234 | 2/23
24 h-m-p 0.1204 0.6020 2.4577 YCCCCC 2180.686187 5 0.2600 1290 | 2/23
25 h-m-p 0.0908 0.4542 2.5860 +YCCC 2177.963327 3 0.2399 1343 | 2/23
26 h-m-p 0.1665 0.8327 0.5632 +YCCCC 2176.399267 4 0.4824 1398 | 2/23
27 h-m-p 0.1361 0.6806 0.3055 +
QuantileBeta(0.15, 0.00500, 3.68164) = 6.446196e-161 2000 rounds
YCC 2174.989176 2 0.5922 1449 | 2/23
28 h-m-p 0.0198 0.0989 0.1031 +
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
+ 2174.613775 m 0.0989 1496
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67622) = 6.457090e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67591) = 6.457724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67606) = 6.457407e-161 2000 rounds
| 3/23
29 h-m-p 0.0246 3.3104 0.4143
QuantileBeta(0.15, 0.00500, 3.67838) = 6.452735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68534) = 6.438759e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.71318) = 6.383455e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.82453) = 6.171392e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.73839) = 6.334187e-161 2000 rounds
C 2173.672674 1 0.6602 1546
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.555293e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73856) = 6.333862e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73824) = 6.334477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.73840) = 6.334170e-161 2000 rounds
| 3/23
30 h-m-p 0.1453 0.7263 0.6414
QuantileBeta(0.15, 0.00500, 3.80742) = 6.203059e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.01450) = 5.840294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90045) = 6.034696e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.90257) = 6.030958e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.95854) = 5.934100e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91363) = 6.011560e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.93609) = 5.972580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91442) = 6.010180e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.92526) = 5.991321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
C 2172.880666 4 0.3710 1599
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.219521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91485) = 6.009440e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91452) = 6.010007e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.91469) = 6.009724e-161 2000 rounds
| 3/23
31 h-m-p 0.8665 7.6640 0.2746
QuantileBeta(0.15, 0.00500, 4.11879) = 5.673163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.73110) = 4.856699e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.71983) = 3.940278e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.43470) = 5.220455e-161 2000 rounds
C 2171.626161 1 2.1906 1647
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.408230e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43083) = 5.225570e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43048) = 5.226029e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43065) = 5.225799e-161 2000 rounds
| 3/23
32 h-m-p 1.4155 7.3089 0.4250
QuantileBeta(0.15, 0.00500, 4.96299) = 4.605555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.55999) = 3.395545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.04008) = 4.527710e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.80003) = 3.880855e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01905) = 4.548683e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
C 2170.366739 2 1.5626 1696
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.708261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01848) = 4.549254e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01811) = 4.549628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.01829) = 4.549441e-161 2000 rounds
| 3/23
33 h-m-p 1.6000 8.0000 0.2424
QuantileBeta(0.15, 0.00500, 5.37784) = 4.215467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45650) = 3.454377e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.51783) = 4.098317e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.98716) = 3.748933e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50894) = 4.105557e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.44339) = 4.159788e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
C 2169.693810 2 2.1778 1746
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.249939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50789) = 4.106420e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50749) = 4.106740e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.50769) = 4.106580e-161 2000 rounds
| 3/23
34 h-m-p 0.9020 4.5098 0.3196
QuantileBeta(0.15, 0.00500, 5.78801) = 3.889647e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.62898) = 3.357422e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.85876) = 3.838467e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.24387) = 3.581886e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.92989) = 3.788346e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.08688) = 3.682228e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.93954) = 3.781652e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.01321) = 3.731279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
C 2169.223169 3 1.3969 1798
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.912025e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94203) = 3.779922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94162) = 3.780206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.94183) = 3.780064e-161 2000 rounds
| 3/23
35 h-m-p 1.6000 8.0000 0.2738
QuantileBeta(0.15, 0.00500, 6.37460) = 3.502403e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.67291) = 2.869811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.31051) = 3.540925e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.12617) = 3.656594e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29180) = 3.552333e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.20898) = 3.603711e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
C 2168.896095 2 1.2890 1848
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.677183e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29068) = 3.553015e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29026) = 3.553274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.29047) = 3.553144e-161 2000 rounds
| 3/23
36 h-m-p 1.6000 8.0000 0.0930
QuantileBeta(0.15, 0.00500, 6.39110) = 3.492621e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69300) = 3.322807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.40423) = 3.484878e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.54861) = 3.401916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41266) = 3.479920e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.48064) = 3.440476e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
C 2168.690531 2 1.9552 1898
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.600928e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41366) = 3.479335e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41323) = 3.479587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.41344) = 3.479461e-161 2000 rounds
| 3/23
37 h-m-p 1.2146 6.4157 0.1497
QuantileBeta(0.15, 0.00500, 6.45174) = 3.457137e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42302) = 3.473853e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42886) = 3.470439e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
C 2168.606919 1 0.4879 1945
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.591612e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42904) = 3.470334e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42861) = 3.470585e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42882) = 3.470460e-161 2000 rounds
| 3/23
38 h-m-p 1.6000 8.0000 0.0248
QuantileBeta(0.15, 0.00500, 6.42752) = 3.471224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42359) = 3.473520e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42795) = 3.470970e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471015e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.42769) = 3.471119e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
C 2168.507290 2 1.1689 1994
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.592190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42808) = 3.470893e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42765) = 3.471143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.42787) = 3.471018e-161 2000 rounds
| 3/23
39 h-m-p 0.3798 8.0000 0.0763
QuantileBeta(0.15, 0.00500, 6.43632) = 3.466092e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.46166) = 3.451396e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.56305) = 3.393837e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45789) = 3.453577e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.44710) = 3.459823e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
C 2168.467456 1 1.3201 2043
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.574531e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45745) = 3.453830e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45702) = 3.454079e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.45723) = 3.453955e-161 2000 rounds
| 3/23
40 h-m-p 1.0218 8.0000 0.0986
QuantileBeta(0.15, 0.00500, 6.54086) = 3.406267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.79175) = 3.270782e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59986) = 3.373409e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
C 2168.445986 1 1.7258 2090
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.491965e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59869) = 3.374053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59826) = 3.374293e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59847) = 3.374173e-161 2000 rounds
| 3/23
41 h-m-p 1.6000 8.0000 0.0690
QuantileBeta(0.15, 0.00500, 6.69603) = 3.321186e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.98868) = 3.171750e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68868) = 3.325121e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.64358) = 3.349468e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
C 2168.436653 1 1.4932 2138
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.440735e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68973) = 3.324554e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68929) = 3.324789e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68951) = 3.324672e-161 2000 rounds
| 3/23
42 h-m-p 1.6000 8.0000 0.0164
QuantileBeta(0.15, 0.00500, 6.68993) = 3.324448e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69118) = 3.323777e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324384e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.69062) = 3.324081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
C 2168.432108 1 2.0510 2186
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.440438e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69027) = 3.324268e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68983) = 3.324503e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69005) = 3.324385e-161 2000 rounds
| 3/23
43 h-m-p 1.6000 8.0000 0.0173
QuantileBeta(0.15, 0.00500, 6.66431) = 3.338233e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58708) = 3.380475e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65940) = 3.340886e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.62324) = 3.360564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
C 2168.430086 1 1.8954 2234
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.457428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65977) = 3.340683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65933) = 3.340920e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65955) = 3.340802e-161 2000 rounds
| 3/23
44 h-m-p 1.6000 8.0000 0.0047
QuantileBeta(0.15, 0.00500, 6.65511) = 3.343206e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.64179) = 3.350441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
C 2168.429864 0 1.4760 2280
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.459724e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65567) = 3.342901e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65524) = 3.343138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.65546) = 3.343020e-161 2000 rounds
| 3/23
45 h-m-p 1.6000 8.0000 0.0032
QuantileBeta(0.15, 0.00500, 6.65922) = 3.340980e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.67053) = 3.334874e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.67430) = 3.332844e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
C 2168.429615 1 4.2140 2328
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.454168e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66560) = 3.337534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66516) = 3.337770e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66538) = 3.337652e-161 2000 rounds
| 3/23
46 h-m-p 1.6000 8.0000 0.0028
QuantileBeta(0.15, 0.00500, 6.66911) = 3.335642e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.68028) = 3.329625e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
C 2168.429507 0 1.7677 2374
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.451870e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66972) = 3.335313e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66928) = 3.335549e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66950) = 3.335431e-161 2000 rounds
| 3/23
47 h-m-p 1.6000 8.0000 0.0011
QuantileBeta(0.15, 0.00500, 6.66822) = 3.336119e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66440) = 3.338183e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
C 2168.429495 0 1.4477 2420
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.452514e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66856) = 3.335935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66812) = 3.336171e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66834) = 3.336053e-161 2000 rounds
| 3/23
48 h-m-p 1.6000 8.0000 0.0007
QuantileBeta(0.15, 0.00500, 6.66718) = 3.336680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66369) = 3.338564e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
C 2168.429491 0 2.2715 2466
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.453435e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66691) = 3.336825e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66647) = 3.337062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66669) = 3.336944e-161 2000 rounds
| 3/23
49 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 6.66689) = 3.336837e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66748) = 3.336518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
C 2168.429489 0 2.4484 2512
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.453267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66678) = 3.336899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
| 3/23
50 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 6.66695) = 3.336807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66680) = 3.336886e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
C 2168.429488 0 2.3553 2558
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.453307e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66714) = 3.336701e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66670) = 3.336938e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66692) = 3.336820e-161 2000 rounds
| 3/23
51 h-m-p 1.4795 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 6.66705) = 3.336749e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66745) = 3.336535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
C 2168.429488 0 1.3339 2604
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.453241e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66726) = 3.336637e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66682) = 3.336874e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336756e-161 2000 rounds
| 3/23
52 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 6.66706) = 3.336745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66712) = 3.336713e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
C 2168.429488 0 1.9849 2650
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.453227e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66729) = 3.336624e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66685) = 3.336860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66707) = 3.336742e-161 2000 rounds
| 3/23
53 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 6.66706) = 3.336745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336755e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
+ 2168.429488 m 8.0000 2696
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.453243e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66726) = 3.336640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66682) = 3.336876e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66704) = 3.336758e-161 2000 rounds
| 3/23
54 h-m-p 1.0036 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 6.66706) = 3.336746e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66713) = 3.336710e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
+ 2168.429488 m 8.0000 2742
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.453145e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66743) = 3.336545e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66699) = 3.336781e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66721) = 3.336663e-161 2000 rounds
| 3/23
55 h-m-p 0.0160 8.0000 0.1707
QuantileBeta(0.15, 0.00500, 6.66750) = 3.336510e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.66835) = 3.336051e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.67175) = 3.334217e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.68535) = 3.326902e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.73977) = 3.297960e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.80893) = 3.261898e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
Y 2168.429475 0 2.5632 2792
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.427971e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71284) = 3.312221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71240) = 3.312455e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
| 3/23
56 h-m-p 1.4567 7.8625 0.3004
QuantileBeta(0.15, 0.00500, 6.75673) = 3.289043e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.88907) = 3.221082e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
+ 2168.428638 m 7.8625 2838
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.301750e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95094) = 3.190264e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95049) = 3.190486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.95071) = 3.190375e-161 2000 rounds
| 4/23
57 h-m-p 0.6540 8.0000 0.3640
QuantileBeta(0.15, 0.00500, 6.71262) = 3.312338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.99834) = 3.741338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
C 2168.428513 0 0.9961 2884
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.497900e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58832) = 3.379788e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58788) = 3.380029e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.58810) = 3.379909e-161 2000 rounds
| 4/23
58 h-m-p 1.6000 8.0000 0.0085
QuantileBeta(0.15, 0.00500, 6.60169) = 3.372398e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.64248) = 3.350065e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
Y 2168.428512 0 1.1770 2929
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.492179e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59832) = 3.374260e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59788) = 3.374501e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.59810) = 3.374381e-161 2000 rounds
| 4/23
59 h-m-p 0.8546 8.0000 0.0117
QuantileBeta(0.15, 0.00500, 6.60810) = 3.368870e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.63810) = 3.352447e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
+ 2168.428510 m 8.0000 2974
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.439515e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69193) = 3.323375e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69150) = 3.323610e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.69172) = 3.323493e-161 2000 rounds
| 4/23
60 h-m-p 0.0744 8.0000 1.2586
QuantileBeta(0.15, 0.00500, 6.78533) = 3.274115e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.06618) = 3.134402e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 8.18958) = 2.677331e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 12.68315) = 1.690752e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
Y 2168.428479 0 2.3528 3021
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.328395e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65325) = 2.249787e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65270) = 2.249921e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.65297) = 2.249854e-161 2000 rounds
| 4/23
61 h-m-p 1.6000 8.0000 0.6666
QuantileBeta(0.15, 0.00500, 10.71950) = 2.015309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.91909) = 1.535134e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
Y 2168.428437 0 3.9666 3066
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.806998e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29737) = 1.745997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29674) = 1.746091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 12.29705) = 1.746044e-161 2000 rounds
| 4/23
62 h-m-p 1.4452 8.0000 1.8295
QuantileBeta(0.15, 0.00500, 14.94113) = 1.426551e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 22.87337) = 9.209467e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 26.93319) = 7.795319e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
C 2168.428404 0 5.6355 3112
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.645664e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60772) = 9.320099e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60679) = 9.320491e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.60725) = 9.320295e-162 2000 rounds
| 4/23
63 h-m-p 1.6000 8.0000 2.8307
QuantileBeta(0.15, 0.00500, 27.13638) = 7.735869e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.72375) = 4.127384e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
C 2168.428389 0 1.9258 3157
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.738088e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05907) = 7.476921e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05800) = 7.477211e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.05853) = 7.477066e-162 2000 rounds
| 4/23
64 h-m-p 1.5677 8.0000 3.4772
QuantileBeta(0.15, 0.00500, 33.50982) = 5.029248e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 49.86366) = 2.012507e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 55.87632) = 7.584531e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
C 2168.428375 0 6.5483 3203
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 2.042965e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82935) = 1.973896e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82778) = 1.973958e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 50.82856) = 1.973927e-162 2000 rounds
| 4/23
65 h-m-p 1.4147 7.0737 6.8099 C 2168.428368 0 2.0117 3248 | 4/23
66 h-m-p 0.8452 4.2260 8.1571 ++ 2168.428363 m 4.2260 3293 | 5/23
67 h-m-p 1.6000 8.0000 0.0000 Y 2168.428362 0 1.0088 3338 | 5/23
68 h-m-p 1.6000 8.0000 0.0000 C 2168.428362 0 0.5683 3382
Out..
lnL = -2168.428362
3383 lfun, 40596 eigenQcodon, 669834 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2230.955350 S = -2193.013888 -29.244389
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 139 patterns 9:33
did 20 / 139 patterns 9:33
did 30 / 139 patterns 9:34
did 40 / 139 patterns 9:34
did 50 / 139 patterns 9:34
did 60 / 139 patterns 9:34
did 70 / 139 patterns 9:34
did 80 / 139 patterns 9:34
did 90 / 139 patterns 9:35
did 100 / 139 patterns 9:35
did 110 / 139 patterns 9:35
did 120 / 139 patterns 9:35
did 130 / 139 patterns 9:35
did 139 / 139 patterns 9:36
Time used: 9:36
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=366
D_melanogaster_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_sechellia_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_simulans_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_erecta_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_takahashii_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_biarmipes_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_suzukii_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_eugracilis_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_ficusphila_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_rhopaloa_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_elegans_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
**************************************************
D_melanogaster_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_sechellia_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_simulans_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_erecta_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_takahashii_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_biarmipes_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_suzukii_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_eugracilis_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_ficusphila_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_rhopaloa_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_elegans_acj6-PI DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
**************************************************
D_melanogaster_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_sechellia_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_simulans_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_erecta_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_takahashii_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_biarmipes_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_suzukii_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_eugracilis_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_ficusphila_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_rhopaloa_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_elegans_acj6-PI QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
**************************************************
D_melanogaster_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_sechellia_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_simulans_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_erecta_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_takahashii_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_biarmipes_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_suzukii_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_eugracilis_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_ficusphila_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_rhopaloa_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_elegans_acj6-PI NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
**************************************************
D_melanogaster_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_sechellia_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_simulans_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_erecta_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_takahashii_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_biarmipes_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_suzukii_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_eugracilis_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_ficusphila_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_rhopaloa_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_elegans_acj6-PI EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
**************************************************
D_melanogaster_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_sechellia_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_simulans_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_erecta_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_takahashii_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_biarmipes_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_suzukii_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_eugracilis_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_ficusphila_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_rhopaloa_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
D_elegans_acj6-PI HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP
**************************************************
D_melanogaster_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_sechellia_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_simulans_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_erecta_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_takahashii_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_biarmipes_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_suzukii_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_eugracilis_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_ficusphila_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_rhopaloa_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
D_elegans_acj6-PI EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS
**************************************************
D_melanogaster_acj6-PI SVTPSMTGHGSAGFGY
D_sechellia_acj6-PI SVTPSMTGHGSAGFGY
D_simulans_acj6-PI SVTPSMTGHGSAGFGY
D_erecta_acj6-PI SVTPSMTGHGSAGFGY
D_takahashii_acj6-PI SVTPSMTGHGSAGFGY
D_biarmipes_acj6-PI SVTPSMTGHGSAGFGY
D_suzukii_acj6-PI SVTPSMTGHGSAGFGY
D_eugracilis_acj6-PI SVTPSMTGHGSAGFGY
D_ficusphila_acj6-PI SVTPSMTGHGSAGFGY
D_rhopaloa_acj6-PI SVTPSMTGHGSAGFGY
D_elegans_acj6-PI SVTPSMTGHGSAGFGY
****************
>D_melanogaster_acj6-PI ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT CGCCGCTAACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCATACGGG GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCAG TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC CACAACAACATGATCGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_sechellia_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC CACAACAATATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_simulans_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC CACAACAACATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_erecta_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGATCCAACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_takahashii_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG CAGGAAAATCCCTTTTCCCGGCAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TAGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GTGCGCTGTCGCAGAGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCC GAAAAGCGTTCTTTGGAAGCCTACTTTGCCGTCCAGCCGAGGCCATCCGG TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_biarmipes_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGTCACCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGCTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCGTCCGG TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_suzukii_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGTCACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_eugracilis_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGATCCAACGGGCTCAATGACCACGTTGGCGCCCATATCGGAGT CGCCTCTAACGCCAACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGCCACCATGGACACTCAGCGGTACATCATCCTGTTATCACAGCGGCAG TGGCAGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCACAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCTGAGGCGCAGGCGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGG TGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCATCAATGACTGGCCACGGTTCAGCGGGATTTGGATAC >D_ficusphila_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG CAGGAAAATCCTTTCTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGACCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCTGCCGCTGGCCTGCATCCCGACACAGACACCGATCCCCGCGAGCTG GAGGCCTTCGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCG GCGCGCTGTCGCAGAGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGG TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_rhopaloa_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGGAAAATCCTTTTTCCCGACAGATGCACCACTCGATGGACCAACTGGA CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT CCCCACTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCCCGCGAGCTG GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GCGCGCTGTCGCAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGG TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_elegans_acj6-PI ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGT CCCCTCTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGCTAAGTGGCCACACGGG GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GCGCACTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGAAAAAGGACTTCCATTGCGGCACCT GAAAAGCGTTCCCTGGAAGCCTACTTTGCCGTGCAGCCGAGGCCATCCGG TGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGG TGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGT AGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>D_melanogaster_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_sechellia_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_simulans_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_erecta_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_takahashii_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_biarmipes_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_suzukii_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_eugracilis_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_ficusphila_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_rhopaloa_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY >D_elegans_acj6-PI MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRKRTSIAAP EKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVS SVTPSMTGHGSAGFGY
#NEXUS
[ID: 4331362082]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_acj6-PI
D_sechellia_acj6-PI
D_simulans_acj6-PI
D_erecta_acj6-PI
D_takahashii_acj6-PI
D_biarmipes_acj6-PI
D_suzukii_acj6-PI
D_eugracilis_acj6-PI
D_ficusphila_acj6-PI
D_rhopaloa_acj6-PI
D_elegans_acj6-PI
;
end;
begin trees;
translate
1 D_melanogaster_acj6-PI,
2 D_sechellia_acj6-PI,
3 D_simulans_acj6-PI,
4 D_erecta_acj6-PI,
5 D_takahashii_acj6-PI,
6 D_biarmipes_acj6-PI,
7 D_suzukii_acj6-PI,
8 D_eugracilis_acj6-PI,
9 D_ficusphila_acj6-PI,
10 D_rhopaloa_acj6-PI,
11 D_elegans_acj6-PI
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01693917,2:0.003097974,(3:0.001438001,(4:0.004473571,(5:0.03327816,((6:0.01884781,7:0.00581871)0.856:0.005804175,(9:0.09736387,(10:0.01084763,11:0.01533106)0.995:0.01739188)0.593:0.009683082)0.754:0.01112394,8:0.07207479)0.999:0.03006657)0.995:0.007511309)0.771:0.002869233);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01693917,2:0.003097974,(3:0.001438001,(4:0.004473571,(5:0.03327816,((6:0.01884781,7:0.00581871):0.005804175,(9:0.09736387,(10:0.01084763,11:0.01533106):0.01739188):0.009683082):0.01112394,8:0.07207479):0.03006657):0.007511309):0.002869233);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2266.17 -2284.86
2 -2265.95 -2284.74
--------------------------------------
TOTAL -2266.06 -2284.80
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PI/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.388850 0.003261 0.282135 0.497652 0.384365 1312.29 1397.93 1.000
r(A<->C){all} 0.118751 0.001152 0.060245 0.190239 0.115789 848.97 932.21 1.000
r(A<->G){all} 0.247701 0.002851 0.148755 0.355528 0.245181 471.46 516.19 1.000
r(A<->T){all} 0.111127 0.001423 0.041648 0.184680 0.107305 777.09 799.93 1.000
r(C<->G){all} 0.065652 0.000415 0.029946 0.107426 0.063244 844.44 944.36 1.000
r(C<->T){all} 0.445810 0.003740 0.322958 0.563454 0.446044 672.17 746.40 1.000
r(G<->T){all} 0.010958 0.000105 0.000022 0.031156 0.007902 782.15 813.64 1.000
pi(A){all} 0.241819 0.000149 0.217424 0.265722 0.241292 1266.11 1281.69 1.000
pi(C){all} 0.306077 0.000175 0.280298 0.331841 0.306253 1162.05 1280.55 1.000
pi(G){all} 0.270149 0.000173 0.244127 0.295796 0.270271 1262.34 1311.24 1.000
pi(T){all} 0.181955 0.000121 0.160300 0.202828 0.181911 1185.48 1279.24 1.000
alpha{1,2} 0.045390 0.000683 0.000112 0.086819 0.047038 1048.01 1140.40 1.000
alpha{3} 2.455511 0.675468 1.067352 4.100930 2.337238 1389.62 1445.31 1.000
pinvar{all} 0.746716 0.000690 0.694248 0.797080 0.747571 1285.60 1323.85 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/acj6-PI/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 366
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 5 4 | Ser TCT 3 3 2 2 2 2 | Tyr TAT 3 2 2 3 2 2 | Cys TGT 2 2 2 2 2 2
TTC 5 5 5 5 4 5 | TCC 7 7 8 8 7 7 | TAC 4 5 5 4 5 5 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 3 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 1 | TCG 10 10 10 10 10 11 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 0 0 0 | Pro CCT 6 6 6 6 3 6 | His CAT 11 9 9 9 9 9 | Arg CGT 5 5 5 5 4 3
CTC 3 4 4 3 3 3 | CCC 9 9 9 10 13 10 | CAC 15 17 17 17 17 17 | CGC 6 7 7 7 8 8
CTA 1 0 0 0 0 0 | CCA 5 5 5 5 5 3 | Gln CAA 9 9 9 8 9 9 | CGA 4 3 3 3 2 4
CTG 16 17 17 18 18 19 | CCG 7 7 7 6 6 8 | CAG 11 11 11 12 11 11 | CGG 2 2 2 2 3 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 2 2 3 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 5 6 5 5 5 5 | Ser AGT 8 8 8 8 8 8
ATC 11 12 12 12 11 12 | ACC 3 3 3 3 2 2 | AAC 5 4 5 5 5 5 | AGC 6 6 6 6 6 6
ATA 1 1 1 1 1 1 | ACA 5 5 5 5 4 4 | Lys AAA 10 10 10 10 10 10 | Arg AGA 2 2 2 2 2 2
Met ATG 19 19 19 19 19 19 | ACG 9 9 9 9 11 11 | AAG 11 11 11 11 11 11 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 9 9 9 9 7 4 | Gly GGT 5 5 5 5 6 6
GTC 7 7 7 7 7 7 | GCC 12 12 12 12 12 13 | GAC 6 6 6 6 8 11 | GGC 9 9 9 9 10 10
GTA 3 3 3 3 4 3 | GCA 3 2 2 2 2 2 | Glu GAA 5 5 5 5 5 5 | GGA 7 7 7 7 5 5
GTG 4 4 4 4 3 4 | GCG 18 19 19 19 19 18 | GAG 11 11 11 11 11 11 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 2 4 5 | Ser TCT 2 2 1 1 2 | Tyr TAT 2 2 1 2 2 | Cys TGT 2 3 1 2 2
TTC 5 5 7 5 4 | TCC 7 7 7 9 8 | TAC 5 5 6 5 5 | TGC 2 1 3 2 2
Leu TTA 2 2 2 2 1 | TCA 3 6 3 3 3 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 4 3 3 3 | TCG 10 7 11 9 9 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 | Pro CCT 5 6 5 4 6 | His CAT 9 10 5 9 9 | Arg CGT 4 5 4 5 5
CTC 3 3 2 3 3 | CCC 10 9 12 11 10 | CAC 17 16 21 17 17 | CGC 7 6 7 6 6
CTA 0 1 1 0 1 | CCA 5 8 3 6 5 | Gln CAA 9 8 6 9 8 | CGA 4 2 2 3 4
CTG 18 15 17 17 17 | CCG 7 4 7 6 6 | CAG 11 12 14 11 12 | CGG 2 2 3 2 2
----------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 3 3 2 | Thr ACT 2 2 2 2 2 | Asn AAT 5 5 5 5 5 | Ser AGT 8 8 8 8 8
ATC 11 10 11 11 12 | ACC 3 2 2 3 3 | AAC 5 5 5 5 5 | AGC 6 6 6 6 6
ATA 1 3 1 1 1 | ACA 4 5 4 3 3 | Lys AAA 10 10 9 9 9 | Arg AGA 2 3 2 3 2
Met ATG 19 19 19 19 19 | ACG 10 10 11 11 11 | AAG 11 11 12 12 12 | AGG 2 3 3 2 2
----------------------------------------------------------------------------------------------------------------------
Val GTT 2 3 2 2 2 | Ala GCT 2 2 3 2 2 | Asp GAT 7 10 6 6 6 | Gly GGT 6 4 5 5 5
GTC 7 5 7 7 6 | GCC 13 11 13 13 13 | GAC 8 5 9 9 9 | GGC 9 12 10 11 11
GTA 3 4 3 3 3 | GCA 2 4 2 2 3 | Glu GAA 5 5 5 5 5 | GGA 5 5 6 5 5
GTG 4 4 4 4 5 | GCG 18 18 17 18 17 | GAG 11 11 11 11 11 | GGG 3 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_acj6-PI
position 1: T:0.13115 C:0.30328 A:0.27869 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.19399 C:0.30055 A:0.16120 G:0.34426
Average T:0.18488 C:0.29508 A:0.25137 G:0.26867
#2: D_sechellia_acj6-PI
position 1: T:0.13115 C:0.30328 A:0.27869 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.18306 C:0.31421 A:0.15301 G:0.34973
Average T:0.18124 C:0.29964 A:0.24863 G:0.27049
#3: D_simulans_acj6-PI
position 1: T:0.13115 C:0.30328 A:0.27869 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.17760 C:0.31967 A:0.15301 G:0.34973
Average T:0.17942 C:0.30146 A:0.24863 G:0.27049
#4: D_erecta_acj6-PI
position 1: T:0.13115 C:0.30328 A:0.27869 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.18033 C:0.31694 A:0.15027 G:0.35246
Average T:0.18033 C:0.30055 A:0.24772 G:0.27140
#5: D_takahashii_acj6-PI
position 1: T:0.13115 C:0.30328 A:0.27869 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.16940 C:0.32787 A:0.14754 G:0.35519
Average T:0.17668 C:0.30419 A:0.24681 G:0.27231
#6: D_biarmipes_acj6-PI
position 1: T:0.12842 C:0.30601 A:0.27869 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.16120 C:0.33607 A:0.14208 G:0.36066
Average T:0.17304 C:0.30783 A:0.24499 G:0.27413
#7: D_suzukii_acj6-PI
position 1: T:0.13115 C:0.30328 A:0.27869 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.17213 C:0.32240 A:0.15027 G:0.35519
Average T:0.17760 C:0.30237 A:0.24772 G:0.27231
#8: D_eugracilis_acj6-PI
position 1: T:0.13661 C:0.29235 A:0.28415 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.18579 C:0.29508 A:0.18033 G:0.33880
Average T:0.18397 C:0.28962 A:0.25956 G:0.26685
#9: D_ficusphila_acj6-PI
position 1: T:0.13388 C:0.29781 A:0.28142 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.14481 C:0.34973 A:0.13388 G:0.37158
Average T:0.16940 C:0.30965 A:0.24317 G:0.27778
#10: D_rhopaloa_acj6-PI
position 1: T:0.13388 C:0.29781 A:0.28142 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.16393 C:0.33607 A:0.14754 G:0.35246
Average T:0.17577 C:0.30510 A:0.24772 G:0.27140
#11: D_elegans_acj6-PI
position 1: T:0.13115 C:0.30328 A:0.27869 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.17213 C:0.32787 A:0.14481 G:0.35519
Average T:0.17760 C:0.30419 A:0.24590 G:0.27231
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 44 | Ser S TCT 22 | Tyr Y TAT 23 | Cys C TGT 22
TTC 55 | TCC 82 | TAC 54 | TGC 22
Leu L TTA 21 | TCA 31 | *** * TAA 0 | *** * TGA 0
TTG 26 | TCG 107 | TAG 0 | Trp W TGG 22
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 59 | His H CAT 98 | Arg R CGT 50
CTC 34 | CCC 112 | CAC 188 | CGC 75
CTA 4 | CCA 55 | Gln Q CAA 93 | CGA 34
CTG 189 | CCG 71 | CAG 127 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 27 | Thr T ACT 22 | Asn N AAT 56 | Ser S AGT 88
ATC 125 | ACC 29 | AAC 54 | AGC 66
ATA 13 | ACA 47 | Lys K AAA 107 | Arg R AGA 24
Met M ATG 209 | ACG 111 | AAG 124 | AGG 24
------------------------------------------------------------------------------
Val V GTT 23 | Ala A GCT 23 | Asp D GAT 82 | Gly G GGT 57
GTC 74 | GCC 136 | GAC 83 | GGC 109
GTA 35 | GCA 26 | Glu E GAA 55 | GGA 64
GTG 44 | GCG 200 | GAG 121 | GGG 23
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13189 C:0.30154 A:0.27968 G:0.28689
position 2: T:0.22951 C:0.28142 A:0.31421 G:0.17486
position 3: T:0.17312 C:0.32240 A:0.15127 G:0.35320
Average T:0.17818 C:0.30179 A:0.24839 G:0.27165
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_acj6-PI
D_sechellia_acj6-PI -1.0000 (0.0000 0.0356)
D_simulans_acj6-PI -1.0000 (0.0000 0.0356)-1.0000 (0.0000 0.0078)
D_erecta_acj6-PI -1.0000 (0.0000 0.0519)-1.0000 (0.0000 0.0275)-1.0000 (0.0000 0.0196)
D_takahashii_acj6-PI -1.0000 (0.0000 0.1537)-1.0000 (0.0000 0.1259)-1.0000 (0.0000 0.1259)-1.0000 (0.0000 0.1213)
D_biarmipes_acj6-PI -1.0000 (0.0000 0.1440)-1.0000 (0.0000 0.1166)-1.0000 (0.0000 0.1076)-1.0000 (0.0000 0.1031)-1.0000 (0.0000 0.0943)
D_suzukii_acj6-PI -1.0000 (0.0000 0.1302)-1.0000 (0.0000 0.1033)-1.0000 (0.0000 0.0945)-1.0000 (0.0000 0.0900)-1.0000 (0.0000 0.0901)-1.0000 (0.0000 0.0436)
D_eugracilis_acj6-PI -1.0000 (0.0000 0.1785)-1.0000 (0.0000 0.1836)-1.0000 (0.0000 0.1738)-1.0000 (0.0000 0.1688) 0.0069 (0.0012 0.1737)-1.0000 (0.0000 0.1733)-1.0000 (0.0000 0.1448)
D_ficusphila_acj6-PI -1.0000 (0.0000 0.2130)-1.0000 (0.0000 0.1880)-1.0000 (0.0000 0.1781)-1.0000 (0.0000 0.1731) 0.0062 (0.0012 0.1928)-1.0000 (0.0000 0.1679)-1.0000 (0.0000 0.1537)-1.0000 (0.0000 0.2403)
D_rhopaloa_acj6-PI -1.0000 (0.0000 0.1684)-1.0000 (0.0000 0.1447)-1.0000 (0.0000 0.1353)-1.0000 (0.0000 0.1399) 0.0102 (0.0012 0.1170)-1.0000 (0.0000 0.0945)-1.0000 (0.0000 0.0730)-1.0000 (0.0000 0.1643)-1.0000 (0.0000 0.1637)
D_elegans_acj6-PI -1.0000 (0.0000 0.1728)-1.0000 (0.0000 0.1490)-1.0000 (0.0000 0.1396)-1.0000 (0.0000 0.1349)-1.0000 (0.0000 0.1349)-1.0000 (0.0000 0.0899)-1.0000 (0.0000 0.0771)-1.0000 (0.0000 0.1638)-1.0000 (0.0000 0.1730)-1.0000 (0.0000 0.0479)
Model 0: one-ratio
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
check convergence..
lnL(ntime: 18 np: 20): -2168.474962 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023422 0.002831 0.002956 0.000004 0.008986 0.005624 0.041817 0.048988 0.013547 0.008613 0.026821 0.005885 0.009081 0.101993 0.015388 0.016373 0.020711 0.082009 2.133129 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43505
(1: 0.023422, 2: 0.002831, (3: 0.000004, (4: 0.005624, (5: 0.048988, ((6: 0.026821, 7: 0.005885): 0.008613, (9: 0.101993, (10: 0.016373, 11: 0.020711): 0.015388): 0.009081): 0.013547, 8: 0.082009): 0.041817): 0.008986): 0.002956);
(D_melanogaster_acj6-PI: 0.023422, D_sechellia_acj6-PI: 0.002831, (D_simulans_acj6-PI: 0.000004, (D_erecta_acj6-PI: 0.005624, (D_takahashii_acj6-PI: 0.048988, ((D_biarmipes_acj6-PI: 0.026821, D_suzukii_acj6-PI: 0.005885): 0.008613, (D_ficusphila_acj6-PI: 0.101993, (D_rhopaloa_acj6-PI: 0.016373, D_elegans_acj6-PI: 0.020711): 0.015388): 0.009081): 0.013547, D_eugracilis_acj6-PI: 0.082009): 0.041817): 0.008986): 0.002956);
Detailed output identifying parameters
kappa (ts/tv) = 2.13313
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 827.3 270.7 0.0001 0.0000 0.0317 0.0 8.6
12..2 0.003 827.3 270.7 0.0001 0.0000 0.0038 0.0 1.0
12..13 0.003 827.3 270.7 0.0001 0.0000 0.0040 0.0 1.1
13..3 0.000 827.3 270.7 0.0001 0.0000 0.0000 0.0 0.0
13..14 0.009 827.3 270.7 0.0001 0.0000 0.0121 0.0 3.3
14..4 0.006 827.3 270.7 0.0001 0.0000 0.0076 0.0 2.1
14..15 0.042 827.3 270.7 0.0001 0.0000 0.0565 0.0 15.3
15..5 0.049 827.3 270.7 0.0001 0.0000 0.0662 0.0 17.9
15..16 0.014 827.3 270.7 0.0001 0.0000 0.0183 0.0 5.0
16..17 0.009 827.3 270.7 0.0001 0.0000 0.0116 0.0 3.2
17..6 0.027 827.3 270.7 0.0001 0.0000 0.0362 0.0 9.8
17..7 0.006 827.3 270.7 0.0001 0.0000 0.0080 0.0 2.2
16..18 0.009 827.3 270.7 0.0001 0.0000 0.0123 0.0 3.3
18..9 0.102 827.3 270.7 0.0001 0.0000 0.1378 0.0 37.3
18..19 0.015 827.3 270.7 0.0001 0.0000 0.0208 0.0 5.6
19..10 0.016 827.3 270.7 0.0001 0.0000 0.0221 0.0 6.0
19..11 0.021 827.3 270.7 0.0001 0.0000 0.0280 0.0 7.6
15..8 0.082 827.3 270.7 0.0001 0.0000 0.1108 0.0 30.0
tree length for dN: 0.0001
tree length for dS: 0.5880
Time used: 0:13
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 21): -2168.428845 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023424 0.002831 0.002956 0.000004 0.008987 0.005624 0.041820 0.048992 0.013547 0.008613 0.026823 0.005885 0.009082 0.102005 0.015390 0.016374 0.020712 0.082016 2.132487 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43508
(1: 0.023424, 2: 0.002831, (3: 0.000004, (4: 0.005624, (5: 0.048992, ((6: 0.026823, 7: 0.005885): 0.008613, (9: 0.102005, (10: 0.016374, 11: 0.020712): 0.015390): 0.009082): 0.013547, 8: 0.082016): 0.041820): 0.008987): 0.002956);
(D_melanogaster_acj6-PI: 0.023424, D_sechellia_acj6-PI: 0.002831, (D_simulans_acj6-PI: 0.000004, (D_erecta_acj6-PI: 0.005624, (D_takahashii_acj6-PI: 0.048992, ((D_biarmipes_acj6-PI: 0.026823, D_suzukii_acj6-PI: 0.005885): 0.008613, (D_ficusphila_acj6-PI: 0.102005, (D_rhopaloa_acj6-PI: 0.016374, D_elegans_acj6-PI: 0.020712): 0.015390): 0.009082): 0.013547, D_eugracilis_acj6-PI: 0.082016): 0.041820): 0.008987): 0.002956);
Detailed output identifying parameters
kappa (ts/tv) = 2.13249
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 827.3 270.7 0.0000 0.0000 0.0317 0.0 8.6
12..2 0.003 827.3 270.7 0.0000 0.0000 0.0038 0.0 1.0
12..13 0.003 827.3 270.7 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 827.3 270.7 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 827.3 270.7 0.0000 0.0000 0.0121 0.0 3.3
14..4 0.006 827.3 270.7 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 827.3 270.7 0.0000 0.0000 0.0565 0.0 15.3
15..5 0.049 827.3 270.7 0.0000 0.0000 0.0662 0.0 17.9
15..16 0.014 827.3 270.7 0.0000 0.0000 0.0183 0.0 5.0
16..17 0.009 827.3 270.7 0.0000 0.0000 0.0116 0.0 3.2
17..6 0.027 827.3 270.7 0.0000 0.0000 0.0363 0.0 9.8
17..7 0.006 827.3 270.7 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 827.3 270.7 0.0000 0.0000 0.0123 0.0 3.3
18..9 0.102 827.3 270.7 0.0000 0.0000 0.1379 0.0 37.3
18..19 0.015 827.3 270.7 0.0000 0.0000 0.0208 0.0 5.6
19..10 0.016 827.3 270.7 0.0000 0.0000 0.0221 0.0 6.0
19..11 0.021 827.3 270.7 0.0000 0.0000 0.0280 0.0 7.6
15..8 0.082 827.3 270.7 0.0000 0.0000 0.1109 0.0 30.0
Time used: 0:38
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
check convergence..
lnL(ntime: 18 np: 23): -2168.426242 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023423 0.002831 0.002956 0.000004 0.008986 0.005624 0.041819 0.048991 0.013547 0.008613 0.026823 0.005885 0.009081 0.102002 0.015389 0.016374 0.020712 0.082014 2.132469 1.000000 0.000000 0.000001 23.115566
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43508
(1: 0.023423, 2: 0.002831, (3: 0.000004, (4: 0.005624, (5: 0.048991, ((6: 0.026823, 7: 0.005885): 0.008613, (9: 0.102002, (10: 0.016374, 11: 0.020712): 0.015389): 0.009081): 0.013547, 8: 0.082014): 0.041819): 0.008986): 0.002956);
(D_melanogaster_acj6-PI: 0.023423, D_sechellia_acj6-PI: 0.002831, (D_simulans_acj6-PI: 0.000004, (D_erecta_acj6-PI: 0.005624, (D_takahashii_acj6-PI: 0.048991, ((D_biarmipes_acj6-PI: 0.026823, D_suzukii_acj6-PI: 0.005885): 0.008613, (D_ficusphila_acj6-PI: 0.102002, (D_rhopaloa_acj6-PI: 0.016374, D_elegans_acj6-PI: 0.020712): 0.015389): 0.009081): 0.013547, D_eugracilis_acj6-PI: 0.082014): 0.041819): 0.008986): 0.002956);
Detailed output identifying parameters
kappa (ts/tv) = 2.13247
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 23.11557
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 827.3 270.7 0.0000 0.0000 0.0317 0.0 8.6
12..2 0.003 827.3 270.7 0.0000 0.0000 0.0038 0.0 1.0
12..13 0.003 827.3 270.7 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 827.3 270.7 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 827.3 270.7 0.0000 0.0000 0.0121 0.0 3.3
14..4 0.006 827.3 270.7 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 827.3 270.7 0.0000 0.0000 0.0565 0.0 15.3
15..5 0.049 827.3 270.7 0.0000 0.0000 0.0662 0.0 17.9
15..16 0.014 827.3 270.7 0.0000 0.0000 0.0183 0.0 5.0
16..17 0.009 827.3 270.7 0.0000 0.0000 0.0116 0.0 3.2
17..6 0.027 827.3 270.7 0.0000 0.0000 0.0363 0.0 9.8
17..7 0.006 827.3 270.7 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 827.3 270.7 0.0000 0.0000 0.0123 0.0 3.3
18..9 0.102 827.3 270.7 0.0000 0.0000 0.1379 0.0 37.3
18..19 0.015 827.3 270.7 0.0000 0.0000 0.0208 0.0 5.6
19..10 0.016 827.3 270.7 0.0000 0.0000 0.0221 0.0 6.0
19..11 0.021 827.3 270.7 0.0000 0.0000 0.0280 0.0 7.6
15..8 0.082 827.3 270.7 0.0000 0.0000 0.1109 0.0 30.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_acj6-PI)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.464 0.112 0.069 0.057 0.052 0.050 0.049 0.049 0.049 0.048
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:41
Model 3: discrete (3 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 24): -2168.426242 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023423 0.002831 0.002956 0.000004 0.008986 0.005624 0.041819 0.048991 0.013547 0.008613 0.026823 0.005885 0.009081 0.102003 0.015389 0.016374 0.020712 0.082014 2.132471 0.558941 0.230185 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43508
(1: 0.023423, 2: 0.002831, (3: 0.000004, (4: 0.005624, (5: 0.048991, ((6: 0.026823, 7: 0.005885): 0.008613, (9: 0.102003, (10: 0.016374, 11: 0.020712): 0.015389): 0.009081): 0.013547, 8: 0.082014): 0.041819): 0.008986): 0.002956);
(D_melanogaster_acj6-PI: 0.023423, D_sechellia_acj6-PI: 0.002831, (D_simulans_acj6-PI: 0.000004, (D_erecta_acj6-PI: 0.005624, (D_takahashii_acj6-PI: 0.048991, ((D_biarmipes_acj6-PI: 0.026823, D_suzukii_acj6-PI: 0.005885): 0.008613, (D_ficusphila_acj6-PI: 0.102003, (D_rhopaloa_acj6-PI: 0.016374, D_elegans_acj6-PI: 0.020712): 0.015389): 0.009081): 0.013547, D_eugracilis_acj6-PI: 0.082014): 0.041819): 0.008986): 0.002956);
Detailed output identifying parameters
kappa (ts/tv) = 2.13247
dN/dS (w) for site classes (K=3)
p: 0.55894 0.23018 0.21087
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 827.3 270.7 0.0000 0.0000 0.0317 0.0 8.6
12..2 0.003 827.3 270.7 0.0000 0.0000 0.0038 0.0 1.0
12..13 0.003 827.3 270.7 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 827.3 270.7 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 827.3 270.7 0.0000 0.0000 0.0121 0.0 3.3
14..4 0.006 827.3 270.7 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 827.3 270.7 0.0000 0.0000 0.0565 0.0 15.3
15..5 0.049 827.3 270.7 0.0000 0.0000 0.0662 0.0 17.9
15..16 0.014 827.3 270.7 0.0000 0.0000 0.0183 0.0 5.0
16..17 0.009 827.3 270.7 0.0000 0.0000 0.0116 0.0 3.2
17..6 0.027 827.3 270.7 0.0000 0.0000 0.0363 0.0 9.8
17..7 0.006 827.3 270.7 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 827.3 270.7 0.0000 0.0000 0.0123 0.0 3.3
18..9 0.102 827.3 270.7 0.0000 0.0000 0.1379 0.0 37.3
18..19 0.015 827.3 270.7 0.0000 0.0000 0.0208 0.0 5.6
19..10 0.016 827.3 270.7 0.0000 0.0000 0.0221 0.0 6.0
19..11 0.021 827.3 270.7 0.0000 0.0000 0.0280 0.0 7.6
15..8 0.082 827.3 270.7 0.0000 0.0000 0.1109 0.0 30.0
Naive Empirical Bayes (NEB) analysis
Time used: 2:08
Model 7: beta (10 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 21): -2168.425760 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023423 0.002831 0.002956 0.000004 0.008986 0.005624 0.041819 0.048991 0.013547 0.008613 0.026823 0.005885 0.009081 0.102003 0.015389 0.016374 0.020712 0.082014 2.132464 0.005000 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43508
(1: 0.023423, 2: 0.002831, (3: 0.000004, (4: 0.005624, (5: 0.048991, ((6: 0.026823, 7: 0.005885): 0.008613, (9: 0.102003, (10: 0.016374, 11: 0.020712): 0.015389): 0.009081): 0.013547, 8: 0.082014): 0.041819): 0.008986): 0.002956);
(D_melanogaster_acj6-PI: 0.023423, D_sechellia_acj6-PI: 0.002831, (D_simulans_acj6-PI: 0.000004, (D_erecta_acj6-PI: 0.005624, (D_takahashii_acj6-PI: 0.048991, ((D_biarmipes_acj6-PI: 0.026823, D_suzukii_acj6-PI: 0.005885): 0.008613, (D_ficusphila_acj6-PI: 0.102003, (D_rhopaloa_acj6-PI: 0.016374, D_elegans_acj6-PI: 0.020712): 0.015389): 0.009081): 0.013547, D_eugracilis_acj6-PI: 0.082014): 0.041819): 0.008986): 0.002956);
Detailed output identifying parameters
kappa (ts/tv) = 2.13246
Parameters in M7 (beta):
p = 0.00500 q = 99.00000
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 827.3 270.7 0.0000 0.0000 0.0317 0.0 8.6
12..2 0.003 827.3 270.7 0.0000 0.0000 0.0038 0.0 1.0
12..13 0.003 827.3 270.7 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 827.3 270.7 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 827.3 270.7 0.0000 0.0000 0.0121 0.0 3.3
14..4 0.006 827.3 270.7 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 827.3 270.7 0.0000 0.0000 0.0565 0.0 15.3
15..5 0.049 827.3 270.7 0.0000 0.0000 0.0662 0.0 17.9
15..16 0.014 827.3 270.7 0.0000 0.0000 0.0183 0.0 5.0
16..17 0.009 827.3 270.7 0.0000 0.0000 0.0116 0.0 3.2
17..6 0.027 827.3 270.7 0.0000 0.0000 0.0363 0.0 9.8
17..7 0.006 827.3 270.7 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 827.3 270.7 0.0000 0.0000 0.0123 0.0 3.3
18..9 0.102 827.3 270.7 0.0000 0.0000 0.1379 0.0 37.3
18..19 0.015 827.3 270.7 0.0000 0.0000 0.0208 0.0 5.6
19..10 0.016 827.3 270.7 0.0000 0.0000 0.0221 0.0 6.0
19..11 0.021 827.3 270.7 0.0000 0.0000 0.0280 0.0 7.6
15..8 0.082 827.3 270.7 0.0000 0.0000 0.1109 0.0 30.0
Time used: 5:24
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 23): -2168.428362 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023424 0.002831 0.002956 0.000004 0.008987 0.005624 0.041820 0.048992 0.013547 0.008613 0.026823 0.005885 0.009082 0.102005 0.015390 0.016374 0.020712 0.082016 2.132481 0.999990 0.005000 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43509
(1: 0.023424, 2: 0.002831, (3: 0.000004, (4: 0.005624, (5: 0.048992, ((6: 0.026823, 7: 0.005885): 0.008613, (9: 0.102005, (10: 0.016374, 11: 0.020712): 0.015390): 0.009082): 0.013547, 8: 0.082016): 0.041820): 0.008987): 0.002956);
(D_melanogaster_acj6-PI: 0.023424, D_sechellia_acj6-PI: 0.002831, (D_simulans_acj6-PI: 0.000004, (D_erecta_acj6-PI: 0.005624, (D_takahashii_acj6-PI: 0.048992, ((D_biarmipes_acj6-PI: 0.026823, D_suzukii_acj6-PI: 0.005885): 0.008613, (D_ficusphila_acj6-PI: 0.102005, (D_rhopaloa_acj6-PI: 0.016374, D_elegans_acj6-PI: 0.020712): 0.015390): 0.009082): 0.013547, D_eugracilis_acj6-PI: 0.082016): 0.041820): 0.008987): 0.002956);
Detailed output identifying parameters
kappa (ts/tv) = 2.13248
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 99.00000
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.023 827.3 270.7 0.0000 0.0000 0.0317 0.0 8.6
12..2 0.003 827.3 270.7 0.0000 0.0000 0.0038 0.0 1.0
12..13 0.003 827.3 270.7 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 827.3 270.7 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 827.3 270.7 0.0000 0.0000 0.0121 0.0 3.3
14..4 0.006 827.3 270.7 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 827.3 270.7 0.0000 0.0000 0.0565 0.0 15.3
15..5 0.049 827.3 270.7 0.0000 0.0000 0.0662 0.0 17.9
15..16 0.014 827.3 270.7 0.0000 0.0000 0.0183 0.0 5.0
16..17 0.009 827.3 270.7 0.0000 0.0000 0.0116 0.0 3.2
17..6 0.027 827.3 270.7 0.0000 0.0000 0.0363 0.0 9.8
17..7 0.006 827.3 270.7 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 827.3 270.7 0.0000 0.0000 0.0123 0.0 3.3
18..9 0.102 827.3 270.7 0.0000 0.0000 0.1379 0.0 37.3
18..19 0.015 827.3 270.7 0.0000 0.0000 0.0208 0.0 5.6
19..10 0.016 827.3 270.7 0.0000 0.0000 0.0221 0.0 6.0
19..11 0.021 827.3 270.7 0.0000 0.0000 0.0280 0.0 7.6
15..8 0.082 827.3 270.7 0.0000 0.0000 0.1109 0.0 30.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_acj6-PI)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.017 0.145 0.837
ws: 0.716 0.081 0.038 0.028 0.025 0.023 0.023 0.022 0.022 0.022
Time used: 9:36
Model 1: NearlyNeutral -2168.428845 Model 2: PositiveSelection -2168.426242 Model 0: one-ratio -2168.474962 Model 3: discrete -2168.426242 Model 7: beta -2168.42576 Model 8: beta&w>1 -2168.428362 Model 0 vs 1 0.0922339999997348 Model 2 vs 1 0.005205999999816413 Model 8 vs 7 0.005204000000048836
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
