--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 08:30:28 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/acj6-PH/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2202.33 -2226.49
2 -2202.26 -2222.74
--------------------------------------
TOTAL -2202.30 -2225.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.398948 0.003586 0.291985 0.522766 0.394293 1187.85 1344.42 1.000
r(A<->C){all} 0.116702 0.001314 0.047389 0.185891 0.113409 539.30 694.28 1.000
r(A<->G){all} 0.240539 0.003111 0.140886 0.356073 0.235726 607.17 636.80 1.002
r(A<->T){all} 0.128960 0.001939 0.051691 0.215578 0.123400 858.59 864.40 1.000
r(C<->G){all} 0.061557 0.000391 0.025350 0.100529 0.059699 776.74 869.03 1.000
r(C<->T){all} 0.440501 0.004222 0.319848 0.571056 0.441155 552.44 611.49 1.001
r(G<->T){all} 0.011741 0.000119 0.000001 0.035259 0.008666 919.40 1037.66 1.001
pi(A){all} 0.238666 0.000159 0.213234 0.263546 0.238715 1112.06 1220.97 1.000
pi(C){all} 0.308803 0.000172 0.281245 0.333079 0.308930 1286.69 1343.28 1.000
pi(G){all} 0.272981 0.000175 0.246631 0.297647 0.272874 1129.15 1155.12 1.000
pi(T){all} 0.179549 0.000118 0.157869 0.199807 0.179360 1135.79 1182.40 1.000
alpha{1,2} 0.048430 0.000662 0.000106 0.087386 0.051533 1196.38 1264.40 1.000
alpha{3} 2.346881 0.620205 1.033658 3.967005 2.224011 1321.58 1411.29 1.000
pinvar{all} 0.753122 0.000680 0.702684 0.803493 0.754077 1335.67 1338.28 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2106.513824
Model 2: PositiveSelection -2106.511272
Model 0: one-ratio -2106.559576
Model 3: discrete -2106.511272
Model 7: beta -2106.510882
Model 8: beta&w>1 -2106.513346
Model 0 vs 1 0.09150399999998626
Model 2 vs 1 0.005103999999846565
Model 8 vs 7 0.004928000000290922
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=357
C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
**************************************************
C1 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C2 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C3 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C4 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C5 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C6 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C7 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C8 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C9 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C10 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C11 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
**************************************************
C1 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C2 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C3 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C4 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C5 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C6 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C7 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C8 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C9 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C10 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
C11 QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
**************************************************
C1 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C2 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C3 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C4 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C5 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C6 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C7 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C8 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C9 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C10 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
C11 HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
**************************************************
C1 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C2 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C3 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C4 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C5 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C6 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C7 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C8 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C9 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C10 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
C11 KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
**************************************************
C1 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C2 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C3 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C4 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C5 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C6 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C7 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C8 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C9 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C10 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
C11 KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
**************************************************
C1 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C2 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C3 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C4 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C5 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C6 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C7 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C8 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C9 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C10 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
C11 AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
**************************************************
C1 GSAGFGY
C2 GSAGFGY
C3 GSAGFGY
C4 GSAGFGY
C5 GSAGFGY
C6 GSAGFGY
C7 GSAGFGY
C8 GSAGFGY
C9 GSAGFGY
C10 GSAGFGY
C11 GSAGFGY
*******
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 357 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 357 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [39270]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [39270]--->[39270]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/acj6-PH/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.671 Mb, Max= 31.784 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
FORMAT of file /tmp/tmp6413443204901737650aln Not Supported[FATAL:T-COFFEE]
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:357 S:100 BS:357
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 100.00 C1 C8 100.00
TOP 7 0 100.00 C8 C1 100.00
BOT 0 8 100.00 C1 C9 100.00
TOP 8 0 100.00 C9 C1 100.00
BOT 0 9 100.00 C1 C10 100.00
TOP 9 0 100.00 C10 C1 100.00
BOT 0 10 100.00 C1 C11 100.00
TOP 10 0 100.00 C11 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 1 6 100.00 C2 C7 100.00
TOP 6 1 100.00 C7 C2 100.00
BOT 1 7 100.00 C2 C8 100.00
TOP 7 1 100.00 C8 C2 100.00
BOT 1 8 100.00 C2 C9 100.00
TOP 8 1 100.00 C9 C2 100.00
BOT 1 9 100.00 C2 C10 100.00
TOP 9 1 100.00 C10 C2 100.00
BOT 1 10 100.00 C2 C11 100.00
TOP 10 1 100.00 C11 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 100.00 C3 C8 100.00
TOP 7 2 100.00 C8 C3 100.00
BOT 2 8 100.00 C3 C9 100.00
TOP 8 2 100.00 C9 C3 100.00
BOT 2 9 100.00 C3 C10 100.00
TOP 9 2 100.00 C10 C3 100.00
BOT 2 10 100.00 C3 C11 100.00
TOP 10 2 100.00 C11 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 100.00 C4 C7 100.00
TOP 6 3 100.00 C7 C4 100.00
BOT 3 7 100.00 C4 C8 100.00
TOP 7 3 100.00 C8 C4 100.00
BOT 3 8 100.00 C4 C9 100.00
TOP 8 3 100.00 C9 C4 100.00
BOT 3 9 100.00 C4 C10 100.00
TOP 9 3 100.00 C10 C4 100.00
BOT 3 10 100.00 C4 C11 100.00
TOP 10 3 100.00 C11 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 100.00 C5 C8 100.00
TOP 7 4 100.00 C8 C5 100.00
BOT 4 8 100.00 C5 C9 100.00
TOP 8 4 100.00 C9 C5 100.00
BOT 4 9 100.00 C5 C10 100.00
TOP 9 4 100.00 C10 C5 100.00
BOT 4 10 100.00 C5 C11 100.00
TOP 10 4 100.00 C11 C5 100.00
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
AVG 6 C7 * 100.00
AVG 7 C8 * 100.00
AVG 8 C9 * 100.00
AVG 9 C10 * 100.00
AVG 10 C11 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
C2 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C3 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C4 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C5 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C6 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C7 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C8 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C9 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C10 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C11 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
***************** ********************************
C1 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C2 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C3 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C4 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C5 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C6 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C7 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C8 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
C9 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA
C10 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C11 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
********************************* **************.*
C1 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C2 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C3 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C4 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C5 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C6 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C7 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C8 TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C9 TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC
C10 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C11 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
**** ***** ***********.** ************************
C1 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C2 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C3 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C4 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C5 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C6 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C7 GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C8 GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA
C9 GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA
C10 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C11 GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
** ** **.****************** ****.*****************
C1 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG
C2 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C3 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C4 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C5 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C6 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C7 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C8 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C9 GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG
C10 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C11 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
*** *********** **.** *****************.** *******
C1 ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C2 ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C3 ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C4 ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C5 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
C6 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG
C7 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
C8 ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
C9 ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG
C10 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
C11 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
* ******** ** ** ***************** ** **.***** **
C1 CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC
C2 CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC
C3 CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC
C4 CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTC
C5 CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC
C6 CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC
C7 CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTC
C8 CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTC
C9 CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC
C10 CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC
C11 CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTC
***********************.************** **.********
C1 GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTAACGCCCACACACC
C2 GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC
C3 GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC
C4 GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC
C5 GATGACCACGCTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC
C6 GATGACCACGCTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC
C7 GATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC
C8 AATGACCACGTTGGCGCCCATATCGGAGTCGCCTCTAACGCCAACACACC
C9 GATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC
C10 GATGACCACGTTGGCGCCCATTTCGGAGTCCCCACTGACGCCCACACACC
C11 GATGACCACGTTGGCGCCCATCTCGGAGTCCCCTCTGACGCCCACACACC
.********. ********** ******** ** **.*****.*******
C1 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C2 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C3 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C4 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C5 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C6 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C7 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C8 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C9 AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C10 AGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
C11 AGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
*.************************************************
C1 CATCCGGGCACGTTAAGTGGCCATACGGGGGGACATCATGGACACTCGGC
C2 CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC
C3 CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC
C4 CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC
C5 CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC
C6 CATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCGGC
C7 CATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCAGC
C8 CATCCGGGCACGTTAAGTGGCCACACGGGGGGCCACCATGGACACTCAGC
C9 CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC
C10 CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC
C11 CATCCGGGCACGCTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC
************ ********** ******** ** ***********.**
C1 GGTACATCATCCTGTTATCACGGCGGCAGTGGCTGCCGCTGGCCTGCATC
C2 GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC
C3 GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC
C4 GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC
C5 GGTACATCATCCTGTTATCACGGCGGCGGTAGCTGCCGCTGGCCTGCATC
C6 GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC
C7 GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC
C8 GGTACATCATCCTGTTATCACAGCGGCAGTGGCAGCCGCTGGCCTGCATC
C9 GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC
C10 GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC
C11 GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC
*********************.*****.**.**:****************
C1 CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGATTC
C2 CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
C3 CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
C4 CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
C5 CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
C6 CCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
C7 CCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
C8 CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC
C9 CCGACACAGACACCGATCCCCGCGAGCTGGAGGCCTTCGCGGAGCGGTTC
C10 CCGACACCGACACCGATCCCCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC
C11 CCGACACCGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC
*******.** ******** ************** ** ******** ***
C1 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
C2 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
C3 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
C4 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
C5 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
C6 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
C7 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
C8 AAGCAGCGGCGCATCAAGCTGGGCGTTACGCAGGCGGACGTGGGCAAAGC
C9 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC
C10 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC
C11 AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC
*********************** ** ********************.**
C1 CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
C2 CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
C3 CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
C4 CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
C5 CCTGGCCAATCTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAGAGCACGA
C6 CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
C7 CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
C8 CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCACAGAGCACGA
C9 CCTGGCCAATCTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGA
C10 CCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGA
C11 CCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCACTGTCGCAGAGCACGA
************.***************** **.*****.**********
C1 TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTT
C2 TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAATATGATCGCCCTC
C3 TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTC
C4 TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTG
C5 TCTGTCGCTTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
C6 TCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
C7 TCTGTCGATTCGAGAGCCTGACCCTGTCGCACAACAACATGATCGCCCTG
C8 TCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
C9 TCTGCAGGTTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
C10 TCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
C11 TCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
**** .* ************** ***** ******** ***********
C1 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C2 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C3 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C4 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C5 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C6 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C7 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C8 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGGCGAAAAA
C9 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C10 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
C11 AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
******************************** *****************
C1 CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C2 CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C3 CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C4 CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C5 CAAGCGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C6 CAAGCGGCGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C7 CAAGCGGCGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C8 CAAGAGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C9 CAAGCGGCGCGACCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C10 CAAGCGACGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
C11 CAAGCGACGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
****.*.***** ** ** *******************************
C1 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTC
C2 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTC
C3 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
C4 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
C5 AAAGGACTTCCATTGCGGCACCCGAAAAGCGTTCTTTGGAAGCCTACTTT
C6 AAAGGACTTCCATTGCGGCACCTGAAAAGCGCTCCCTGGAAGCCTACTTC
C7 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
C8 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
C9 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
C10 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
C11 AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTT
********************** ******** ** *************
C1 GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
C2 GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
C3 GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
C4 GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
C5 GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
C6 GCCGTCCAGCCGAGGCCGTCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
C7 GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
C8 GCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
C9 GCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
C10 GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
C11 GCCGTGCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
***** ***********.*****************:** ***********
C1 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C2 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C3 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C4 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C5 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C6 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C7 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C8 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C9 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C10 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
C11 GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
**************************************************
C1 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC
C2 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC
C3 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC
C4 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
C5 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
C6 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
C7 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
C8 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC
C9 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
C10 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
C11 AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
**********************************.***************
C1 GGTTCGGCGGGATTTGGATAC
C2 GGTTCGGCGGGATTTGGATAC
C3 GGTTCGGCGGGATTTGGATAC
C4 GGTTCGGCGGGATTTGGATAC
C5 GGTTCGGCGGGATTTGGATAC
C6 GGTTCGGCGGGATTTGGATAC
C7 GGTTCGGCGGGATTTGGATAC
C8 GGTTCAGCGGGATTTGGATAC
C9 GGTTCGGCGGGATTTGGATAC
C10 GGTTCGGCGGGATTTGGATAC
C11 GGTTCGGCGGGATTTGGATAC
*****.***************
>C1
ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG
ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC
GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTAACGCCCACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCATACGGGGGGACATCATGGACACTCGGC
GGTACATCATCCTGTTATCACGGCGGCAGTGGCTGCCGCTGGCCTGCATC
CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGATTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTT
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTC
GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C2
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC
GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC
GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC
CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAATATGATCGCCCTC
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTC
GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C3
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC
GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC
GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC
CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTC
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C4
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTC
GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC
GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC
CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTG
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C5
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC
GATGACCACGCTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC
GGTACATCATCCTGTTATCACGGCGGCGGTAGCTGCCGCTGGCCTGCATC
CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAGAGCACGA
TCTGTCGCTTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCCGAAAAGCGTTCTTTGGAAGCCTACTTT
GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C6
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG
CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC
GATGACCACGCTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCGGC
GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC
CCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
TCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGGCGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGCTCCCTGGAAGCCTACTTC
GCCGTCCAGCCGAGGCCGTCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C7
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTC
GATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCAGC
GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC
CCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA
TCTGTCGATTCGAGAGCCTGACCCTGTCGCACAACAACATGATCGCCCTG
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGGCGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C8
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTC
AATGACCACGTTGGCGCCCATATCGGAGTCGCCTCTAACGCCAACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGCCACCATGGACACTCAGC
GGTACATCATCCTGTTATCACAGCGGCAGTGGCAGCCGCTGGCCTGCATC
CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC
AAGCAGCGGCGCATCAAGCTGGGCGTTACGCAGGCGGACGTGGGCAAAGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCACAGAGCACGA
TCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGGCGAAAAA
CAAGAGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
GCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC
GGTTCAGCGGGATTTGGATAC
>C9
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA
TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA
GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG
ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG
CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC
GATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC
AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC
GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC
CCGACACAGACACCGATCCCCGCGAGCTGGAGGCCTTCGCGGAGCGGTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC
CCTGGCCAATCTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGA
TCTGCAGGTTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGGCGCGACCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
GCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C10
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC
GATGACCACGTTGGCGCCCATTTCGGAGTCCCCACTGACGCCCACACACC
AGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC
GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC
CCGACACCGACACCGATCCCCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGA
TCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGACGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC
GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C11
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTC
GATGACCACGTTGGCGCCCATCTCGGAGTCCCCTCTGACGCCCACACACC
AGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC
CATCCGGGCACGCTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC
GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC
CCGACACCGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC
AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC
CCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCACTGTCGCAGAGCACGA
TCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG
AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA
CAAGCGACGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA
AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTT
GCCGTGCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA
GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC
AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC
GGTTCGGCGGGATTTGGATAC
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
GSAGFGY
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 1071 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479802638
Setting output file names to "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 2019982123
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4801351831
Seed = 1805863230
Swapseed = 1479802638
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 65 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3960.406392 -- -24.640631
Chain 2 -- -3992.878923 -- -24.640631
Chain 3 -- -3962.713105 -- -24.640631
Chain 4 -- -3960.618912 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3980.351765 -- -24.640631
Chain 2 -- -3992.348940 -- -24.640631
Chain 3 -- -3913.893596 -- -24.640631
Chain 4 -- -3902.914904 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3960.406] (-3992.879) (-3962.713) (-3960.619) * [-3980.352] (-3992.349) (-3913.894) (-3902.915)
500 -- (-2390.194) [-2343.765] (-2348.985) (-2393.425) * (-2337.018) (-2350.494) (-2384.856) [-2349.917] -- 0:00:00
1000 -- (-2333.905) [-2273.956] (-2304.401) (-2299.336) * [-2313.332] (-2327.692) (-2311.697) (-2322.846) -- 0:00:00
1500 -- (-2292.710) [-2242.911] (-2288.089) (-2287.532) * [-2265.968] (-2313.067) (-2282.592) (-2291.965) -- 0:00:00
2000 -- (-2281.558) [-2224.381] (-2262.204) (-2242.292) * [-2216.777] (-2294.159) (-2277.266) (-2272.054) -- 0:08:19
2500 -- (-2263.976) [-2223.104] (-2263.015) (-2235.082) * [-2209.949] (-2281.245) (-2252.699) (-2246.641) -- 0:06:39
3000 -- (-2240.304) (-2221.718) [-2227.585] (-2234.883) * [-2204.259] (-2255.953) (-2237.470) (-2227.847) -- 0:05:32
3500 -- [-2210.076] (-2226.410) (-2210.426) (-2221.091) * [-2207.391] (-2219.885) (-2230.342) (-2216.952) -- 0:04:44
4000 -- (-2208.382) (-2226.635) [-2206.936] (-2220.220) * [-2211.814] (-2203.393) (-2209.416) (-2210.031) -- 0:04:09
4500 -- (-2209.703) [-2208.007] (-2207.190) (-2222.856) * (-2218.392) [-2208.847] (-2211.134) (-2212.371) -- 0:07:22
5000 -- (-2204.184) (-2224.620) [-2209.960] (-2220.436) * (-2218.078) [-2210.341] (-2209.090) (-2220.643) -- 0:06:38
Average standard deviation of split frequencies: 0.096027
5500 -- (-2214.486) (-2222.231) [-2206.307] (-2214.345) * (-2210.973) (-2221.141) (-2205.688) [-2216.297] -- 0:06:01
6000 -- [-2205.444] (-2212.856) (-2209.944) (-2212.523) * [-2215.796] (-2207.029) (-2211.488) (-2211.150) -- 0:05:31
6500 -- (-2213.551) (-2221.536) [-2199.992] (-2208.599) * [-2218.187] (-2200.320) (-2219.866) (-2218.547) -- 0:05:05
7000 -- [-2206.269] (-2220.111) (-2207.957) (-2203.221) * (-2211.256) (-2216.549) (-2213.715) [-2203.348] -- 0:07:05
7500 -- [-2204.678] (-2214.371) (-2212.254) (-2205.564) * [-2207.310] (-2208.754) (-2210.184) (-2218.770) -- 0:06:37
8000 -- [-2204.620] (-2211.356) (-2210.266) (-2208.473) * (-2212.876) (-2215.156) (-2225.521) [-2216.527] -- 0:06:12
8500 -- (-2207.657) [-2205.557] (-2218.710) (-2211.289) * (-2203.412) (-2214.407) (-2217.850) [-2208.053] -- 0:05:49
9000 -- [-2208.253] (-2214.103) (-2224.120) (-2205.894) * (-2206.670) (-2214.585) (-2212.394) [-2206.130] -- 0:05:30
9500 -- (-2218.147) [-2202.128] (-2215.561) (-2205.626) * (-2217.632) (-2210.953) (-2205.472) [-2212.248] -- 0:05:12
10000 -- (-2207.072) [-2205.437] (-2230.037) (-2215.842) * [-2205.724] (-2216.435) (-2213.761) (-2214.162) -- 0:04:57
Average standard deviation of split frequencies: 0.076603
10500 -- [-2205.471] (-2216.779) (-2205.537) (-2202.916) * [-2209.864] (-2217.998) (-2214.963) (-2207.378) -- 0:06:16
11000 -- (-2221.581) [-2201.695] (-2222.073) (-2208.595) * (-2206.027) (-2217.603) [-2208.215] (-2209.139) -- 0:05:59
11500 -- (-2202.899) [-2205.294] (-2209.030) (-2211.023) * (-2203.019) (-2216.182) [-2205.898] (-2218.110) -- 0:05:43
12000 -- (-2219.132) (-2211.317) (-2215.701) [-2208.587] * (-2210.435) (-2221.469) (-2216.663) [-2201.473] -- 0:05:29
12500 -- (-2212.102) (-2204.736) (-2209.297) [-2207.632] * (-2213.693) [-2211.333] (-2213.611) (-2214.321) -- 0:05:16
13000 -- (-2221.213) (-2212.181) (-2206.025) [-2199.027] * (-2211.720) (-2206.831) [-2200.445] (-2207.327) -- 0:05:03
13500 -- [-2202.444] (-2215.794) (-2219.949) (-2208.565) * (-2209.393) [-2206.011] (-2224.588) (-2214.150) -- 0:04:52
14000 -- [-2210.725] (-2213.260) (-2204.634) (-2203.662) * (-2213.465) (-2215.708) (-2216.033) [-2221.768] -- 0:05:52
14500 -- (-2215.962) (-2218.893) [-2206.750] (-2214.739) * [-2208.890] (-2224.638) (-2201.955) (-2214.260) -- 0:05:39
15000 -- (-2205.145) [-2205.071] (-2215.805) (-2217.702) * (-2211.698) (-2219.076) [-2204.000] (-2215.123) -- 0:05:28
Average standard deviation of split frequencies: 0.050508
15500 -- (-2223.210) [-2218.411] (-2211.674) (-2211.899) * (-2212.350) (-2206.581) [-2207.844] (-2214.108) -- 0:05:17
16000 -- (-2217.463) (-2221.792) [-2206.695] (-2208.886) * (-2225.275) [-2210.534] (-2210.203) (-2211.448) -- 0:05:07
16500 -- (-2208.602) [-2205.664] (-2217.574) (-2223.236) * (-2215.154) (-2211.376) (-2211.210) [-2206.907] -- 0:04:58
17000 -- [-2207.967] (-2221.975) (-2221.914) (-2207.581) * (-2213.956) (-2212.772) [-2214.237] (-2199.905) -- 0:04:49
17500 -- [-2210.375] (-2211.794) (-2216.369) (-2210.193) * (-2205.521) (-2207.062) [-2208.109] (-2210.109) -- 0:05:36
18000 -- [-2202.832] (-2227.891) (-2212.780) (-2210.790) * (-2209.152) (-2210.157) [-2203.617] (-2214.344) -- 0:05:27
18500 -- [-2209.925] (-2214.596) (-2203.649) (-2219.483) * (-2206.940) (-2221.468) (-2207.520) [-2203.796] -- 0:05:18
19000 -- (-2212.091) [-2211.243] (-2211.248) (-2216.523) * [-2202.113] (-2209.045) (-2205.647) (-2209.156) -- 0:05:09
19500 -- (-2206.908) (-2218.167) (-2218.831) [-2213.683] * (-2220.021) [-2210.120] (-2210.039) (-2219.008) -- 0:05:01
20000 -- [-2211.482] (-2214.931) (-2212.807) (-2208.201) * (-2215.119) (-2206.140) (-2199.848) [-2209.150] -- 0:04:54
Average standard deviation of split frequencies: 0.042361
20500 -- (-2216.727) (-2214.941) (-2216.101) [-2214.924] * (-2203.280) (-2214.513) [-2208.962] (-2218.288) -- 0:05:34
21000 -- [-2209.848] (-2215.387) (-2221.198) (-2200.155) * [-2207.057] (-2216.800) (-2226.663) (-2213.356) -- 0:05:26
21500 -- (-2213.402) (-2217.664) [-2213.841] (-2212.338) * (-2210.786) (-2219.758) [-2201.321] (-2220.330) -- 0:05:18
22000 -- (-2208.106) (-2209.241) (-2208.711) [-2211.938] * (-2223.708) (-2216.150) (-2207.081) [-2208.713] -- 0:05:11
22500 -- [-2207.971] (-2221.822) (-2208.424) (-2213.053) * (-2215.577) (-2220.155) (-2211.406) [-2208.423] -- 0:05:04
23000 -- (-2209.419) (-2210.099) [-2202.012] (-2212.176) * (-2215.844) (-2209.371) [-2215.532] (-2210.576) -- 0:04:57
23500 -- (-2210.121) [-2207.527] (-2199.459) (-2214.442) * (-2219.737) (-2218.743) (-2216.419) [-2201.379] -- 0:05:32
24000 -- (-2210.856) (-2209.531) [-2208.446] (-2212.362) * (-2213.086) (-2221.734) [-2202.441] (-2202.663) -- 0:05:25
24500 -- (-2215.314) (-2214.906) (-2215.020) [-2214.895] * (-2215.982) (-2219.556) (-2217.445) [-2208.095] -- 0:05:18
25000 -- [-2202.532] (-2226.784) (-2224.333) (-2216.259) * (-2220.796) (-2225.401) (-2215.543) [-2214.641] -- 0:05:12
Average standard deviation of split frequencies: 0.025901
25500 -- [-2208.114] (-2216.030) (-2216.163) (-2215.211) * [-2212.084] (-2208.241) (-2214.605) (-2212.129) -- 0:05:05
26000 -- (-2221.747) (-2214.941) [-2217.600] (-2212.680) * (-2208.836) (-2224.907) (-2223.027) [-2209.636] -- 0:04:59
26500 -- (-2210.673) (-2214.620) [-2208.600] (-2214.330) * (-2205.277) [-2209.162] (-2210.661) (-2210.496) -- 0:05:30
27000 -- (-2210.236) [-2209.235] (-2225.194) (-2211.940) * [-2203.182] (-2217.809) (-2200.608) (-2211.469) -- 0:05:24
27500 -- (-2216.815) (-2216.777) (-2216.931) [-2202.300] * (-2211.899) (-2210.554) [-2211.046] (-2204.214) -- 0:05:18
28000 -- [-2207.054] (-2203.895) (-2210.498) (-2211.318) * (-2211.841) [-2201.782] (-2207.631) (-2204.224) -- 0:05:12
28500 -- (-2213.069) (-2211.605) [-2199.057] (-2205.769) * (-2227.747) (-2203.665) (-2210.648) [-2208.356] -- 0:05:06
29000 -- (-2214.468) [-2210.770] (-2214.136) (-2203.739) * (-2200.245) (-2206.064) (-2214.631) [-2205.293] -- 0:05:01
29500 -- [-2207.434] (-2233.713) (-2211.867) (-2206.810) * (-2207.285) (-2214.240) (-2219.564) [-2209.723] -- 0:04:56
30000 -- (-2220.699) (-2220.723) (-2215.439) [-2210.551] * (-2208.922) (-2216.206) (-2216.170) [-2208.774] -- 0:05:23
Average standard deviation of split frequencies: 0.024156
30500 -- (-2212.886) (-2221.420) [-2204.946] (-2219.601) * [-2207.735] (-2222.519) (-2212.418) (-2213.670) -- 0:05:17
31000 -- (-2215.499) [-2214.569] (-2214.164) (-2204.045) * [-2218.422] (-2209.543) (-2216.851) (-2216.295) -- 0:05:12
31500 -- (-2208.996) (-2211.713) [-2210.049] (-2233.082) * (-2217.264) (-2217.833) (-2211.466) [-2201.598] -- 0:05:07
32000 -- (-2213.348) (-2204.873) (-2210.369) [-2204.227] * (-2207.520) (-2211.785) [-2220.834] (-2210.881) -- 0:05:02
32500 -- (-2214.603) [-2208.356] (-2203.082) (-2216.387) * (-2204.560) [-2205.227] (-2228.271) (-2217.994) -- 0:04:57
33000 -- (-2219.565) [-2204.822] (-2208.154) (-2211.175) * [-2209.417] (-2204.999) (-2209.878) (-2204.761) -- 0:05:22
33500 -- [-2204.947] (-2215.201) (-2209.377) (-2221.258) * (-2204.765) [-2210.106] (-2203.743) (-2215.175) -- 0:05:17
34000 -- [-2210.379] (-2212.905) (-2210.526) (-2224.232) * (-2207.560) (-2217.909) [-2221.746] (-2214.816) -- 0:05:12
34500 -- [-2211.313] (-2217.939) (-2212.443) (-2218.428) * (-2212.428) [-2209.440] (-2212.125) (-2211.181) -- 0:05:07
35000 -- [-2217.907] (-2213.676) (-2209.803) (-2213.342) * [-2211.279] (-2211.419) (-2208.446) (-2213.803) -- 0:05:03
Average standard deviation of split frequencies: 0.029930
35500 -- (-2215.894) (-2209.004) [-2207.657] (-2210.018) * (-2218.895) (-2210.831) [-2208.301] (-2223.846) -- 0:04:58
36000 -- (-2202.731) (-2212.376) [-2205.420] (-2209.483) * (-2223.835) (-2218.304) [-2204.436] (-2217.150) -- 0:05:21
36500 -- [-2204.222] (-2228.052) (-2227.822) (-2212.945) * [-2212.430] (-2219.578) (-2216.198) (-2223.834) -- 0:05:16
37000 -- [-2203.390] (-2216.845) (-2211.948) (-2210.455) * (-2217.394) (-2220.332) (-2207.809) [-2211.749] -- 0:05:12
37500 -- [-2209.652] (-2206.574) (-2219.452) (-2207.248) * (-2204.379) [-2200.964] (-2210.721) (-2212.586) -- 0:05:08
38000 -- [-2214.575] (-2213.789) (-2217.841) (-2206.495) * (-2223.253) (-2211.567) (-2211.918) [-2208.116] -- 0:05:03
38500 -- [-2219.287] (-2219.988) (-2216.482) (-2214.049) * (-2207.861) (-2226.466) [-2207.320] (-2209.802) -- 0:04:59
39000 -- (-2219.906) (-2216.973) (-2219.780) [-2211.363] * [-2216.190] (-2219.429) (-2206.755) (-2220.446) -- 0:04:55
39500 -- (-2213.843) (-2211.488) (-2209.582) [-2207.401] * (-2216.413) (-2210.179) [-2212.661] (-2225.712) -- 0:05:16
40000 -- [-2205.583] (-2222.466) (-2220.528) (-2214.902) * (-2211.555) (-2215.702) [-2206.400] (-2214.626) -- 0:05:12
Average standard deviation of split frequencies: 0.038916
40500 -- (-2206.541) (-2214.958) [-2208.434] (-2220.752) * (-2211.396) (-2218.717) (-2214.909) [-2212.552] -- 0:05:07
41000 -- [-2214.238] (-2224.631) (-2202.877) (-2212.515) * (-2206.729) (-2214.964) [-2216.579] (-2226.074) -- 0:05:04
41500 -- [-2211.751] (-2221.350) (-2213.514) (-2224.522) * [-2209.773] (-2216.484) (-2215.937) (-2224.689) -- 0:05:00
42000 -- (-2209.635) [-2206.788] (-2216.002) (-2218.035) * (-2218.965) [-2203.658] (-2215.406) (-2215.283) -- 0:04:56
42500 -- (-2203.424) (-2208.138) (-2208.592) [-2218.003] * (-2217.247) (-2217.953) [-2210.438] (-2218.443) -- 0:04:52
43000 -- (-2211.386) (-2212.135) [-2200.923] (-2218.726) * (-2208.908) [-2207.332] (-2214.064) (-2223.275) -- 0:05:11
43500 -- (-2208.108) [-2210.822] (-2202.418) (-2224.342) * (-2209.485) [-2216.620] (-2213.861) (-2219.177) -- 0:05:07
44000 -- [-2210.143] (-2221.408) (-2214.213) (-2233.376) * [-2208.857] (-2211.995) (-2219.010) (-2220.316) -- 0:05:04
44500 -- [-2205.057] (-2219.313) (-2229.986) (-2221.533) * [-2208.158] (-2206.647) (-2217.213) (-2214.516) -- 0:05:00
45000 -- (-2205.807) (-2214.823) [-2213.229] (-2214.482) * [-2199.069] (-2215.046) (-2218.908) (-2208.391) -- 0:04:57
Average standard deviation of split frequencies: 0.034843
45500 -- [-2215.434] (-2223.846) (-2212.847) (-2214.318) * (-2209.622) (-2215.958) (-2216.158) [-2204.225] -- 0:04:53
46000 -- (-2221.055) (-2223.968) [-2210.112] (-2217.234) * [-2209.889] (-2210.312) (-2210.693) (-2221.840) -- 0:04:50
46500 -- (-2217.851) (-2228.930) (-2208.911) [-2214.775] * [-2204.546] (-2225.369) (-2216.787) (-2209.887) -- 0:05:07
47000 -- (-2201.143) (-2225.946) (-2210.212) [-2215.203] * (-2217.838) (-2210.828) [-2214.282] (-2211.086) -- 0:05:04
47500 -- (-2216.465) (-2212.209) [-2209.397] (-2219.248) * (-2211.009) [-2208.199] (-2212.591) (-2218.550) -- 0:05:00
48000 -- (-2222.689) (-2210.304) [-2216.158] (-2204.584) * [-2216.446] (-2207.192) (-2204.839) (-2215.090) -- 0:04:57
48500 -- (-2220.154) [-2210.124] (-2212.302) (-2216.924) * [-2205.765] (-2200.124) (-2205.319) (-2218.031) -- 0:04:54
49000 -- (-2215.903) [-2204.523] (-2197.490) (-2202.843) * (-2218.505) [-2210.805] (-2210.006) (-2213.426) -- 0:04:51
49500 -- (-2216.644) (-2212.227) [-2208.759] (-2217.034) * (-2207.053) (-2230.466) (-2211.974) [-2203.130] -- 0:04:48
50000 -- [-2211.528] (-2229.090) (-2215.323) (-2213.678) * [-2205.266] (-2207.879) (-2215.634) (-2210.473) -- 0:05:04
Average standard deviation of split frequencies: 0.035355
50500 -- (-2213.093) (-2206.581) [-2215.424] (-2212.282) * (-2231.749) (-2212.165) (-2229.824) [-2206.076] -- 0:05:00
51000 -- [-2203.207] (-2210.637) (-2207.132) (-2228.107) * [-2222.775] (-2204.987) (-2209.570) (-2206.047) -- 0:04:57
51500 -- [-2216.531] (-2214.998) (-2222.393) (-2212.658) * (-2217.471) (-2210.131) (-2213.551) [-2207.626] -- 0:04:54
52000 -- (-2227.003) (-2219.231) [-2214.162] (-2210.863) * [-2209.698] (-2210.821) (-2210.083) (-2215.909) -- 0:04:51
52500 -- (-2209.774) (-2212.433) (-2223.768) [-2211.548] * (-2212.459) (-2201.845) [-2210.491] (-2206.344) -- 0:04:48
53000 -- [-2207.016] (-2208.928) (-2218.596) (-2203.891) * (-2213.184) [-2210.584] (-2211.843) (-2205.555) -- 0:05:03
53500 -- [-2212.951] (-2213.626) (-2221.452) (-2208.339) * [-2205.311] (-2210.928) (-2207.017) (-2210.675) -- 0:05:00
54000 -- (-2213.282) [-2203.852] (-2202.103) (-2215.939) * (-2215.811) [-2213.883] (-2218.377) (-2208.331) -- 0:04:57
54500 -- (-2218.043) [-2212.594] (-2210.696) (-2204.262) * [-2204.051] (-2210.230) (-2210.622) (-2218.994) -- 0:04:54
55000 -- (-2210.671) (-2215.580) [-2205.075] (-2210.307) * (-2212.638) [-2210.374] (-2208.852) (-2214.456) -- 0:04:52
Average standard deviation of split frequencies: 0.030866
55500 -- (-2207.115) (-2212.695) (-2215.054) [-2215.337] * (-2209.915) [-2208.652] (-2211.711) (-2212.958) -- 0:04:49
56000 -- (-2210.555) [-2213.168] (-2210.457) (-2208.425) * (-2213.730) [-2209.420] (-2208.210) (-2208.611) -- 0:05:03
56500 -- [-2209.501] (-2205.931) (-2214.527) (-2215.700) * (-2212.908) (-2208.925) [-2208.257] (-2215.169) -- 0:05:00
57000 -- (-2206.616) (-2211.756) (-2210.529) [-2208.222] * (-2203.029) [-2209.274] (-2214.661) (-2213.881) -- 0:04:57
57500 -- (-2214.252) (-2227.132) [-2208.099] (-2214.369) * [-2204.223] (-2206.675) (-2220.040) (-2211.209) -- 0:04:55
58000 -- (-2214.127) [-2210.489] (-2209.413) (-2210.748) * (-2211.853) [-2207.776] (-2219.692) (-2205.788) -- 0:04:52
58500 -- (-2215.010) (-2205.600) [-2205.900] (-2207.347) * (-2217.778) [-2207.600] (-2218.736) (-2223.038) -- 0:04:49
59000 -- [-2204.417] (-2214.633) (-2209.628) (-2210.665) * (-2204.861) (-2224.245) (-2223.056) [-2203.200] -- 0:05:03
59500 -- (-2208.189) (-2214.059) [-2213.735] (-2210.115) * (-2225.015) [-2209.927] (-2214.606) (-2216.539) -- 0:05:00
60000 -- [-2205.108] (-2208.739) (-2213.176) (-2211.264) * (-2215.371) (-2213.334) (-2228.421) [-2207.703] -- 0:04:57
Average standard deviation of split frequencies: 0.034190
60500 -- (-2210.261) [-2211.255] (-2213.362) (-2199.123) * [-2203.468] (-2204.672) (-2220.328) (-2225.498) -- 0:04:55
61000 -- (-2212.716) [-2203.169] (-2213.555) (-2215.616) * [-2204.934] (-2209.934) (-2216.663) (-2214.775) -- 0:04:52
61500 -- [-2202.737] (-2217.245) (-2215.133) (-2201.204) * (-2214.429) (-2221.441) [-2205.632] (-2226.774) -- 0:04:49
62000 -- (-2207.601) (-2209.472) [-2202.534] (-2203.776) * (-2209.119) (-2209.990) [-2205.153] (-2224.894) -- 0:05:02
62500 -- (-2215.323) [-2213.987] (-2211.647) (-2213.824) * (-2227.278) [-2211.319] (-2208.569) (-2216.612) -- 0:05:00
63000 -- (-2214.106) (-2221.951) [-2217.778] (-2210.680) * [-2204.346] (-2216.677) (-2206.126) (-2208.729) -- 0:04:57
63500 -- (-2221.421) (-2220.199) [-2207.697] (-2204.692) * (-2211.908) (-2230.732) [-2209.107] (-2213.036) -- 0:04:54
64000 -- (-2213.260) (-2216.134) [-2203.925] (-2215.108) * [-2209.915] (-2210.394) (-2212.127) (-2208.985) -- 0:04:52
64500 -- (-2208.284) [-2209.450] (-2219.991) (-2202.017) * (-2214.484) (-2220.129) [-2205.946] (-2201.615) -- 0:04:50
65000 -- (-2209.999) (-2210.149) (-2213.044) [-2207.663] * (-2208.688) (-2212.741) (-2217.537) [-2210.882] -- 0:05:02
Average standard deviation of split frequencies: 0.025237
65500 -- (-2221.121) (-2209.125) (-2217.447) [-2211.250] * [-2201.373] (-2221.396) (-2211.380) (-2214.903) -- 0:04:59
66000 -- (-2207.602) (-2223.582) (-2204.085) [-2202.558] * (-2209.254) [-2214.060] (-2209.509) (-2213.560) -- 0:04:57
66500 -- [-2212.889] (-2220.026) (-2215.482) (-2209.221) * [-2209.100] (-2215.280) (-2221.101) (-2207.371) -- 0:04:54
67000 -- [-2206.097] (-2208.086) (-2207.943) (-2223.465) * (-2205.892) (-2216.074) (-2214.778) [-2205.903] -- 0:04:52
67500 -- [-2214.420] (-2220.140) (-2210.967) (-2216.213) * [-2201.808] (-2215.034) (-2216.644) (-2212.343) -- 0:04:50
68000 -- (-2206.475) [-2211.248] (-2209.849) (-2224.023) * (-2207.104) (-2219.058) [-2212.795] (-2216.747) -- 0:05:01
68500 -- (-2207.132) (-2201.551) [-2209.232] (-2229.511) * (-2223.818) (-2220.369) (-2206.277) [-2204.918] -- 0:04:59
69000 -- [-2205.342] (-2211.680) (-2208.032) (-2217.683) * (-2220.723) (-2219.414) (-2209.473) [-2199.802] -- 0:04:56
69500 -- (-2214.446) (-2219.712) [-2214.095] (-2231.047) * (-2214.808) (-2222.725) [-2207.040] (-2203.291) -- 0:04:54
70000 -- (-2212.181) (-2226.086) [-2208.245] (-2224.739) * (-2218.650) (-2219.954) [-2216.354] (-2222.692) -- 0:04:52
Average standard deviation of split frequencies: 0.020902
70500 -- (-2210.604) (-2218.534) [-2209.789] (-2219.885) * (-2214.250) (-2208.242) (-2217.424) [-2211.887] -- 0:04:50
71000 -- [-2209.687] (-2219.180) (-2209.703) (-2213.097) * (-2226.852) [-2210.475] (-2216.283) (-2207.535) -- 0:04:47
71500 -- (-2213.758) (-2213.565) [-2214.423] (-2216.771) * (-2218.031) (-2209.013) [-2203.544] (-2207.818) -- 0:04:58
72000 -- [-2210.855] (-2214.726) (-2218.542) (-2216.621) * (-2212.395) [-2204.938] (-2216.517) (-2221.093) -- 0:04:56
72500 -- (-2215.570) (-2213.077) (-2209.712) [-2213.251] * [-2207.842] (-2208.396) (-2211.611) (-2209.388) -- 0:04:54
73000 -- (-2208.857) [-2201.327] (-2216.323) (-2221.884) * [-2213.901] (-2221.546) (-2209.630) (-2209.739) -- 0:04:52
73500 -- (-2208.610) (-2210.863) [-2213.579] (-2210.257) * (-2211.617) (-2208.129) [-2207.431] (-2208.500) -- 0:04:49
74000 -- [-2212.422] (-2220.022) (-2218.372) (-2203.002) * [-2212.955] (-2208.319) (-2212.517) (-2207.075) -- 0:04:47
74500 -- (-2207.597) [-2207.769] (-2206.371) (-2210.234) * (-2207.968) (-2206.453) (-2221.047) [-2207.122] -- 0:04:45
75000 -- [-2205.415] (-2214.969) (-2214.044) (-2211.765) * (-2221.834) [-2205.475] (-2208.633) (-2213.531) -- 0:04:56
Average standard deviation of split frequencies: 0.021916
75500 -- (-2209.910) [-2221.419] (-2209.840) (-2206.798) * (-2211.536) [-2205.340] (-2223.889) (-2206.983) -- 0:04:53
76000 -- [-2208.725] (-2216.609) (-2209.838) (-2210.930) * [-2204.878] (-2213.127) (-2216.256) (-2224.269) -- 0:04:51
76500 -- (-2221.221) (-2213.390) [-2206.868] (-2206.520) * [-2223.835] (-2204.489) (-2234.617) (-2203.326) -- 0:04:49
77000 -- (-2204.982) (-2216.995) [-2213.560] (-2213.205) * (-2216.707) (-2206.212) [-2218.271] (-2219.447) -- 0:04:47
77500 -- [-2206.853] (-2221.361) (-2216.244) (-2214.928) * (-2212.584) (-2210.978) [-2206.425] (-2214.062) -- 0:04:45
78000 -- [-2214.016] (-2224.974) (-2202.686) (-2211.828) * (-2213.207) (-2210.913) (-2216.460) [-2215.179] -- 0:04:43
78500 -- (-2220.167) (-2222.464) (-2223.209) [-2208.097] * (-2205.464) [-2212.689] (-2215.607) (-2209.399) -- 0:04:53
79000 -- [-2212.539] (-2210.446) (-2208.003) (-2216.506) * [-2207.615] (-2221.223) (-2212.610) (-2210.231) -- 0:04:51
79500 -- (-2211.242) [-2211.596] (-2212.988) (-2212.173) * [-2214.558] (-2213.619) (-2214.346) (-2211.933) -- 0:04:49
80000 -- (-2215.882) [-2202.979] (-2220.439) (-2233.385) * (-2210.738) (-2205.482) [-2205.364] (-2214.946) -- 0:04:47
Average standard deviation of split frequencies: 0.018700
80500 -- (-2221.134) [-2208.113] (-2220.644) (-2209.678) * (-2226.009) [-2210.278] (-2227.576) (-2222.722) -- 0:04:45
81000 -- [-2210.478] (-2209.289) (-2212.075) (-2216.106) * (-2211.690) (-2209.358) (-2224.187) [-2216.129] -- 0:04:43
81500 -- (-2213.068) [-2215.751] (-2204.088) (-2220.340) * (-2207.409) (-2209.865) [-2211.558] (-2214.599) -- 0:04:41
82000 -- (-2216.146) [-2207.173] (-2201.305) (-2214.209) * (-2217.288) (-2206.374) (-2209.443) [-2202.540] -- 0:04:51
82500 -- (-2219.242) (-2215.105) [-2209.273] (-2226.463) * (-2221.276) (-2211.618) [-2211.325] (-2206.567) -- 0:04:49
83000 -- (-2208.939) (-2214.214) (-2211.740) [-2205.020] * (-2219.563) [-2211.018] (-2220.322) (-2208.355) -- 0:04:47
83500 -- (-2211.431) [-2210.605] (-2207.858) (-2210.200) * (-2223.774) [-2202.962] (-2219.518) (-2213.695) -- 0:04:45
84000 -- (-2202.885) (-2214.374) [-2200.519] (-2212.180) * [-2209.042] (-2215.579) (-2216.557) (-2213.242) -- 0:04:43
84500 -- (-2218.731) [-2203.555] (-2222.968) (-2206.291) * (-2213.845) [-2211.835] (-2216.866) (-2231.245) -- 0:04:41
85000 -- (-2213.202) (-2217.121) [-2208.574] (-2206.001) * (-2203.562) [-2217.539] (-2211.815) (-2221.075) -- 0:04:39
Average standard deviation of split frequencies: 0.017175
85500 -- (-2209.060) (-2213.358) (-2210.752) [-2201.811] * (-2216.028) (-2216.307) [-2214.860] (-2215.383) -- 0:04:48
86000 -- [-2211.854] (-2223.593) (-2205.284) (-2206.390) * (-2205.777) (-2228.084) (-2218.302) [-2210.483] -- 0:04:46
86500 -- (-2220.891) (-2217.533) [-2201.394] (-2205.096) * [-2202.962] (-2216.922) (-2212.132) (-2222.368) -- 0:04:45
87000 -- (-2209.028) (-2208.302) [-2210.893] (-2208.434) * (-2205.377) (-2213.535) (-2231.174) [-2210.395] -- 0:04:43
87500 -- [-2210.137] (-2220.829) (-2219.409) (-2217.322) * (-2206.882) (-2219.314) (-2205.786) [-2207.129] -- 0:04:41
88000 -- [-2214.944] (-2216.757) (-2213.344) (-2218.120) * (-2210.321) (-2204.257) (-2217.715) [-2208.026] -- 0:04:39
88500 -- [-2210.745] (-2214.324) (-2212.485) (-2202.250) * [-2210.114] (-2216.704) (-2211.761) (-2209.273) -- 0:04:38
89000 -- (-2220.718) [-2210.242] (-2214.393) (-2211.503) * (-2213.957) [-2224.429] (-2214.059) (-2215.904) -- 0:04:46
89500 -- (-2207.918) (-2229.719) (-2215.232) [-2206.382] * (-2217.467) (-2216.903) (-2215.192) [-2207.489] -- 0:04:44
90000 -- (-2228.602) [-2219.939] (-2216.127) (-2216.229) * (-2223.219) (-2213.801) (-2218.168) [-2208.061] -- 0:04:43
Average standard deviation of split frequencies: 0.021837
90500 -- (-2213.286) (-2212.469) [-2213.378] (-2211.104) * (-2216.145) (-2221.211) [-2211.551] (-2209.363) -- 0:04:41
91000 -- (-2212.544) [-2205.470] (-2216.365) (-2216.865) * (-2220.199) (-2210.919) (-2217.250) [-2212.036] -- 0:04:39
91500 -- (-2214.032) (-2227.067) [-2205.721] (-2218.832) * (-2221.696) [-2218.561] (-2228.745) (-2210.794) -- 0:04:38
92000 -- (-2214.088) (-2214.130) (-2220.599) [-2199.655] * (-2219.246) (-2204.479) (-2230.286) [-2200.994] -- 0:04:36
92500 -- [-2212.515] (-2222.943) (-2209.537) (-2218.119) * (-2206.427) (-2227.885) (-2215.972) [-2201.874] -- 0:04:44
93000 -- [-2205.609] (-2212.066) (-2211.757) (-2210.620) * [-2208.648] (-2223.945) (-2210.328) (-2208.687) -- 0:04:42
93500 -- [-2208.880] (-2217.693) (-2209.802) (-2204.780) * (-2212.001) [-2211.910] (-2215.424) (-2224.296) -- 0:04:41
94000 -- (-2214.222) (-2217.762) (-2206.542) [-2211.567] * [-2210.468] (-2211.529) (-2208.147) (-2222.736) -- 0:04:39
94500 -- (-2210.117) (-2215.458) (-2217.262) [-2208.798] * (-2213.767) [-2208.882] (-2218.282) (-2215.241) -- 0:04:37
95000 -- (-2215.550) (-2214.492) (-2220.355) [-2204.749] * (-2214.691) (-2203.090) [-2205.899] (-2218.217) -- 0:04:36
Average standard deviation of split frequencies: 0.021933
95500 -- (-2218.670) (-2216.693) [-2203.909] (-2207.657) * (-2220.487) (-2220.682) [-2205.726] (-2212.102) -- 0:04:34
96000 -- [-2215.249] (-2205.948) (-2211.227) (-2216.674) * (-2222.265) [-2208.281] (-2209.080) (-2207.326) -- 0:04:42
96500 -- [-2210.312] (-2217.865) (-2212.472) (-2215.135) * (-2210.657) [-2211.279] (-2209.395) (-2206.308) -- 0:04:40
97000 -- (-2207.629) (-2216.430) (-2211.181) [-2203.431] * (-2215.111) (-2211.146) (-2204.284) [-2202.827] -- 0:04:39
97500 -- (-2212.670) (-2215.325) (-2215.046) [-2205.400] * [-2206.626] (-2223.088) (-2215.381) (-2216.764) -- 0:04:37
98000 -- (-2226.056) [-2222.660] (-2216.132) (-2206.699) * (-2212.594) (-2221.512) [-2212.820] (-2214.017) -- 0:04:36
98500 -- (-2220.490) (-2229.606) [-2204.598] (-2208.542) * (-2210.091) (-2219.124) [-2215.394] (-2204.518) -- 0:04:34
99000 -- (-2217.482) (-2211.681) [-2204.926] (-2208.761) * [-2211.119] (-2219.360) (-2220.010) (-2203.710) -- 0:04:33
99500 -- (-2211.693) (-2208.857) (-2207.351) [-2215.020] * (-2202.265) (-2216.905) [-2208.827] (-2205.979) -- 0:04:40
100000 -- (-2220.524) (-2215.904) [-2212.495] (-2218.473) * (-2217.185) (-2215.716) [-2208.686] (-2213.600) -- 0:04:39
Average standard deviation of split frequencies: 0.020917
100500 -- [-2213.203] (-2208.183) (-2212.655) (-2204.573) * (-2206.999) (-2219.793) [-2206.641] (-2205.605) -- 0:04:37
101000 -- (-2218.142) (-2219.259) (-2210.336) [-2214.309] * (-2214.977) (-2207.923) [-2202.894] (-2213.924) -- 0:04:35
101500 -- (-2223.790) (-2215.748) (-2207.631) [-2209.151] * (-2206.876) (-2218.053) [-2211.701] (-2212.305) -- 0:04:34
102000 -- [-2204.413] (-2217.459) (-2222.424) (-2206.061) * (-2211.155) (-2222.104) (-2212.166) [-2203.670] -- 0:04:41
102500 -- (-2215.027) (-2225.163) [-2208.409] (-2210.658) * [-2200.238] (-2223.162) (-2206.613) (-2210.325) -- 0:04:40
103000 -- (-2215.851) (-2215.724) [-2210.489] (-2209.721) * [-2203.150] (-2207.191) (-2209.167) (-2216.123) -- 0:04:38
103500 -- (-2210.887) (-2217.320) (-2211.969) [-2202.853] * [-2216.079] (-2210.180) (-2216.616) (-2224.886) -- 0:04:37
104000 -- [-2210.047] (-2213.080) (-2220.527) (-2220.807) * [-2206.069] (-2236.684) (-2209.497) (-2212.882) -- 0:04:35
104500 -- (-2201.434) [-2211.457] (-2214.461) (-2215.818) * (-2206.608) [-2206.059] (-2209.682) (-2206.560) -- 0:04:34
105000 -- (-2213.177) [-2210.031] (-2212.263) (-2220.464) * [-2209.068] (-2210.036) (-2210.253) (-2219.231) -- 0:04:41
Average standard deviation of split frequencies: 0.021643
105500 -- [-2203.768] (-2208.803) (-2223.201) (-2224.696) * (-2211.611) [-2211.385] (-2212.431) (-2217.888) -- 0:04:39
106000 -- (-2208.538) [-2214.477] (-2217.759) (-2216.793) * (-2208.513) [-2215.225] (-2213.439) (-2221.724) -- 0:04:38
106500 -- (-2215.851) [-2208.454] (-2216.808) (-2219.711) * (-2210.945) (-2212.213) [-2201.724] (-2217.942) -- 0:04:36
107000 -- (-2209.485) [-2202.261] (-2215.652) (-2218.088) * (-2213.466) [-2210.694] (-2210.753) (-2217.033) -- 0:04:35
107500 -- [-2202.039] (-2206.372) (-2215.822) (-2218.587) * (-2214.884) (-2206.668) [-2208.557] (-2220.017) -- 0:04:33
108000 -- (-2214.514) (-2223.839) [-2204.554] (-2211.557) * (-2211.838) [-2211.853] (-2219.355) (-2217.458) -- 0:04:32
108500 -- [-2197.751] (-2218.544) (-2212.327) (-2220.509) * (-2211.067) (-2209.464) [-2205.722] (-2218.797) -- 0:04:39
109000 -- [-2205.809] (-2226.008) (-2220.629) (-2210.791) * (-2217.526) (-2208.404) [-2215.414] (-2204.622) -- 0:04:37
109500 -- (-2223.926) (-2219.392) (-2219.847) [-2208.007] * (-2215.529) [-2202.254] (-2215.588) (-2210.110) -- 0:04:36
110000 -- (-2218.869) [-2219.660] (-2217.833) (-2210.286) * (-2224.884) [-2206.998] (-2214.258) (-2223.035) -- 0:04:35
Average standard deviation of split frequencies: 0.019311
110500 -- (-2215.669) (-2208.472) (-2216.173) [-2206.541] * (-2217.932) (-2211.365) (-2219.534) [-2206.760] -- 0:04:33
111000 -- (-2217.331) (-2208.861) (-2217.687) [-2204.597] * (-2211.594) (-2213.289) (-2229.862) [-2216.975] -- 0:04:40
111500 -- (-2218.377) (-2213.217) [-2212.821] (-2218.741) * (-2208.925) [-2210.479] (-2212.903) (-2211.360) -- 0:04:38
112000 -- (-2217.393) [-2209.632] (-2219.545) (-2211.701) * [-2201.662] (-2209.217) (-2220.706) (-2211.092) -- 0:04:37
112500 -- [-2211.661] (-2223.916) (-2210.499) (-2207.007) * (-2214.022) (-2219.271) [-2206.275] (-2206.135) -- 0:04:36
113000 -- (-2217.447) (-2219.815) (-2210.878) [-2203.854] * (-2202.939) [-2206.202] (-2223.137) (-2213.965) -- 0:04:34
113500 -- (-2207.228) (-2222.653) [-2207.317] (-2218.153) * (-2206.797) (-2204.385) (-2210.386) [-2206.523] -- 0:04:41
114000 -- (-2200.707) (-2212.321) (-2210.621) [-2208.047] * (-2210.665) (-2212.947) [-2205.820] (-2217.038) -- 0:04:39
114500 -- (-2213.173) (-2208.461) (-2211.853) [-2207.941] * (-2209.597) (-2208.046) (-2207.528) [-2209.575] -- 0:04:38
115000 -- [-2209.010] (-2210.215) (-2209.379) (-2209.955) * (-2208.917) (-2212.557) [-2211.556] (-2207.204) -- 0:04:37
Average standard deviation of split frequencies: 0.019777
115500 -- (-2203.839) (-2203.149) [-2203.101] (-2220.029) * (-2210.813) (-2210.316) (-2209.200) [-2204.175] -- 0:04:35
116000 -- [-2203.150] (-2206.147) (-2210.799) (-2215.135) * [-2202.129] (-2215.204) (-2217.094) (-2216.376) -- 0:04:34
116500 -- (-2219.122) (-2204.366) [-2206.593] (-2233.388) * (-2213.959) [-2208.154] (-2209.460) (-2214.106) -- 0:04:33
117000 -- (-2223.256) [-2209.811] (-2223.543) (-2208.012) * (-2211.927) (-2209.768) [-2204.364] (-2211.810) -- 0:04:39
117500 -- (-2219.144) (-2207.467) (-2216.198) [-2217.153] * (-2220.333) (-2205.191) (-2216.477) [-2213.109] -- 0:04:37
118000 -- (-2210.821) (-2209.601) (-2220.178) [-2214.007] * (-2209.848) (-2210.246) [-2210.397] (-2213.475) -- 0:04:36
118500 -- (-2221.010) [-2208.683] (-2220.529) (-2222.219) * (-2232.101) (-2213.984) [-2205.186] (-2210.246) -- 0:04:35
119000 -- (-2211.182) [-2211.183] (-2213.202) (-2211.576) * [-2208.134] (-2212.171) (-2208.267) (-2205.153) -- 0:04:33
119500 -- [-2200.486] (-2202.661) (-2220.207) (-2208.027) * (-2213.759) (-2214.484) (-2209.430) [-2200.882] -- 0:04:32
120000 -- (-2207.151) [-2210.332] (-2232.360) (-2213.803) * (-2215.709) [-2207.998] (-2213.120) (-2212.448) -- 0:04:38
Average standard deviation of split frequencies: 0.018752
120500 -- (-2204.602) (-2213.857) (-2222.192) [-2213.785] * (-2227.224) (-2230.155) [-2212.673] (-2206.159) -- 0:04:37
121000 -- (-2209.188) [-2214.313] (-2230.020) (-2221.356) * (-2205.310) [-2218.829] (-2215.186) (-2215.010) -- 0:04:36
121500 -- (-2209.686) [-2213.805] (-2226.541) (-2206.402) * [-2215.208] (-2212.633) (-2211.432) (-2223.114) -- 0:04:34
122000 -- (-2208.542) (-2212.641) (-2217.254) [-2207.946] * (-2220.306) (-2214.353) (-2214.387) [-2202.984] -- 0:04:40
122500 -- (-2208.953) (-2217.826) (-2218.032) [-2205.009] * (-2211.935) [-2202.519] (-2222.452) (-2216.248) -- 0:04:39
123000 -- (-2220.505) (-2215.654) (-2216.682) [-2204.917] * [-2208.320] (-2211.861) (-2229.264) (-2214.112) -- 0:04:38
123500 -- [-2213.370] (-2204.404) (-2215.104) (-2219.262) * (-2215.190) [-2206.279] (-2217.037) (-2209.853) -- 0:04:36
124000 -- (-2206.369) [-2211.348] (-2220.628) (-2214.706) * [-2204.659] (-2210.214) (-2231.054) (-2220.056) -- 0:04:35
124500 -- [-2201.507] (-2215.990) (-2217.125) (-2218.662) * (-2205.235) [-2205.787] (-2214.071) (-2206.008) -- 0:04:34
125000 -- (-2214.493) (-2224.896) [-2206.965] (-2214.054) * [-2207.183] (-2204.141) (-2219.726) (-2219.824) -- 0:04:33
Average standard deviation of split frequencies: 0.016462
125500 -- (-2210.000) (-2217.390) [-2207.229] (-2212.648) * (-2215.734) (-2209.880) (-2206.808) [-2213.927] -- 0:04:38
126000 -- (-2213.301) (-2215.248) (-2220.996) [-2202.314] * (-2209.071) [-2204.559] (-2215.317) (-2229.677) -- 0:04:37
126500 -- (-2216.805) [-2208.571] (-2228.448) (-2209.698) * (-2212.325) (-2210.202) [-2206.008] (-2214.227) -- 0:04:36
127000 -- [-2210.662] (-2204.488) (-2209.274) (-2212.181) * (-2222.786) (-2219.289) [-2211.388] (-2207.473) -- 0:04:34
127500 -- (-2207.416) [-2203.731] (-2219.475) (-2218.902) * (-2217.261) (-2223.046) (-2212.393) [-2220.478] -- 0:04:33
128000 -- (-2208.972) [-2201.785] (-2224.952) (-2224.775) * (-2216.480) (-2210.897) (-2213.812) [-2204.844] -- 0:04:32
128500 -- (-2208.658) (-2211.426) (-2214.035) [-2212.429] * (-2203.372) (-2210.096) [-2204.515] (-2216.126) -- 0:04:31
129000 -- (-2218.659) (-2208.016) (-2217.818) [-2210.567] * (-2215.551) [-2207.324] (-2211.781) (-2214.848) -- 0:04:36
129500 -- (-2215.881) [-2209.588] (-2219.241) (-2210.813) * (-2214.110) (-2209.644) [-2207.627] (-2213.808) -- 0:04:35
130000 -- (-2212.131) (-2220.551) [-2207.374] (-2218.893) * [-2209.451] (-2209.776) (-2212.850) (-2212.629) -- 0:04:34
Average standard deviation of split frequencies: 0.015633
130500 -- (-2215.819) (-2203.523) [-2207.004] (-2215.431) * (-2211.757) (-2215.287) [-2202.977] (-2206.503) -- 0:04:33
131000 -- (-2201.187) (-2204.040) [-2209.062] (-2218.641) * (-2210.295) (-2203.088) (-2214.456) [-2208.498] -- 0:04:31
131500 -- (-2209.839) (-2223.427) [-2205.283] (-2232.207) * [-2210.659] (-2201.351) (-2211.968) (-2224.255) -- 0:04:30
132000 -- [-2210.915] (-2218.753) (-2207.499) (-2211.209) * (-2217.464) (-2209.823) [-2206.913] (-2211.198) -- 0:04:29
132500 -- [-2208.444] (-2217.271) (-2210.333) (-2222.224) * (-2208.165) (-2214.573) (-2219.276) [-2205.786] -- 0:04:34
133000 -- [-2208.858] (-2209.399) (-2214.231) (-2222.031) * (-2217.380) [-2211.126] (-2206.119) (-2210.507) -- 0:04:33
133500 -- [-2210.637] (-2219.420) (-2214.194) (-2209.033) * (-2217.739) [-2205.225] (-2204.744) (-2211.604) -- 0:04:32
134000 -- (-2215.958) [-2209.358] (-2215.425) (-2202.456) * (-2214.161) (-2214.037) [-2198.907] (-2207.595) -- 0:04:31
134500 -- (-2213.512) (-2222.851) (-2210.720) [-2211.438] * (-2214.414) (-2211.244) (-2210.130) [-2204.260] -- 0:04:30
135000 -- (-2213.447) (-2216.604) [-2209.992] (-2210.661) * [-2207.692] (-2214.714) (-2216.021) (-2206.585) -- 0:04:29
Average standard deviation of split frequencies: 0.014789
135500 -- [-2211.918] (-2214.880) (-2217.316) (-2217.660) * (-2216.116) [-2209.789] (-2211.938) (-2211.464) -- 0:04:34
136000 -- [-2208.405] (-2216.058) (-2212.245) (-2203.752) * (-2215.977) [-2211.086] (-2214.845) (-2215.153) -- 0:04:33
136500 -- (-2208.584) [-2216.049] (-2219.576) (-2212.441) * (-2205.137) [-2205.515] (-2209.446) (-2209.659) -- 0:04:32
137000 -- (-2214.818) (-2212.972) [-2204.869] (-2205.347) * [-2208.081] (-2212.244) (-2214.145) (-2213.441) -- 0:04:30
137500 -- (-2207.351) (-2215.473) [-2206.211] (-2211.743) * (-2210.533) (-2208.769) [-2212.419] (-2210.579) -- 0:04:29
138000 -- (-2207.139) (-2211.288) [-2203.257] (-2211.350) * (-2215.564) [-2208.741] (-2220.058) (-2212.114) -- 0:04:28
138500 -- (-2208.760) (-2222.380) [-2216.013] (-2210.631) * (-2211.230) [-2205.205] (-2211.492) (-2221.708) -- 0:04:27
139000 -- (-2210.585) (-2215.459) [-2206.810] (-2210.904) * [-2209.506] (-2201.726) (-2237.501) (-2209.858) -- 0:04:32
139500 -- (-2222.767) (-2222.288) (-2209.849) [-2207.134] * (-2211.848) [-2204.410] (-2222.240) (-2208.368) -- 0:04:31
140000 -- (-2212.970) (-2218.491) [-2208.700] (-2207.843) * (-2213.465) (-2214.409) (-2211.299) [-2206.457] -- 0:04:30
Average standard deviation of split frequencies: 0.015416
140500 -- (-2210.166) (-2221.836) [-2217.037] (-2220.230) * (-2208.370) (-2208.067) [-2208.408] (-2218.362) -- 0:04:29
141000 -- [-2203.775] (-2230.599) (-2209.046) (-2213.464) * (-2211.337) (-2205.421) [-2210.989] (-2215.550) -- 0:04:28
141500 -- (-2206.866) (-2217.312) [-2208.689] (-2208.244) * (-2224.028) (-2220.588) [-2207.164] (-2210.860) -- 0:04:26
142000 -- (-2203.340) (-2209.249) [-2210.184] (-2208.072) * [-2202.704] (-2217.850) (-2215.259) (-2212.150) -- 0:04:31
142500 -- [-2217.345] (-2211.209) (-2206.957) (-2220.766) * [-2200.178] (-2220.445) (-2211.955) (-2219.898) -- 0:04:30
143000 -- (-2209.899) [-2214.627] (-2212.230) (-2217.634) * [-2202.271] (-2217.479) (-2215.885) (-2214.119) -- 0:04:29
143500 -- [-2204.976] (-2216.516) (-2217.211) (-2218.483) * (-2216.236) (-2212.839) [-2207.278] (-2211.233) -- 0:04:28
144000 -- [-2207.625] (-2212.253) (-2218.355) (-2208.881) * (-2225.343) (-2223.927) (-2216.047) [-2210.322] -- 0:04:27
144500 -- (-2199.984) [-2213.732] (-2211.554) (-2227.475) * (-2227.121) (-2215.436) [-2209.268] (-2210.013) -- 0:04:26
145000 -- [-2207.664] (-2220.812) (-2213.511) (-2208.018) * (-2225.890) (-2220.645) [-2212.435] (-2210.375) -- 0:04:31
Average standard deviation of split frequencies: 0.016359
145500 -- (-2212.688) (-2221.412) [-2211.848] (-2206.185) * (-2218.529) (-2212.412) [-2204.730] (-2213.837) -- 0:04:30
146000 -- (-2214.869) (-2221.019) [-2212.958] (-2206.868) * [-2201.971] (-2219.723) (-2225.098) (-2210.523) -- 0:04:29
146500 -- (-2209.500) (-2204.684) (-2225.500) [-2201.668] * (-2212.646) (-2212.824) [-2216.793] (-2220.175) -- 0:04:27
147000 -- (-2211.095) (-2214.220) [-2207.941] (-2211.850) * (-2222.991) (-2205.272) (-2216.541) [-2207.233] -- 0:04:26
147500 -- (-2213.496) (-2206.591) (-2211.480) [-2209.297] * (-2206.932) (-2217.247) (-2214.405) [-2211.271] -- 0:04:25
148000 -- (-2204.930) (-2216.997) (-2214.624) [-2205.039] * (-2212.008) (-2208.310) [-2213.003] (-2215.987) -- 0:04:30
148500 -- [-2211.530] (-2218.557) (-2215.997) (-2219.874) * (-2219.248) (-2203.950) (-2205.943) [-2202.282] -- 0:04:29
149000 -- (-2207.952) (-2206.441) [-2218.033] (-2211.297) * (-2222.149) [-2208.861] (-2215.523) (-2207.156) -- 0:04:28
149500 -- [-2206.547] (-2219.445) (-2210.567) (-2204.534) * (-2209.093) (-2207.368) (-2215.882) [-2205.923] -- 0:04:27
150000 -- [-2208.276] (-2226.071) (-2215.805) (-2203.298) * (-2209.923) (-2220.271) (-2211.840) [-2209.671] -- 0:04:26
Average standard deviation of split frequencies: 0.015435
150500 -- (-2224.279) [-2222.569] (-2222.528) (-2204.762) * (-2218.016) (-2214.127) (-2204.684) [-2205.733] -- 0:04:25
151000 -- [-2212.965] (-2217.952) (-2223.151) (-2211.025) * [-2202.675] (-2206.989) (-2210.758) (-2210.436) -- 0:04:24
151500 -- (-2205.662) [-2209.013] (-2215.245) (-2207.080) * [-2219.773] (-2213.063) (-2217.965) (-2209.772) -- 0:04:28
152000 -- (-2202.686) (-2212.334) [-2208.150] (-2203.909) * (-2212.685) (-2208.712) (-2218.075) [-2208.686] -- 0:04:27
152500 -- (-2207.407) (-2210.954) (-2224.354) [-2204.602] * [-2204.245] (-2203.496) (-2208.393) (-2223.386) -- 0:04:26
153000 -- [-2210.877] (-2213.115) (-2218.937) (-2208.895) * [-2216.853] (-2220.519) (-2208.767) (-2204.641) -- 0:04:25
153500 -- (-2199.133) (-2235.279) [-2216.148] (-2214.683) * (-2215.284) [-2207.626] (-2218.572) (-2217.486) -- 0:04:24
154000 -- (-2219.390) (-2221.468) (-2204.786) [-2212.711] * (-2211.554) (-2209.895) (-2223.168) [-2218.080] -- 0:04:23
154500 -- (-2215.814) [-2206.648] (-2206.848) (-2218.560) * (-2211.274) [-2207.924] (-2213.566) (-2214.996) -- 0:04:28
155000 -- (-2207.464) (-2221.696) [-2207.657] (-2217.110) * (-2206.932) [-2218.830] (-2213.496) (-2214.493) -- 0:04:27
Average standard deviation of split frequencies: 0.016519
155500 -- [-2206.449] (-2216.259) (-2214.307) (-2218.216) * (-2213.345) (-2224.467) (-2215.820) [-2209.192] -- 0:04:26
156000 -- [-2213.423] (-2224.072) (-2198.936) (-2210.239) * (-2215.094) (-2217.484) [-2214.154] (-2205.403) -- 0:04:25
156500 -- [-2210.631] (-2214.365) (-2201.372) (-2218.992) * (-2220.265) (-2224.077) (-2211.277) [-2207.939] -- 0:04:24
157000 -- (-2226.000) (-2212.388) (-2215.470) [-2203.624] * (-2217.339) [-2207.526] (-2220.905) (-2216.762) -- 0:04:23
157500 -- (-2215.171) (-2227.553) (-2207.570) [-2207.400] * [-2207.448] (-2214.961) (-2221.996) (-2203.928) -- 0:04:27
158000 -- (-2213.150) (-2213.932) [-2212.551] (-2223.842) * (-2213.655) (-2203.242) (-2214.681) [-2216.494] -- 0:04:26
158500 -- (-2212.681) (-2219.350) [-2207.437] (-2215.076) * [-2216.817] (-2208.617) (-2209.055) (-2211.788) -- 0:04:25
159000 -- [-2203.146] (-2224.793) (-2216.328) (-2217.585) * (-2214.920) [-2210.546] (-2215.564) (-2219.629) -- 0:04:24
159500 -- (-2212.741) (-2219.497) (-2211.442) [-2202.788] * (-2225.593) (-2215.099) (-2206.595) [-2210.538] -- 0:04:23
160000 -- (-2208.191) (-2214.883) (-2217.157) [-2204.671] * (-2216.511) [-2209.246] (-2207.208) (-2206.660) -- 0:04:22
Average standard deviation of split frequencies: 0.016766
160500 -- (-2211.856) [-2210.128] (-2207.882) (-2216.165) * (-2209.146) (-2221.687) (-2206.426) [-2208.958] -- 0:04:21
161000 -- (-2224.683) [-2208.705] (-2207.757) (-2209.797) * (-2216.822) [-2209.526] (-2214.551) (-2203.593) -- 0:04:25
161500 -- (-2214.721) (-2210.527) [-2212.498] (-2210.926) * (-2224.530) (-2221.866) [-2207.446] (-2206.959) -- 0:04:24
162000 -- (-2210.204) (-2222.967) [-2211.507] (-2202.226) * (-2216.162) (-2210.642) (-2210.887) [-2203.485] -- 0:04:23
162500 -- (-2221.875) (-2210.343) (-2215.450) [-2207.710] * (-2220.910) (-2206.827) (-2209.593) [-2206.942] -- 0:04:22
163000 -- (-2212.171) (-2232.959) (-2221.651) [-2204.193] * (-2212.366) (-2209.200) [-2206.348] (-2211.946) -- 0:04:21
163500 -- [-2208.843] (-2229.812) (-2216.149) (-2212.230) * (-2228.456) (-2214.423) (-2209.540) [-2206.303] -- 0:04:20
164000 -- (-2211.545) (-2223.274) (-2206.825) [-2203.522] * (-2208.507) (-2217.379) [-2207.327] (-2210.634) -- 0:04:19
164500 -- [-2206.935] (-2205.841) (-2208.289) (-2212.647) * [-2215.593] (-2221.171) (-2207.395) (-2206.397) -- 0:04:24
165000 -- (-2218.997) [-2204.581] (-2214.217) (-2207.711) * (-2216.519) [-2199.221] (-2208.596) (-2216.484) -- 0:04:23
Average standard deviation of split frequencies: 0.022313
165500 -- (-2212.317) (-2218.179) [-2217.457] (-2214.146) * (-2220.080) [-2207.821] (-2216.457) (-2214.877) -- 0:04:22
166000 -- (-2219.375) (-2211.127) [-2216.316] (-2215.918) * (-2213.351) (-2204.400) (-2207.553) [-2210.638] -- 0:04:21
166500 -- (-2225.348) [-2220.303] (-2207.139) (-2209.726) * (-2222.209) (-2225.542) [-2211.852] (-2207.134) -- 0:04:20
167000 -- (-2217.592) (-2207.075) [-2204.350] (-2223.558) * (-2221.754) (-2207.855) [-2209.609] (-2212.423) -- 0:04:19
167500 -- (-2221.164) (-2206.900) [-2205.840] (-2208.533) * (-2210.661) (-2216.110) [-2207.177] (-2211.134) -- 0:04:23
168000 -- (-2210.303) (-2209.856) [-2208.493] (-2218.640) * [-2203.244] (-2210.841) (-2213.335) (-2204.303) -- 0:04:22
168500 -- (-2221.079) (-2218.951) [-2207.379] (-2214.203) * (-2210.038) (-2219.877) [-2203.413] (-2215.308) -- 0:04:21
169000 -- (-2219.599) (-2218.379) [-2207.403] (-2203.769) * (-2216.928) (-2205.351) [-2203.389] (-2212.180) -- 0:04:20
169500 -- (-2217.595) (-2219.817) [-2216.029] (-2211.246) * (-2212.942) [-2207.622] (-2207.412) (-2208.559) -- 0:04:19
170000 -- (-2223.652) (-2220.972) (-2221.985) [-2202.587] * (-2207.620) (-2218.767) (-2206.899) [-2209.460] -- 0:04:18
Average standard deviation of split frequencies: 0.019138
170500 -- (-2204.242) [-2208.314] (-2233.208) (-2211.561) * (-2220.186) (-2199.134) (-2216.236) [-2204.617] -- 0:04:22
171000 -- (-2209.563) [-2213.782] (-2213.563) (-2220.494) * (-2204.659) (-2200.231) (-2218.641) [-2201.874] -- 0:04:21
171500 -- [-2206.554] (-2207.515) (-2211.110) (-2214.940) * (-2222.181) (-2213.115) [-2209.482] (-2216.260) -- 0:04:20
172000 -- [-2211.953] (-2213.346) (-2211.745) (-2227.540) * (-2227.982) (-2208.266) [-2208.057] (-2214.989) -- 0:04:19
172500 -- (-2211.127) (-2205.254) [-2206.760] (-2217.091) * (-2218.572) [-2209.465] (-2207.874) (-2215.728) -- 0:04:19
173000 -- [-2205.206] (-2212.496) (-2211.958) (-2217.077) * (-2210.836) (-2207.771) [-2205.939] (-2216.912) -- 0:04:18
173500 -- (-2205.403) (-2220.285) [-2204.538] (-2217.015) * (-2211.231) [-2212.425] (-2213.074) (-2213.635) -- 0:04:17
174000 -- [-2209.034] (-2229.452) (-2207.979) (-2214.798) * [-2214.220] (-2213.357) (-2210.787) (-2215.415) -- 0:04:21
174500 -- (-2207.834) [-2209.382] (-2209.538) (-2219.027) * (-2209.721) (-2207.050) (-2226.219) [-2206.465] -- 0:04:20
175000 -- (-2218.179) [-2206.353] (-2217.139) (-2213.701) * (-2200.384) (-2219.979) (-2206.479) [-2207.911] -- 0:04:19
Average standard deviation of split frequencies: 0.016645
175500 -- [-2216.582] (-2218.311) (-2206.758) (-2210.135) * (-2225.669) (-2224.700) [-2207.681] (-2210.015) -- 0:04:18
176000 -- (-2214.384) [-2219.326] (-2211.973) (-2211.709) * (-2208.035) (-2213.666) [-2205.222] (-2214.378) -- 0:04:17
176500 -- (-2217.788) [-2204.585] (-2206.838) (-2213.834) * (-2212.377) [-2208.571] (-2201.830) (-2213.679) -- 0:04:16
177000 -- [-2208.730] (-2213.837) (-2207.226) (-2209.415) * (-2201.142) [-2200.927] (-2210.856) (-2217.645) -- 0:04:15
177500 -- (-2216.603) (-2238.914) [-2212.372] (-2199.283) * [-2203.158] (-2203.799) (-2208.055) (-2211.029) -- 0:04:19
178000 -- (-2215.960) (-2208.668) (-2215.155) [-2206.127] * [-2209.585] (-2204.145) (-2220.234) (-2217.800) -- 0:04:18
178500 -- (-2221.528) (-2210.322) (-2216.443) [-2203.726] * [-2205.532] (-2209.468) (-2209.027) (-2217.033) -- 0:04:17
179000 -- (-2221.658) (-2210.983) (-2211.597) [-2208.359] * (-2202.898) [-2201.493] (-2227.040) (-2211.357) -- 0:04:16
179500 -- (-2222.337) (-2211.987) (-2227.429) [-2216.512] * (-2206.580) (-2205.944) [-2209.919] (-2219.241) -- 0:04:15
180000 -- (-2208.082) [-2204.987] (-2222.113) (-2205.616) * [-2225.095] (-2206.356) (-2207.334) (-2200.820) -- 0:04:15
Average standard deviation of split frequencies: 0.019010
180500 -- (-2207.071) (-2206.998) [-2205.558] (-2209.328) * (-2216.419) (-2210.967) [-2214.878] (-2205.665) -- 0:04:18
181000 -- (-2220.867) (-2222.888) (-2222.354) [-2212.119] * [-2209.659] (-2204.511) (-2210.436) (-2208.904) -- 0:04:17
181500 -- (-2209.684) (-2233.949) [-2206.064] (-2214.636) * (-2212.143) (-2201.511) (-2217.241) [-2211.200] -- 0:04:17
182000 -- (-2209.644) (-2231.754) [-2203.241] (-2212.714) * (-2212.882) [-2204.856] (-2213.077) (-2215.232) -- 0:04:16
182500 -- [-2207.978] (-2211.447) (-2227.563) (-2214.588) * (-2212.965) (-2219.366) [-2199.254] (-2222.230) -- 0:04:15
183000 -- (-2208.766) (-2216.540) [-2204.623] (-2213.601) * (-2215.774) [-2213.590] (-2211.974) (-2212.283) -- 0:04:14
183500 -- [-2207.805] (-2205.516) (-2213.809) (-2209.679) * (-2215.751) (-2221.928) (-2216.019) [-2208.590] -- 0:04:18
184000 -- (-2217.718) [-2204.417] (-2212.116) (-2208.173) * (-2217.582) (-2212.653) [-2213.984] (-2213.125) -- 0:04:17
184500 -- (-2220.588) (-2213.508) (-2215.359) [-2207.613] * [-2207.580] (-2217.608) (-2212.552) (-2199.260) -- 0:04:16
185000 -- (-2215.686) [-2211.746] (-2221.489) (-2207.429) * [-2205.613] (-2210.490) (-2215.769) (-2217.399) -- 0:04:15
Average standard deviation of split frequencies: 0.019551
185500 -- (-2208.694) (-2228.191) (-2225.006) [-2206.238] * (-2199.617) (-2209.048) (-2210.056) [-2219.640] -- 0:04:14
186000 -- (-2216.453) (-2221.903) [-2205.726] (-2218.390) * (-2211.427) (-2221.930) (-2214.021) [-2207.501] -- 0:04:18
186500 -- (-2210.289) (-2210.322) [-2206.586] (-2211.580) * [-2202.788] (-2220.335) (-2210.410) (-2202.429) -- 0:04:17
187000 -- (-2218.232) (-2211.740) [-2209.128] (-2204.684) * (-2206.237) (-2205.511) (-2219.988) [-2212.602] -- 0:04:16
187500 -- [-2210.123] (-2223.030) (-2209.484) (-2209.241) * [-2202.216] (-2201.102) (-2220.925) (-2212.345) -- 0:04:15
188000 -- (-2227.515) (-2213.831) (-2207.268) [-2203.075] * (-2219.411) [-2211.348] (-2215.670) (-2206.491) -- 0:04:14
188500 -- (-2216.583) (-2216.119) [-2206.224] (-2213.510) * (-2224.415) (-2218.152) [-2203.695] (-2212.804) -- 0:04:13
189000 -- (-2209.987) [-2210.360] (-2224.788) (-2216.686) * [-2222.735] (-2206.435) (-2213.010) (-2234.730) -- 0:04:13
189500 -- (-2207.832) [-2208.638] (-2214.176) (-2203.562) * (-2214.811) [-2206.314] (-2215.638) (-2221.269) -- 0:04:16
190000 -- (-2213.442) [-2203.316] (-2213.959) (-2221.460) * (-2218.783) [-2209.323] (-2218.339) (-2211.899) -- 0:04:15
Average standard deviation of split frequencies: 0.020662
190500 -- [-2212.358] (-2205.520) (-2223.453) (-2225.883) * [-2207.112] (-2210.030) (-2205.873) (-2219.504) -- 0:04:14
191000 -- (-2210.880) (-2213.352) [-2205.977] (-2209.853) * (-2208.991) (-2206.814) (-2225.109) [-2206.084] -- 0:04:14
191500 -- (-2205.473) (-2206.451) [-2200.604] (-2214.989) * (-2221.203) (-2206.826) (-2213.284) [-2211.524] -- 0:04:13
192000 -- [-2216.943] (-2205.240) (-2208.244) (-2214.780) * [-2210.248] (-2210.136) (-2214.447) (-2215.461) -- 0:04:12
192500 -- [-2202.377] (-2211.936) (-2212.201) (-2223.630) * (-2207.243) [-2208.256] (-2221.579) (-2214.834) -- 0:04:11
193000 -- (-2203.785) [-2208.368] (-2221.563) (-2211.656) * (-2219.519) (-2209.803) [-2208.849] (-2212.135) -- 0:04:10
193500 -- (-2209.421) [-2210.668] (-2204.857) (-2208.597) * (-2240.487) [-2205.428] (-2218.467) (-2210.496) -- 0:04:14
194000 -- (-2224.364) (-2231.433) (-2218.739) [-2214.828] * (-2217.664) [-2211.118] (-2227.347) (-2215.396) -- 0:04:13
194500 -- [-2210.431] (-2217.617) (-2216.508) (-2208.621) * [-2211.095] (-2207.188) (-2217.743) (-2210.262) -- 0:04:12
195000 -- (-2208.022) (-2216.033) [-2209.675] (-2223.667) * (-2204.390) (-2221.245) (-2225.570) [-2214.479] -- 0:04:11
Average standard deviation of split frequencies: 0.021131
195500 -- (-2223.108) (-2207.691) (-2216.951) [-2212.924] * [-2213.163] (-2218.652) (-2216.289) (-2230.240) -- 0:04:11
196000 -- [-2211.423] (-2230.749) (-2214.112) (-2208.559) * (-2216.425) (-2228.808) [-2205.179] (-2215.064) -- 0:04:10
196500 -- [-2208.899] (-2214.492) (-2212.451) (-2207.730) * (-2213.048) (-2218.105) (-2206.742) [-2215.717] -- 0:04:09
197000 -- (-2216.597) [-2205.030] (-2214.886) (-2205.251) * [-2207.596] (-2213.848) (-2215.536) (-2217.106) -- 0:04:12
197500 -- (-2211.855) [-2199.539] (-2215.486) (-2222.594) * (-2213.982) (-2220.124) (-2218.457) [-2210.532] -- 0:04:11
198000 -- [-2203.810] (-2202.559) (-2210.857) (-2215.575) * (-2208.307) (-2204.753) [-2212.476] (-2207.566) -- 0:04:11
198500 -- (-2225.674) (-2214.414) [-2216.219] (-2212.167) * [-2210.708] (-2209.350) (-2219.688) (-2205.725) -- 0:04:10
199000 -- (-2207.901) (-2214.609) (-2213.077) [-2211.716] * [-2202.816] (-2216.817) (-2233.783) (-2221.060) -- 0:04:09
199500 -- (-2211.956) (-2212.388) [-2207.126] (-2208.894) * [-2201.251] (-2227.207) (-2211.515) (-2207.889) -- 0:04:08
200000 -- (-2222.583) [-2224.034] (-2216.865) (-2208.546) * (-2211.708) (-2222.433) (-2216.949) [-2211.518] -- 0:04:08
Average standard deviation of split frequencies: 0.019465
200500 -- (-2216.590) [-2208.745] (-2213.428) (-2209.636) * [-2210.741] (-2212.368) (-2211.573) (-2211.974) -- 0:04:11
201000 -- (-2222.503) [-2205.987] (-2217.003) (-2204.826) * (-2214.708) (-2215.262) (-2215.051) [-2220.439] -- 0:04:10
201500 -- (-2220.050) (-2206.355) (-2219.013) [-2201.112] * [-2202.407] (-2229.304) (-2229.920) (-2217.499) -- 0:04:09
202000 -- (-2207.873) (-2216.059) (-2215.685) [-2201.319] * [-2212.841] (-2208.395) (-2223.705) (-2213.599) -- 0:04:08
202500 -- (-2208.756) [-2212.520] (-2208.954) (-2208.902) * (-2221.590) [-2202.923] (-2215.944) (-2224.451) -- 0:04:12
203000 -- (-2219.240) [-2206.459] (-2215.166) (-2211.327) * [-2202.719] (-2205.456) (-2229.101) (-2213.319) -- 0:04:11
203500 -- [-2207.309] (-2204.633) (-2216.694) (-2204.911) * (-2208.880) (-2219.432) [-2208.635] (-2210.041) -- 0:04:10
204000 -- (-2202.583) [-2206.514] (-2219.174) (-2211.847) * (-2215.782) (-2214.494) (-2210.210) [-2217.569] -- 0:04:09
204500 -- (-2210.951) (-2209.102) [-2211.533] (-2227.743) * (-2212.816) (-2220.018) (-2202.904) [-2211.566] -- 0:04:08
205000 -- (-2208.752) (-2211.895) (-2213.240) [-2218.578] * (-2216.809) (-2231.305) [-2204.544] (-2214.574) -- 0:04:08
Average standard deviation of split frequencies: 0.018307
205500 -- (-2220.510) [-2208.793] (-2213.514) (-2214.677) * (-2209.668) (-2217.305) [-2208.515] (-2205.458) -- 0:04:11
206000 -- (-2215.210) (-2225.234) [-2206.843] (-2212.772) * (-2209.946) (-2230.228) (-2218.143) [-2211.279] -- 0:04:10
206500 -- (-2216.774) [-2216.010] (-2214.502) (-2207.150) * (-2211.454) (-2221.251) [-2201.041] (-2224.861) -- 0:04:09
207000 -- (-2208.569) [-2209.026] (-2219.431) (-2205.564) * (-2211.065) (-2210.389) [-2199.709] (-2222.249) -- 0:04:09
207500 -- (-2215.744) [-2208.382] (-2206.495) (-2209.784) * (-2214.924) (-2217.113) [-2201.628] (-2208.808) -- 0:04:08
208000 -- [-2216.880] (-2216.315) (-2218.593) (-2223.293) * (-2211.836) [-2201.865] (-2222.410) (-2205.998) -- 0:04:07
208500 -- (-2213.593) (-2224.826) [-2217.400] (-2216.814) * [-2220.054] (-2206.745) (-2219.258) (-2224.660) -- 0:04:06
209000 -- (-2217.292) [-2221.127] (-2212.601) (-2210.902) * (-2216.138) (-2211.072) (-2215.161) [-2208.076] -- 0:04:09
209500 -- (-2217.136) (-2210.981) (-2208.330) [-2205.780] * (-2206.740) [-2208.625] (-2212.991) (-2209.262) -- 0:04:09
210000 -- (-2207.754) [-2208.094] (-2218.283) (-2222.112) * (-2209.203) (-2209.123) (-2214.361) [-2216.278] -- 0:04:08
Average standard deviation of split frequencies: 0.016143
210500 -- (-2212.655) (-2214.757) (-2215.603) [-2205.520] * (-2212.307) (-2218.663) [-2213.397] (-2215.852) -- 0:04:07
211000 -- (-2210.328) [-2206.627] (-2219.622) (-2207.084) * (-2209.247) [-2207.332] (-2225.780) (-2204.217) -- 0:04:06
211500 -- (-2217.641) [-2206.767] (-2221.576) (-2209.633) * [-2203.576] (-2217.347) (-2217.507) (-2201.108) -- 0:04:06
212000 -- (-2211.477) (-2209.805) [-2210.779] (-2215.102) * (-2217.480) (-2215.068) [-2207.053] (-2215.259) -- 0:04:05
212500 -- (-2204.402) (-2214.694) [-2205.069] (-2216.417) * (-2224.925) (-2217.145) [-2211.418] (-2208.107) -- 0:04:08
213000 -- (-2220.307) [-2217.884] (-2217.756) (-2210.566) * [-2200.299] (-2208.355) (-2217.487) (-2213.894) -- 0:04:07
213500 -- (-2219.714) [-2200.345] (-2217.406) (-2220.079) * [-2209.751] (-2207.717) (-2209.207) (-2212.822) -- 0:04:06
214000 -- (-2224.888) [-2204.435] (-2208.291) (-2225.759) * (-2224.437) [-2208.005] (-2214.326) (-2213.839) -- 0:04:06
214500 -- (-2215.710) [-2209.379] (-2223.740) (-2209.710) * (-2201.889) [-2215.847] (-2206.891) (-2205.682) -- 0:04:05
215000 -- (-2216.611) (-2217.419) [-2203.801] (-2214.063) * [-2218.033] (-2212.572) (-2212.951) (-2213.797) -- 0:04:04
Average standard deviation of split frequencies: 0.015901
215500 -- (-2218.310) [-2209.309] (-2215.862) (-2212.647) * (-2215.307) (-2220.897) [-2203.480] (-2222.620) -- 0:04:03
216000 -- [-2210.495] (-2217.677) (-2221.153) (-2208.952) * [-2227.118] (-2212.870) (-2212.039) (-2235.713) -- 0:04:03
216500 -- (-2203.893) (-2209.109) (-2210.715) [-2211.097] * (-2214.942) [-2208.167] (-2211.957) (-2223.059) -- 0:04:06
217000 -- (-2215.089) (-2211.498) [-2206.045] (-2217.428) * (-2214.426) [-2209.180] (-2208.391) (-2218.918) -- 0:04:05
217500 -- (-2232.167) (-2205.138) [-2207.401] (-2207.414) * (-2221.596) (-2205.019) [-2209.985] (-2214.061) -- 0:04:04
218000 -- (-2227.345) (-2222.248) (-2220.139) [-2209.786] * (-2218.706) [-2203.942] (-2204.349) (-2208.414) -- 0:04:03
218500 -- (-2203.915) (-2219.445) [-2209.976] (-2219.076) * (-2209.024) (-2216.709) [-2206.780] (-2212.513) -- 0:04:03
219000 -- (-2214.254) (-2216.535) [-2201.670] (-2216.867) * (-2208.558) [-2205.988] (-2229.817) (-2206.478) -- 0:04:02
219500 -- [-2212.045] (-2212.850) (-2217.131) (-2214.129) * (-2204.177) [-2205.356] (-2226.765) (-2205.425) -- 0:04:05
220000 -- (-2215.976) (-2207.174) [-2203.612] (-2211.375) * [-2205.501] (-2205.187) (-2216.785) (-2225.503) -- 0:04:04
Average standard deviation of split frequencies: 0.012665
220500 -- (-2216.917) [-2210.816] (-2217.461) (-2209.882) * (-2210.819) (-2210.198) [-2209.912] (-2217.082) -- 0:04:03
221000 -- [-2215.538] (-2209.717) (-2216.154) (-2225.108) * (-2216.405) (-2204.785) (-2210.810) [-2210.189] -- 0:04:03
221500 -- (-2213.205) [-2208.080] (-2211.381) (-2218.560) * (-2212.108) [-2211.027] (-2226.847) (-2216.383) -- 0:04:02
222000 -- (-2226.200) [-2209.840] (-2214.997) (-2218.659) * (-2216.379) (-2220.802) (-2216.709) [-2207.762] -- 0:04:01
222500 -- (-2212.083) (-2211.907) (-2211.007) [-2200.838] * (-2204.172) [-2209.454] (-2223.033) (-2210.056) -- 0:04:01
223000 -- [-2219.092] (-2203.205) (-2213.915) (-2215.423) * [-2214.835] (-2212.864) (-2211.613) (-2213.307) -- 0:04:03
223500 -- (-2215.093) [-2209.678] (-2216.065) (-2220.203) * (-2210.604) [-2208.213] (-2212.092) (-2220.443) -- 0:04:03
224000 -- (-2222.460) [-2206.533] (-2204.226) (-2216.803) * (-2206.060) (-2208.017) (-2214.665) [-2212.563] -- 0:04:02
224500 -- (-2214.990) (-2211.609) (-2210.102) [-2211.250] * [-2211.905] (-2209.397) (-2219.419) (-2216.966) -- 0:04:01
225000 -- (-2224.056) (-2203.632) (-2212.645) [-2210.878] * (-2208.166) [-2207.802] (-2209.025) (-2206.968) -- 0:04:01
Average standard deviation of split frequencies: 0.012813
225500 -- (-2212.706) (-2206.908) [-2214.630] (-2216.300) * (-2216.002) (-2217.469) (-2213.200) [-2207.080] -- 0:04:00
226000 -- (-2210.645) [-2209.243] (-2209.812) (-2209.560) * (-2213.972) (-2219.077) (-2205.934) [-2208.092] -- 0:03:59
226500 -- (-2219.656) (-2228.190) [-2211.943] (-2204.414) * (-2227.056) [-2212.885] (-2217.917) (-2213.976) -- 0:04:02
227000 -- (-2206.124) (-2219.721) [-2206.789] (-2213.143) * (-2217.886) (-2211.810) (-2212.510) [-2221.029] -- 0:04:01
227500 -- (-2216.530) [-2205.005] (-2210.942) (-2212.710) * (-2219.803) (-2217.464) (-2217.516) [-2208.055] -- 0:04:01
228000 -- (-2218.086) (-2212.945) (-2214.974) [-2207.193] * (-2211.875) (-2225.013) (-2210.504) [-2213.519] -- 0:04:00
228500 -- (-2223.313) (-2212.707) [-2208.461] (-2210.559) * (-2205.567) [-2214.878] (-2215.808) (-2230.609) -- 0:03:59
229000 -- (-2228.390) (-2215.052) [-2209.307] (-2214.690) * (-2202.648) [-2212.000] (-2206.248) (-2211.930) -- 0:03:59
229500 -- (-2216.574) (-2202.801) (-2216.651) [-2211.078] * (-2205.701) [-2205.548] (-2218.459) (-2215.630) -- 0:03:58
230000 -- (-2218.527) [-2210.016] (-2214.065) (-2213.013) * [-2211.621] (-2216.586) (-2213.076) (-2210.951) -- 0:03:57
Average standard deviation of split frequencies: 0.011678
230500 -- (-2227.841) (-2207.924) [-2207.119] (-2209.662) * (-2212.223) (-2212.178) [-2207.001] (-2210.318) -- 0:04:00
231000 -- (-2215.748) (-2206.047) (-2203.070) [-2205.937] * [-2209.472] (-2212.306) (-2204.427) (-2217.431) -- 0:03:59
231500 -- (-2220.535) (-2206.053) [-2210.182] (-2237.073) * (-2209.184) (-2218.862) [-2204.868] (-2212.602) -- 0:03:59
232000 -- (-2214.120) (-2218.700) (-2216.261) [-2204.384] * (-2213.577) (-2209.499) [-2209.880] (-2206.919) -- 0:03:58
232500 -- [-2208.113] (-2223.271) (-2206.535) (-2208.215) * (-2206.823) (-2210.253) [-2203.586] (-2207.932) -- 0:03:57
233000 -- (-2212.917) [-2207.510] (-2207.989) (-2211.417) * (-2211.092) (-2222.310) (-2213.354) [-2212.939] -- 0:03:57
233500 -- (-2212.003) (-2205.516) [-2202.745] (-2209.262) * (-2208.667) (-2216.662) (-2211.980) [-2208.532] -- 0:03:59
234000 -- (-2211.460) [-2198.365] (-2211.113) (-2213.976) * [-2207.761] (-2219.272) (-2207.335) (-2215.325) -- 0:03:58
234500 -- [-2212.601] (-2211.708) (-2205.749) (-2215.727) * [-2202.189] (-2210.782) (-2206.446) (-2219.519) -- 0:03:58
235000 -- (-2201.884) (-2213.228) (-2216.400) [-2212.388] * (-2209.465) (-2217.664) (-2209.919) [-2218.517] -- 0:03:57
Average standard deviation of split frequencies: 0.011414
235500 -- (-2221.667) (-2217.957) [-2217.454] (-2206.832) * [-2214.756] (-2210.096) (-2212.667) (-2214.481) -- 0:03:56
236000 -- (-2216.222) [-2199.310] (-2212.526) (-2212.052) * [-2202.215] (-2216.432) (-2212.482) (-2215.812) -- 0:03:56
236500 -- (-2221.564) (-2216.927) (-2216.751) [-2208.642] * [-2206.667] (-2218.540) (-2211.871) (-2209.974) -- 0:03:55
237000 -- (-2213.380) (-2223.692) (-2213.755) [-2202.673] * (-2211.510) (-2211.113) (-2217.270) [-2210.744] -- 0:03:58
237500 -- (-2209.863) (-2214.245) (-2217.903) [-2209.111] * [-2211.748] (-2217.856) (-2204.052) (-2208.978) -- 0:03:57
238000 -- [-2217.252] (-2217.886) (-2210.224) (-2214.131) * [-2209.681] (-2211.890) (-2217.389) (-2207.474) -- 0:03:56
238500 -- (-2219.505) (-2221.517) (-2212.635) [-2209.358] * [-2200.405] (-2235.989) (-2209.291) (-2208.020) -- 0:03:56
239000 -- (-2214.047) (-2221.752) [-2209.165] (-2215.985) * (-2203.516) (-2215.564) (-2203.297) [-2210.323] -- 0:03:55
239500 -- (-2214.675) (-2226.322) [-2205.245] (-2219.981) * (-2213.568) [-2207.675] (-2210.352) (-2216.298) -- 0:03:54
240000 -- (-2220.936) (-2210.531) (-2217.305) [-2224.149] * (-2207.451) (-2217.299) [-2209.507] (-2201.312) -- 0:03:54
Average standard deviation of split frequencies: 0.010213
240500 -- (-2215.067) (-2207.731) (-2213.690) [-2209.950] * (-2216.678) (-2213.582) (-2218.689) [-2208.679] -- 0:03:56
241000 -- (-2216.952) [-2201.048] (-2204.791) (-2225.526) * (-2214.252) [-2204.864] (-2207.802) (-2214.776) -- 0:03:56
241500 -- (-2220.625) [-2214.897] (-2201.966) (-2206.586) * (-2217.942) [-2211.642] (-2198.997) (-2215.484) -- 0:03:55
242000 -- (-2203.578) (-2205.022) [-2204.340] (-2219.997) * (-2208.924) (-2214.396) [-2209.151] (-2215.519) -- 0:03:54
242500 -- [-2207.907] (-2199.929) (-2211.707) (-2215.793) * (-2222.659) [-2224.275] (-2216.055) (-2209.278) -- 0:03:54
243000 -- (-2210.987) (-2209.181) (-2212.810) [-2209.111] * (-2211.054) [-2213.839] (-2201.701) (-2211.321) -- 0:03:53
243500 -- (-2216.688) [-2209.401] (-2230.374) (-2209.097) * (-2215.642) (-2209.960) (-2212.469) [-2207.282] -- 0:03:53
244000 -- (-2217.336) [-2205.250] (-2213.977) (-2216.009) * (-2215.919) [-2212.730] (-2216.521) (-2213.368) -- 0:03:55
244500 -- (-2221.071) (-2206.017) (-2205.842) [-2208.918] * (-2214.707) (-2215.185) [-2203.357] (-2213.039) -- 0:03:54
245000 -- [-2203.547] (-2215.200) (-2208.432) (-2224.046) * (-2235.909) (-2217.022) [-2206.880] (-2209.868) -- 0:03:54
Average standard deviation of split frequencies: 0.009034
245500 -- (-2201.911) (-2218.383) (-2213.965) [-2215.444] * (-2233.240) [-2212.526] (-2220.003) (-2214.328) -- 0:03:53
246000 -- [-2203.161] (-2215.211) (-2209.341) (-2221.843) * (-2225.521) (-2216.392) [-2208.982] (-2214.939) -- 0:03:52
246500 -- [-2201.452] (-2207.057) (-2209.557) (-2221.888) * (-2217.025) (-2221.077) [-2213.138] (-2200.877) -- 0:03:52
247000 -- (-2201.628) (-2210.957) (-2211.499) [-2217.167] * (-2212.428) (-2211.615) (-2206.317) [-2214.674] -- 0:03:51
247500 -- [-2205.341] (-2212.170) (-2208.776) (-2219.388) * (-2241.801) (-2214.587) [-2203.855] (-2211.003) -- 0:03:54
248000 -- (-2216.155) (-2219.621) (-2215.372) [-2214.310] * (-2206.369) [-2224.402] (-2224.035) (-2210.918) -- 0:03:53
248500 -- (-2219.249) [-2218.585] (-2216.028) (-2207.237) * (-2208.018) [-2212.752] (-2229.241) (-2216.248) -- 0:03:52
249000 -- [-2214.374] (-2217.766) (-2211.895) (-2209.592) * (-2218.439) (-2211.511) (-2219.662) [-2214.166] -- 0:03:52
249500 -- [-2201.203] (-2219.061) (-2208.928) (-2220.789) * [-2205.711] (-2211.484) (-2213.937) (-2208.227) -- 0:03:51
250000 -- (-2214.851) (-2211.881) [-2209.922] (-2223.095) * (-2209.558) (-2216.175) [-2212.532] (-2217.785) -- 0:03:51
Average standard deviation of split frequencies: 0.009806
250500 -- [-2208.907] (-2208.183) (-2222.831) (-2211.845) * (-2222.113) (-2210.558) [-2216.297] (-2217.655) -- 0:03:50
251000 -- [-2207.733] (-2217.284) (-2214.589) (-2211.858) * (-2211.011) (-2215.861) (-2213.368) [-2200.885] -- 0:03:49
251500 -- [-2208.945] (-2218.482) (-2208.530) (-2206.865) * (-2214.736) [-2212.622] (-2208.338) (-2215.879) -- 0:03:52
252000 -- (-2207.512) (-2228.235) (-2214.789) [-2203.123] * (-2215.088) [-2213.321] (-2216.349) (-2216.858) -- 0:03:51
252500 -- (-2206.178) [-2219.558] (-2210.568) (-2211.054) * (-2210.135) [-2215.777] (-2212.479) (-2216.555) -- 0:03:50
253000 -- (-2210.877) (-2216.967) (-2213.063) [-2209.846] * (-2208.154) [-2207.273] (-2218.436) (-2213.352) -- 0:03:50
253500 -- (-2208.465) (-2214.819) (-2225.438) [-2207.448] * (-2201.378) (-2216.949) [-2212.415] (-2213.237) -- 0:03:49
254000 -- (-2205.952) (-2210.457) (-2216.837) [-2209.775] * (-2203.991) [-2203.858] (-2209.223) (-2214.859) -- 0:03:49
254500 -- (-2216.339) (-2208.607) (-2210.790) [-2214.056] * [-2204.920] (-2218.073) (-2215.374) (-2230.773) -- 0:03:48
255000 -- (-2210.084) (-2214.132) [-2208.638] (-2217.797) * [-2204.455] (-2221.011) (-2217.617) (-2213.406) -- 0:03:50
Average standard deviation of split frequencies: 0.009865
255500 -- [-2204.164] (-2213.646) (-2214.162) (-2209.660) * (-2213.128) (-2217.617) [-2209.359] (-2233.517) -- 0:03:50
256000 -- (-2224.900) (-2206.921) [-2207.082] (-2214.061) * (-2219.755) (-2213.231) (-2213.588) [-2211.571] -- 0:03:49
256500 -- (-2215.653) [-2208.482] (-2204.570) (-2213.263) * (-2213.057) (-2222.602) [-2203.513] (-2206.261) -- 0:03:48
257000 -- (-2202.856) (-2218.866) (-2215.857) [-2202.698] * (-2210.993) (-2215.978) (-2203.669) [-2211.414] -- 0:03:48
257500 -- (-2223.102) (-2217.404) [-2214.020] (-2216.919) * [-2216.363] (-2216.633) (-2208.954) (-2203.868) -- 0:03:50
258000 -- (-2207.388) [-2199.600] (-2226.504) (-2218.650) * (-2217.805) (-2215.842) [-2205.500] (-2212.362) -- 0:03:50
258500 -- [-2207.888] (-2209.806) (-2221.937) (-2220.264) * (-2207.265) [-2203.774] (-2214.067) (-2225.120) -- 0:03:49
259000 -- (-2217.666) [-2211.864] (-2209.448) (-2223.307) * [-2207.308] (-2224.702) (-2206.904) (-2224.029) -- 0:03:48
259500 -- (-2219.368) (-2211.163) (-2206.899) [-2210.761] * (-2211.720) (-2223.016) [-2210.270] (-2216.101) -- 0:03:48
260000 -- [-2198.644] (-2205.580) (-2206.934) (-2207.068) * (-2206.456) (-2210.182) [-2209.678] (-2223.393) -- 0:03:47
Average standard deviation of split frequencies: 0.010076
260500 -- (-2201.904) (-2205.645) [-2207.341] (-2210.134) * (-2204.940) [-2208.785] (-2224.341) (-2217.050) -- 0:03:49
261000 -- (-2213.792) (-2218.012) [-2206.116] (-2210.231) * [-2204.537] (-2211.817) (-2207.048) (-2206.375) -- 0:03:49
261500 -- (-2210.803) (-2207.105) [-2207.365] (-2204.694) * (-2206.006) (-2211.315) (-2206.918) [-2209.793] -- 0:03:48
262000 -- (-2205.755) [-2210.888] (-2208.873) (-2214.630) * (-2229.344) (-2205.614) [-2207.179] (-2216.078) -- 0:03:48
262500 -- [-2210.745] (-2216.200) (-2217.011) (-2214.862) * [-2212.503] (-2204.362) (-2207.686) (-2217.558) -- 0:03:47
263000 -- [-2216.784] (-2217.799) (-2209.623) (-2214.909) * (-2210.301) [-2203.298] (-2206.667) (-2217.131) -- 0:03:46
263500 -- (-2213.373) [-2208.708] (-2226.082) (-2209.324) * (-2211.822) [-2207.910] (-2215.116) (-2221.634) -- 0:03:49
264000 -- (-2214.260) (-2219.985) (-2216.685) [-2210.948] * (-2219.006) [-2208.822] (-2206.742) (-2211.978) -- 0:03:48
264500 -- (-2218.065) (-2217.999) (-2206.816) [-2204.485] * (-2212.641) [-2208.545] (-2211.460) (-2219.483) -- 0:03:48
265000 -- (-2209.750) (-2215.569) (-2210.379) [-2200.602] * (-2212.937) [-2209.001] (-2203.348) (-2211.397) -- 0:03:47
Average standard deviation of split frequencies: 0.011646
265500 -- (-2211.533) (-2211.558) [-2203.726] (-2214.625) * [-2210.325] (-2221.966) (-2216.921) (-2222.752) -- 0:03:46
266000 -- (-2214.272) (-2211.247) [-2218.955] (-2211.395) * (-2215.747) [-2207.356] (-2204.793) (-2220.580) -- 0:03:46
266500 -- (-2209.182) [-2214.337] (-2211.568) (-2217.039) * (-2218.781) (-2217.712) (-2208.689) [-2209.760] -- 0:03:45
267000 -- (-2206.457) (-2202.738) (-2202.855) [-2212.046] * (-2211.723) (-2214.904) (-2213.896) [-2208.812] -- 0:03:47
267500 -- (-2212.534) (-2219.250) (-2211.646) [-2204.683] * (-2218.028) (-2219.874) (-2208.378) [-2214.835] -- 0:03:47
268000 -- (-2209.744) (-2223.863) [-2211.620] (-2210.459) * (-2217.540) (-2220.789) [-2211.453] (-2202.864) -- 0:03:46
268500 -- [-2203.575] (-2206.304) (-2212.895) (-2209.717) * (-2213.876) (-2219.767) [-2218.067] (-2219.869) -- 0:03:46
269000 -- (-2212.689) (-2204.423) (-2214.551) [-2212.433] * (-2208.051) (-2213.235) [-2213.735] (-2206.231) -- 0:03:45
269500 -- (-2207.252) [-2205.017] (-2212.081) (-2219.425) * (-2201.775) (-2228.377) [-2205.873] (-2216.882) -- 0:03:44
270000 -- (-2214.032) (-2217.413) (-2219.554) [-2204.292] * (-2214.681) (-2220.462) (-2219.719) [-2206.509] -- 0:03:44
Average standard deviation of split frequencies: 0.010699
270500 -- [-2218.814] (-2216.050) (-2207.964) (-2204.956) * (-2214.808) [-2211.349] (-2206.472) (-2211.996) -- 0:03:43
271000 -- (-2216.891) (-2214.952) [-2210.263] (-2205.381) * [-2217.471] (-2219.412) (-2210.955) (-2214.104) -- 0:03:45
271500 -- (-2206.435) (-2206.950) (-2206.368) [-2200.606] * (-2211.181) (-2228.674) [-2207.018] (-2212.308) -- 0:03:45
272000 -- (-2209.326) [-2200.668] (-2225.702) (-2230.277) * (-2206.332) (-2220.190) [-2204.548] (-2203.781) -- 0:03:44
272500 -- (-2205.663) (-2213.102) (-2225.975) [-2200.573] * [-2207.841] (-2211.231) (-2209.689) (-2204.778) -- 0:03:44
273000 -- [-2214.499] (-2214.427) (-2210.814) (-2209.302) * (-2212.142) (-2226.534) (-2210.540) [-2205.515] -- 0:03:43
273500 -- (-2221.931) (-2207.984) (-2213.504) [-2208.002] * (-2217.553) [-2215.249] (-2222.131) (-2205.451) -- 0:03:43
274000 -- (-2225.859) (-2215.516) (-2214.686) [-2211.444] * [-2208.041] (-2220.894) (-2232.678) (-2207.973) -- 0:03:42
274500 -- [-2207.769] (-2218.862) (-2218.242) (-2222.398) * (-2212.508) [-2205.282] (-2205.252) (-2222.026) -- 0:03:44
275000 -- (-2213.890) (-2219.996) (-2211.787) [-2205.698] * (-2210.807) (-2207.962) [-2204.494] (-2216.439) -- 0:03:44
Average standard deviation of split frequencies: 0.011102
275500 -- (-2218.739) (-2206.886) (-2209.831) [-2215.051] * (-2219.078) (-2213.220) (-2214.934) [-2209.182] -- 0:03:43
276000 -- (-2209.031) (-2222.478) (-2212.421) [-2202.605] * (-2231.567) (-2207.009) [-2206.758] (-2212.453) -- 0:03:42
276500 -- [-2203.533] (-2226.359) (-2213.859) (-2213.124) * (-2215.838) (-2213.871) [-2212.398] (-2206.848) -- 0:03:42
277000 -- (-2209.337) (-2236.582) [-2205.828] (-2206.870) * (-2220.983) (-2216.882) [-2209.653] (-2217.240) -- 0:03:41
277500 -- (-2221.660) (-2221.743) (-2209.076) [-2208.287] * [-2206.133] (-2214.258) (-2211.689) (-2218.313) -- 0:03:41
278000 -- (-2207.048) [-2208.182] (-2211.718) (-2206.868) * [-2211.965] (-2204.929) (-2212.945) (-2215.396) -- 0:03:43
278500 -- [-2206.990] (-2219.335) (-2216.735) (-2215.411) * (-2210.482) [-2211.563] (-2222.849) (-2214.047) -- 0:03:42
279000 -- [-2207.496] (-2220.051) (-2220.722) (-2213.222) * (-2219.649) (-2209.414) [-2208.640] (-2205.292) -- 0:03:42
279500 -- (-2207.055) [-2213.576] (-2214.057) (-2210.862) * (-2218.288) (-2219.127) (-2207.926) [-2207.669] -- 0:03:41
280000 -- (-2208.889) (-2213.753) [-2201.991] (-2213.054) * (-2215.633) (-2213.949) [-2211.551] (-2199.876) -- 0:03:41
Average standard deviation of split frequencies: 0.010917
280500 -- (-2207.772) (-2208.862) [-2212.244] (-2209.591) * (-2216.548) [-2221.843] (-2215.022) (-2216.519) -- 0:03:40
281000 -- [-2206.366] (-2218.783) (-2218.269) (-2215.172) * [-2204.749] (-2210.330) (-2211.380) (-2217.154) -- 0:03:40
281500 -- (-2206.888) (-2209.277) (-2219.552) [-2208.864] * (-2208.787) (-2216.925) [-2207.188] (-2225.543) -- 0:03:42
282000 -- (-2210.260) (-2211.029) [-2209.247] (-2209.911) * [-2208.081] (-2217.752) (-2208.762) (-2231.238) -- 0:03:41
282500 -- (-2211.254) (-2211.076) (-2215.246) [-2209.892] * (-2202.626) (-2221.023) [-2205.458] (-2220.185) -- 0:03:40
283000 -- (-2209.834) (-2217.612) (-2212.015) [-2215.812] * (-2211.097) (-2213.469) (-2211.095) [-2205.485] -- 0:03:40
283500 -- [-2211.304] (-2206.536) (-2220.126) (-2218.799) * (-2209.356) (-2214.280) [-2200.461] (-2208.853) -- 0:03:39
284000 -- (-2212.055) [-2209.689] (-2216.688) (-2214.262) * (-2210.589) [-2209.470] (-2214.021) (-2231.439) -- 0:03:39
284500 -- (-2211.855) (-2216.492) [-2210.324] (-2222.838) * (-2206.236) [-2212.422] (-2209.858) (-2212.493) -- 0:03:38
285000 -- (-2207.819) (-2216.701) [-2212.829] (-2205.327) * (-2215.874) (-2206.987) [-2208.099] (-2215.464) -- 0:03:40
Average standard deviation of split frequencies: 0.009301
285500 -- [-2209.405] (-2215.568) (-2216.833) (-2221.147) * (-2209.038) (-2204.223) (-2206.980) [-2203.209] -- 0:03:40
286000 -- (-2206.768) [-2199.851] (-2216.802) (-2217.725) * (-2216.165) (-2221.169) [-2210.793] (-2210.617) -- 0:03:39
286500 -- [-2201.453] (-2208.934) (-2220.979) (-2212.150) * [-2220.419] (-2212.279) (-2207.536) (-2216.735) -- 0:03:39
287000 -- [-2205.643] (-2203.667) (-2213.507) (-2221.906) * (-2225.862) (-2212.188) [-2214.164] (-2211.302) -- 0:03:38
287500 -- (-2219.447) [-2200.888] (-2220.301) (-2211.740) * (-2221.653) (-2210.169) [-2205.905] (-2216.513) -- 0:03:38
288000 -- (-2222.553) (-2213.606) (-2218.834) [-2212.146] * (-2220.317) (-2229.708) (-2224.608) [-2204.484] -- 0:03:37
288500 -- (-2204.371) (-2217.643) (-2205.100) [-2210.012] * [-2210.532] (-2237.730) (-2209.550) (-2206.242) -- 0:03:39
289000 -- [-2202.789] (-2209.100) (-2210.255) (-2211.269) * [-2203.144] (-2220.165) (-2211.199) (-2213.036) -- 0:03:38
289500 -- (-2219.888) [-2214.705] (-2211.990) (-2217.618) * (-2206.299) [-2204.701] (-2222.500) (-2220.507) -- 0:03:38
290000 -- [-2204.972] (-2218.763) (-2204.652) (-2218.946) * (-2210.330) (-2205.290) [-2213.520] (-2221.963) -- 0:03:37
Average standard deviation of split frequencies: 0.008688
290500 -- (-2220.125) (-2210.042) [-2204.864] (-2222.008) * (-2218.113) (-2211.493) [-2217.466] (-2227.288) -- 0:03:37
291000 -- (-2205.334) [-2204.383] (-2212.268) (-2212.939) * [-2209.917] (-2231.531) (-2219.195) (-2211.927) -- 0:03:36
291500 -- (-2214.694) (-2206.691) (-2211.958) [-2208.273] * (-2205.412) [-2219.092] (-2222.737) (-2212.722) -- 0:03:36
292000 -- (-2211.312) (-2210.255) (-2212.347) [-2210.603] * (-2219.798) (-2215.001) (-2209.532) [-2206.003] -- 0:03:38
292500 -- (-2205.905) (-2212.183) (-2223.713) [-2205.805] * (-2214.088) (-2219.071) [-2209.637] (-2221.459) -- 0:03:37
293000 -- (-2207.735) [-2212.805] (-2216.880) (-2207.118) * (-2212.233) [-2211.942] (-2209.283) (-2228.598) -- 0:03:37
293500 -- (-2211.022) [-2205.732] (-2235.490) (-2207.418) * [-2213.085] (-2214.632) (-2210.107) (-2219.585) -- 0:03:36
294000 -- (-2213.002) (-2216.620) [-2221.491] (-2223.901) * (-2207.578) [-2212.006] (-2206.804) (-2215.291) -- 0:03:36
294500 -- (-2206.782) [-2202.237] (-2209.710) (-2209.790) * (-2205.061) (-2219.857) [-2212.794] (-2219.898) -- 0:03:35
295000 -- (-2212.765) (-2214.139) (-2218.957) [-2206.187] * (-2213.941) (-2225.131) [-2214.485] (-2229.647) -- 0:03:35
Average standard deviation of split frequencies: 0.010011
295500 -- [-2206.771] (-2203.902) (-2213.784) (-2212.523) * (-2215.138) [-2205.113] (-2205.616) (-2213.615) -- 0:03:36
296000 -- (-2212.960) (-2220.528) [-2209.518] (-2209.758) * [-2209.889] (-2219.448) (-2206.546) (-2209.228) -- 0:03:36
296500 -- (-2203.665) (-2214.762) [-2209.076] (-2215.939) * (-2222.157) [-2209.048] (-2204.038) (-2206.799) -- 0:03:35
297000 -- [-2209.411] (-2216.242) (-2209.677) (-2205.798) * [-2212.461] (-2210.199) (-2214.313) (-2213.831) -- 0:03:35
297500 -- (-2215.460) (-2215.667) [-2205.626] (-2208.954) * (-2213.635) (-2215.629) (-2207.202) [-2208.219] -- 0:03:34
298000 -- (-2225.087) (-2212.213) [-2204.635] (-2212.980) * (-2221.348) [-2206.768] (-2207.032) (-2219.152) -- 0:03:34
298500 -- (-2210.042) (-2208.132) (-2218.564) [-2213.472] * (-2222.200) [-2205.675] (-2222.460) (-2211.434) -- 0:03:33
299000 -- [-2207.210] (-2215.059) (-2220.147) (-2209.965) * (-2217.716) [-2201.674] (-2216.666) (-2215.105) -- 0:03:33
299500 -- (-2206.604) [-2203.565] (-2215.236) (-2217.111) * (-2208.599) [-2216.696] (-2207.652) (-2219.750) -- 0:03:35
300000 -- (-2216.526) (-2210.753) [-2211.693] (-2219.267) * (-2206.701) (-2227.246) [-2203.956] (-2207.329) -- 0:03:34
Average standard deviation of split frequencies: 0.010639
300500 -- [-2210.652] (-2210.692) (-2223.780) (-2221.421) * (-2204.674) (-2207.731) [-2199.743] (-2203.955) -- 0:03:34
301000 -- [-2208.263] (-2210.454) (-2209.451) (-2214.219) * (-2215.379) [-2212.156] (-2218.899) (-2200.904) -- 0:03:33
301500 -- (-2208.876) [-2202.745] (-2222.328) (-2216.280) * (-2207.325) (-2210.773) (-2206.053) [-2209.341] -- 0:03:33
302000 -- (-2215.303) [-2205.893] (-2214.212) (-2213.838) * (-2205.240) (-2202.682) [-2210.105] (-2203.730) -- 0:03:32
302500 -- (-2217.952) (-2215.499) (-2221.465) [-2207.422] * [-2207.728] (-2219.231) (-2221.534) (-2229.635) -- 0:03:34
303000 -- (-2205.193) (-2219.389) [-2208.420] (-2212.967) * [-2205.194] (-2205.381) (-2216.077) (-2207.602) -- 0:03:33
303500 -- (-2223.281) [-2213.916] (-2205.646) (-2213.039) * [-2206.005] (-2211.521) (-2215.495) (-2201.062) -- 0:03:33
304000 -- (-2205.638) (-2214.587) [-2204.960] (-2218.223) * (-2229.418) [-2203.839] (-2210.938) (-2218.512) -- 0:03:32
304500 -- (-2205.206) [-2202.497] (-2214.824) (-2220.224) * (-2206.703) (-2211.162) (-2215.354) [-2208.488] -- 0:03:32
305000 -- (-2215.076) (-2207.927) (-2209.272) [-2210.985] * (-2211.559) (-2209.116) (-2206.296) [-2209.646] -- 0:03:34
Average standard deviation of split frequencies: 0.011004
305500 -- (-2212.772) [-2203.367] (-2223.215) (-2206.969) * (-2215.168) (-2213.110) [-2219.260] (-2211.220) -- 0:03:33
306000 -- (-2199.906) [-2206.435] (-2204.851) (-2219.135) * (-2223.017) [-2206.595] (-2207.236) (-2220.093) -- 0:03:33
306500 -- (-2228.033) (-2233.324) (-2203.656) [-2210.630] * [-2219.494] (-2215.115) (-2213.940) (-2208.587) -- 0:03:32
307000 -- (-2218.102) [-2214.754] (-2206.377) (-2216.412) * (-2214.602) (-2220.223) (-2213.666) [-2201.158] -- 0:03:32
307500 -- (-2217.958) (-2210.232) [-2202.455] (-2218.038) * (-2210.842) (-2213.753) [-2209.807] (-2218.789) -- 0:03:31
308000 -- (-2221.591) (-2208.191) [-2206.846] (-2209.366) * [-2209.282] (-2231.051) (-2230.875) (-2218.815) -- 0:03:31
308500 -- (-2217.793) (-2213.776) (-2216.760) [-2210.079] * (-2213.775) [-2206.448] (-2207.348) (-2221.177) -- 0:03:32
309000 -- (-2211.811) (-2206.686) [-2201.946] (-2221.018) * (-2211.365) (-2212.699) [-2205.803] (-2218.309) -- 0:03:32
309500 -- (-2210.211) (-2215.843) [-2205.098] (-2217.872) * [-2218.678] (-2207.929) (-2220.699) (-2215.353) -- 0:03:31
310000 -- (-2218.948) (-2213.986) [-2203.827] (-2214.077) * (-2208.627) (-2218.120) [-2208.237] (-2228.069) -- 0:03:31
Average standard deviation of split frequencies: 0.010080
310500 -- (-2220.940) (-2215.963) [-2204.595] (-2217.796) * (-2209.891) (-2218.370) (-2215.617) [-2205.250] -- 0:03:30
311000 -- (-2222.341) (-2210.340) (-2206.153) [-2212.981] * (-2218.481) (-2209.629) (-2219.400) [-2207.630] -- 0:03:30
311500 -- (-2212.407) (-2212.219) (-2204.644) [-2206.309] * (-2207.502) [-2217.269] (-2210.488) (-2207.939) -- 0:03:29
312000 -- (-2210.564) (-2207.765) [-2211.523] (-2212.262) * (-2223.230) [-2214.945] (-2213.531) (-2217.519) -- 0:03:31
312500 -- (-2206.341) [-2201.279] (-2216.564) (-2214.418) * (-2215.643) [-2205.368] (-2206.509) (-2217.659) -- 0:03:31
313000 -- (-2222.375) [-2207.721] (-2222.432) (-2211.701) * [-2211.261] (-2217.759) (-2209.962) (-2210.255) -- 0:03:30
313500 -- (-2217.430) [-2215.595] (-2212.356) (-2214.000) * (-2217.495) (-2230.108) (-2206.746) [-2208.693] -- 0:03:30
314000 -- (-2200.249) (-2212.757) (-2215.061) [-2207.688] * [-2210.148] (-2210.792) (-2221.317) (-2203.831) -- 0:03:29
314500 -- (-2213.346) (-2217.268) (-2219.889) [-2216.338] * (-2202.591) (-2214.567) (-2214.450) [-2202.155] -- 0:03:29
315000 -- (-2215.087) (-2204.318) [-2213.424] (-2216.711) * (-2206.898) (-2214.220) (-2221.958) [-2202.032] -- 0:03:28
Average standard deviation of split frequencies: 0.009910
315500 -- [-2207.295] (-2214.679) (-2209.967) (-2221.478) * (-2207.017) (-2215.628) [-2216.454] (-2212.551) -- 0:03:30
316000 -- (-2213.126) [-2203.596] (-2211.406) (-2210.858) * [-2206.845] (-2216.378) (-2222.072) (-2216.182) -- 0:03:29
316500 -- (-2208.725) (-2206.087) [-2209.424] (-2234.593) * [-2209.584] (-2213.225) (-2221.312) (-2213.852) -- 0:03:29
317000 -- (-2216.622) [-2210.020] (-2217.760) (-2219.024) * (-2207.607) (-2216.732) [-2207.664] (-2210.954) -- 0:03:28
317500 -- (-2227.753) [-2209.791] (-2209.546) (-2207.689) * (-2215.292) (-2213.154) [-2209.407] (-2209.518) -- 0:03:28
318000 -- (-2218.540) (-2207.424) [-2216.652] (-2209.279) * (-2211.538) (-2212.581) (-2211.325) [-2213.337] -- 0:03:28
318500 -- (-2207.302) (-2218.292) [-2206.922] (-2208.854) * (-2206.473) (-2212.662) (-2219.634) [-2207.235] -- 0:03:27
319000 -- (-2212.551) (-2220.333) (-2218.252) [-2209.464] * (-2212.344) [-2217.936] (-2213.674) (-2212.633) -- 0:03:27
319500 -- (-2223.360) [-2206.499] (-2214.667) (-2209.155) * (-2227.677) (-2220.171) [-2214.901] (-2206.571) -- 0:03:28
320000 -- (-2214.228) (-2206.538) [-2209.448] (-2214.693) * (-2218.595) (-2228.212) [-2207.677] (-2209.621) -- 0:03:28
Average standard deviation of split frequencies: 0.010396
320500 -- [-2199.406] (-2217.678) (-2208.776) (-2206.043) * (-2218.659) [-2212.846] (-2218.711) (-2209.167) -- 0:03:27
321000 -- (-2217.285) (-2208.615) [-2216.969] (-2206.409) * [-2213.354] (-2221.488) (-2210.544) (-2212.952) -- 0:03:27
321500 -- (-2222.941) [-2214.168] (-2212.654) (-2212.421) * (-2203.328) [-2211.152] (-2224.482) (-2214.597) -- 0:03:26
322000 -- (-2212.307) (-2215.778) [-2200.149] (-2217.283) * (-2211.074) (-2209.507) (-2214.383) [-2212.037] -- 0:03:26
322500 -- [-2215.314] (-2213.911) (-2220.708) (-2217.869) * [-2220.958] (-2207.687) (-2221.671) (-2207.548) -- 0:03:25
323000 -- (-2209.749) [-2205.628] (-2210.407) (-2206.937) * [-2214.882] (-2207.838) (-2224.850) (-2204.124) -- 0:03:27
323500 -- (-2218.569) (-2219.079) (-2212.831) [-2205.257] * (-2210.873) [-2208.205] (-2219.222) (-2201.397) -- 0:03:27
324000 -- (-2223.144) [-2213.927] (-2211.132) (-2206.429) * [-2200.398] (-2211.773) (-2220.095) (-2208.978) -- 0:03:26
324500 -- [-2206.919] (-2207.001) (-2214.765) (-2210.600) * (-2209.934) (-2205.898) (-2231.471) [-2210.076] -- 0:03:26
325000 -- (-2214.057) (-2211.931) [-2208.632] (-2216.011) * (-2222.715) [-2206.871] (-2215.984) (-2208.514) -- 0:03:25
Average standard deviation of split frequencies: 0.010432
325500 -- (-2213.281) (-2203.340) (-2216.994) [-2202.963] * (-2209.080) [-2214.319] (-2217.265) (-2216.149) -- 0:03:25
326000 -- (-2209.706) [-2208.661] (-2206.845) (-2204.350) * (-2218.506) (-2207.358) (-2208.153) [-2210.896] -- 0:03:24
326500 -- (-2203.857) (-2209.583) (-2218.518) [-2200.363] * (-2232.594) [-2205.528] (-2221.009) (-2222.161) -- 0:03:26
327000 -- [-2214.530] (-2205.317) (-2228.782) (-2213.314) * (-2220.834) [-2217.493] (-2217.265) (-2213.060) -- 0:03:25
327500 -- (-2210.593) (-2213.222) (-2210.316) [-2209.052] * (-2213.349) (-2230.170) (-2208.013) [-2211.098] -- 0:03:25
328000 -- (-2215.791) (-2207.967) (-2211.031) [-2211.759] * (-2208.899) (-2211.838) (-2214.318) [-2205.780] -- 0:03:24
328500 -- (-2208.885) [-2219.958] (-2213.374) (-2210.085) * (-2207.963) (-2213.964) (-2208.885) [-2213.000] -- 0:03:24
329000 -- (-2208.348) (-2224.487) (-2207.274) [-2207.515] * (-2207.436) (-2211.259) [-2211.180] (-2207.694) -- 0:03:23
329500 -- (-2200.988) (-2223.879) [-2223.868] (-2211.896) * (-2224.554) [-2216.297] (-2211.659) (-2216.610) -- 0:03:23
330000 -- (-2209.849) [-2203.472] (-2207.290) (-2219.537) * (-2216.296) [-2203.572] (-2214.436) (-2233.188) -- 0:03:25
Average standard deviation of split frequencies: 0.011914
330500 -- [-2208.817] (-2235.600) (-2210.442) (-2211.234) * (-2212.507) (-2208.706) [-2215.682] (-2216.024) -- 0:03:24
331000 -- (-2203.316) (-2217.531) [-2205.494] (-2213.323) * [-2209.249] (-2211.880) (-2213.457) (-2206.969) -- 0:03:24
331500 -- (-2208.268) [-2205.998] (-2220.734) (-2215.820) * [-2202.198] (-2217.001) (-2204.394) (-2220.115) -- 0:03:23
332000 -- [-2205.673] (-2217.240) (-2215.687) (-2214.928) * [-2215.740] (-2214.973) (-2214.286) (-2212.418) -- 0:03:23
332500 -- [-2205.655] (-2205.673) (-2235.076) (-2213.058) * (-2215.601) [-2213.868] (-2216.805) (-2218.397) -- 0:03:22
333000 -- (-2203.887) (-2209.313) [-2201.617] (-2229.879) * (-2216.682) [-2202.118] (-2215.353) (-2213.506) -- 0:03:22
333500 -- (-2202.695) (-2212.363) [-2208.593] (-2216.545) * (-2236.179) (-2207.570) (-2210.206) [-2211.964] -- 0:03:23
334000 -- (-2203.893) (-2209.225) [-2204.964] (-2217.778) * [-2210.333] (-2204.900) (-2219.143) (-2202.910) -- 0:03:23
334500 -- (-2210.763) (-2218.024) (-2207.765) [-2205.673] * (-2216.765) (-2224.124) (-2216.843) [-2205.259] -- 0:03:22
335000 -- (-2211.580) [-2213.069] (-2210.178) (-2221.003) * (-2207.839) (-2211.573) [-2199.888] (-2212.265) -- 0:03:22
Average standard deviation of split frequencies: 0.011925
335500 -- (-2207.177) [-2216.982] (-2213.548) (-2217.201) * (-2222.038) (-2216.229) (-2211.175) [-2203.437] -- 0:03:22
336000 -- (-2216.660) [-2213.097] (-2208.315) (-2211.916) * (-2216.356) (-2213.091) (-2226.244) [-2203.721] -- 0:03:21
336500 -- [-2209.873] (-2216.497) (-2216.328) (-2209.708) * (-2214.356) (-2213.376) (-2216.067) [-2206.208] -- 0:03:21
337000 -- (-2207.489) [-2210.057] (-2212.792) (-2208.491) * (-2204.968) (-2203.561) [-2206.598] (-2208.873) -- 0:03:22
337500 -- (-2207.155) [-2216.036] (-2211.484) (-2211.059) * (-2211.029) [-2198.934] (-2208.261) (-2221.812) -- 0:03:22
338000 -- (-2211.638) (-2217.940) [-2202.811] (-2225.320) * [-2209.324] (-2215.310) (-2212.019) (-2213.047) -- 0:03:21
338500 -- (-2209.524) (-2210.953) (-2218.483) [-2215.045] * (-2223.042) [-2210.018] (-2214.970) (-2213.670) -- 0:03:21
339000 -- (-2207.651) [-2207.096] (-2220.618) (-2219.730) * (-2232.159) (-2208.403) [-2207.559] (-2215.025) -- 0:03:20
339500 -- [-2203.337] (-2216.860) (-2223.754) (-2220.473) * (-2211.186) [-2207.965] (-2213.885) (-2213.236) -- 0:03:20
340000 -- (-2202.674) (-2218.764) (-2218.150) [-2205.705] * (-2204.941) [-2212.192] (-2208.344) (-2224.003) -- 0:03:19
Average standard deviation of split frequencies: 0.011960
340500 -- [-2220.647] (-2215.138) (-2209.221) (-2209.551) * (-2214.770) (-2202.036) (-2211.321) [-2208.541] -- 0:03:21
341000 -- (-2218.594) (-2227.325) [-2214.843] (-2214.233) * (-2212.150) (-2218.912) [-2206.400] (-2228.061) -- 0:03:20
341500 -- (-2216.418) (-2222.830) [-2211.063] (-2211.735) * (-2210.100) (-2218.576) [-2212.091] (-2208.612) -- 0:03:20
342000 -- (-2214.107) [-2205.438] (-2225.439) (-2213.273) * (-2217.279) (-2211.773) (-2208.865) [-2212.797] -- 0:03:20
342500 -- (-2214.651) (-2217.851) (-2206.695) [-2210.502] * (-2214.464) (-2216.484) (-2208.006) [-2214.179] -- 0:03:19
343000 -- (-2215.121) (-2217.107) (-2207.453) [-2206.896] * [-2206.311] (-2231.303) (-2212.613) (-2229.617) -- 0:03:19
343500 -- (-2216.528) (-2212.535) (-2215.658) [-2215.846] * [-2207.349] (-2212.073) (-2215.995) (-2203.158) -- 0:03:18
344000 -- (-2209.529) (-2227.029) (-2208.998) [-2211.330] * (-2213.951) (-2227.389) (-2225.530) [-2207.931] -- 0:03:20
344500 -- [-2210.500] (-2219.385) (-2206.065) (-2217.558) * (-2208.306) (-2222.942) (-2223.507) [-2216.384] -- 0:03:19
345000 -- [-2214.388] (-2222.165) (-2215.484) (-2219.104) * (-2208.479) (-2220.122) (-2228.813) [-2208.390] -- 0:03:19
Average standard deviation of split frequencies: 0.012165
345500 -- (-2211.636) (-2207.907) (-2224.813) [-2207.664] * (-2217.526) (-2211.101) [-2210.915] (-2217.607) -- 0:03:18
346000 -- (-2215.985) [-2214.104] (-2225.126) (-2206.600) * (-2223.991) (-2218.793) (-2218.836) [-2212.093] -- 0:03:18
346500 -- (-2212.475) (-2208.138) (-2215.411) [-2205.380] * [-2213.160] (-2217.641) (-2215.381) (-2222.570) -- 0:03:18
347000 -- [-2212.234] (-2213.924) (-2210.379) (-2214.853) * (-2210.505) (-2210.506) [-2213.094] (-2218.664) -- 0:03:17
347500 -- [-2199.518] (-2212.527) (-2213.104) (-2211.247) * (-2206.344) (-2218.805) (-2212.271) [-2215.048] -- 0:03:19
348000 -- [-2207.454] (-2209.543) (-2211.795) (-2206.180) * (-2206.626) [-2205.683] (-2210.133) (-2225.848) -- 0:03:18
348500 -- (-2213.029) [-2209.644] (-2215.032) (-2211.590) * (-2215.274) (-2211.851) (-2216.342) [-2211.850] -- 0:03:18
349000 -- (-2231.266) (-2208.840) [-2208.219] (-2216.360) * (-2207.002) [-2212.118] (-2211.322) (-2204.860) -- 0:03:17
349500 -- (-2232.468) [-2212.220] (-2208.919) (-2222.867) * (-2214.578) (-2215.613) (-2208.856) [-2208.654] -- 0:03:17
350000 -- (-2225.408) (-2219.117) (-2210.287) [-2215.047] * (-2217.458) (-2221.706) (-2206.727) [-2209.513] -- 0:03:16
Average standard deviation of split frequencies: 0.011331
350500 -- (-2212.427) (-2205.390) (-2214.749) [-2208.356] * (-2226.898) [-2210.097] (-2207.771) (-2206.289) -- 0:03:16
351000 -- [-2219.240] (-2210.475) (-2227.507) (-2204.795) * (-2214.513) [-2218.842] (-2199.079) (-2217.379) -- 0:03:17
351500 -- (-2217.269) (-2219.518) (-2218.263) [-2210.523] * (-2216.165) (-2212.798) [-2200.010] (-2215.168) -- 0:03:17
352000 -- (-2209.813) (-2224.598) [-2204.417] (-2207.472) * (-2210.733) [-2203.715] (-2217.492) (-2219.855) -- 0:03:16
352500 -- (-2210.252) (-2218.885) [-2213.639] (-2213.223) * (-2215.557) (-2211.859) [-2215.744] (-2224.529) -- 0:03:16
353000 -- (-2221.423) (-2228.684) [-2205.935] (-2212.847) * [-2206.093] (-2218.239) (-2213.735) (-2210.642) -- 0:03:16
353500 -- (-2212.399) (-2209.539) [-2209.221] (-2229.923) * [-2218.772] (-2225.392) (-2219.357) (-2212.500) -- 0:03:15
354000 -- [-2211.039] (-2208.847) (-2214.627) (-2221.119) * (-2216.938) [-2209.890] (-2209.260) (-2209.692) -- 0:03:15
354500 -- (-2219.013) [-2207.659] (-2213.435) (-2234.177) * (-2208.514) (-2212.112) (-2205.977) [-2199.498] -- 0:03:14
355000 -- (-2231.066) (-2214.942) [-2208.574] (-2237.082) * (-2215.265) (-2218.301) (-2210.168) [-2206.162] -- 0:03:16
Average standard deviation of split frequencies: 0.012674
355500 -- (-2211.258) [-2211.424] (-2212.597) (-2241.088) * [-2204.975] (-2207.908) (-2219.285) (-2211.315) -- 0:03:15
356000 -- (-2213.512) (-2205.895) [-2202.964] (-2232.190) * (-2220.593) [-2210.953] (-2214.003) (-2216.130) -- 0:03:15
356500 -- (-2213.845) (-2206.059) (-2207.364) [-2221.382] * (-2215.051) [-2204.636] (-2207.174) (-2214.106) -- 0:03:14
357000 -- (-2213.778) (-2215.926) [-2215.556] (-2223.657) * (-2213.301) [-2203.714] (-2213.631) (-2204.162) -- 0:03:14
357500 -- [-2216.701] (-2209.531) (-2215.960) (-2223.166) * (-2205.673) [-2213.208] (-2210.390) (-2208.759) -- 0:03:14
358000 -- [-2204.529] (-2209.132) (-2207.585) (-2215.243) * (-2206.799) (-2215.002) (-2214.524) [-2208.056] -- 0:03:15
358500 -- (-2219.744) (-2207.639) (-2212.163) [-2210.792] * (-2223.198) (-2208.533) (-2230.924) [-2202.613] -- 0:03:15
359000 -- (-2214.331) (-2207.602) [-2209.744] (-2210.127) * (-2215.884) (-2224.580) (-2221.325) [-2210.165] -- 0:03:14
359500 -- [-2209.208] (-2215.538) (-2220.596) (-2214.826) * [-2210.132] (-2219.314) (-2213.348) (-2222.874) -- 0:03:14
360000 -- (-2217.402) (-2203.166) [-2210.914] (-2204.809) * (-2206.901) (-2218.281) (-2207.561) [-2215.501] -- 0:03:15
Average standard deviation of split frequencies: 0.012790
360500 -- [-2203.992] (-2212.714) (-2209.671) (-2208.744) * [-2213.330] (-2222.682) (-2212.293) (-2211.283) -- 0:03:15
361000 -- [-2202.047] (-2213.081) (-2234.343) (-2206.964) * [-2212.651] (-2219.701) (-2207.930) (-2215.938) -- 0:03:14
361500 -- [-2204.789] (-2223.426) (-2224.464) (-2220.024) * (-2208.395) [-2207.424] (-2211.576) (-2218.059) -- 0:03:14
362000 -- (-2212.755) (-2211.644) (-2217.303) [-2211.990] * (-2211.733) [-2202.758] (-2215.207) (-2223.932) -- 0:03:13
362500 -- (-2213.897) (-2214.812) [-2211.297] (-2218.698) * (-2217.816) (-2211.046) [-2205.519] (-2219.668) -- 0:03:15
363000 -- (-2229.098) [-2210.234] (-2209.828) (-2215.330) * (-2203.990) (-2208.662) [-2210.187] (-2218.613) -- 0:03:14
363500 -- (-2203.256) [-2211.307] (-2216.420) (-2214.883) * (-2212.796) [-2206.989] (-2224.139) (-2221.973) -- 0:03:14
364000 -- (-2208.745) [-2211.789] (-2222.528) (-2208.067) * [-2199.880] (-2216.419) (-2212.758) (-2213.549) -- 0:03:13
364500 -- [-2206.214] (-2222.072) (-2204.860) (-2211.981) * (-2215.050) (-2212.811) (-2214.833) [-2203.087] -- 0:03:13
365000 -- (-2212.442) (-2212.331) (-2225.507) [-2205.450] * (-2213.169) (-2205.848) [-2211.951] (-2203.461) -- 0:03:14
Average standard deviation of split frequencies: 0.013340
365500 -- (-2206.878) [-2208.612] (-2212.025) (-2209.754) * (-2224.600) (-2211.952) [-2207.797] (-2210.757) -- 0:03:14
366000 -- (-2216.908) (-2213.422) (-2222.924) [-2214.452] * (-2218.235) (-2219.516) [-2207.404] (-2212.533) -- 0:03:14
366500 -- (-2217.590) (-2220.472) (-2216.718) [-2210.264] * [-2210.072] (-2211.052) (-2204.213) (-2220.284) -- 0:03:13
367000 -- (-2214.915) [-2209.308] (-2223.173) (-2207.950) * [-2201.635] (-2217.451) (-2208.779) (-2207.788) -- 0:03:13
367500 -- [-2204.097] (-2209.416) (-2213.738) (-2202.781) * (-2211.337) [-2204.336] (-2204.882) (-2216.599) -- 0:03:12
368000 -- (-2202.301) [-2204.791] (-2223.472) (-2207.164) * (-2208.175) [-2202.741] (-2209.221) (-2224.364) -- 0:03:12
368500 -- (-2213.057) (-2211.921) [-2213.563] (-2219.672) * (-2204.970) (-2230.891) [-2205.691] (-2211.172) -- 0:03:13
369000 -- (-2216.876) (-2219.234) (-2206.269) [-2210.358] * (-2211.665) (-2224.452) [-2207.486] (-2221.057) -- 0:03:13
369500 -- (-2212.965) (-2218.362) (-2209.070) [-2200.787] * (-2217.811) [-2210.357] (-2204.918) (-2217.579) -- 0:03:12
370000 -- (-2204.615) (-2208.795) [-2206.697] (-2212.728) * (-2213.271) [-2209.702] (-2210.476) (-2213.791) -- 0:03:12
Average standard deviation of split frequencies: 0.011809
370500 -- (-2211.397) [-2213.278] (-2211.810) (-2211.882) * (-2212.582) (-2212.775) [-2215.902] (-2216.145) -- 0:03:11
371000 -- (-2208.602) [-2208.046] (-2211.183) (-2212.528) * [-2217.358] (-2206.723) (-2217.249) (-2216.705) -- 0:03:11
371500 -- (-2209.380) [-2209.595] (-2211.819) (-2209.176) * (-2207.038) [-2201.340] (-2208.843) (-2218.718) -- 0:03:12
372000 -- [-2214.097] (-2210.236) (-2214.868) (-2206.768) * (-2218.737) (-2203.807) (-2209.987) [-2205.456] -- 0:03:12
372500 -- (-2212.743) (-2220.778) (-2218.187) [-2213.755] * (-2210.894) (-2215.404) (-2207.172) [-2203.179] -- 0:03:12
373000 -- (-2215.117) (-2212.274) (-2219.239) [-2212.079] * (-2213.461) (-2212.185) [-2204.326] (-2210.301) -- 0:03:11
373500 -- [-2210.795] (-2219.371) (-2217.172) (-2207.184) * (-2217.745) [-2208.744] (-2211.629) (-2206.755) -- 0:03:11
374000 -- (-2217.689) (-2220.843) (-2211.758) [-2207.211] * [-2206.610] (-2220.463) (-2217.091) (-2204.799) -- 0:03:12
374500 -- (-2211.259) [-2207.032] (-2208.987) (-2210.039) * (-2219.509) (-2212.155) (-2214.127) [-2207.987] -- 0:03:12
375000 -- (-2208.688) [-2218.846] (-2201.626) (-2224.180) * [-2211.493] (-2220.848) (-2216.807) (-2208.907) -- 0:03:11
Average standard deviation of split frequencies: 0.014149
375500 -- (-2206.108) [-2215.951] (-2218.089) (-2207.995) * [-2202.339] (-2229.998) (-2211.995) (-2215.907) -- 0:03:11
376000 -- (-2211.009) (-2219.279) [-2209.197] (-2206.681) * [-2209.036] (-2220.844) (-2209.139) (-2222.336) -- 0:03:10
376500 -- (-2213.383) (-2217.043) (-2206.724) [-2211.175] * (-2216.059) (-2227.588) [-2208.061] (-2215.591) -- 0:03:10
377000 -- [-2216.141] (-2215.225) (-2207.761) (-2212.085) * (-2221.336) (-2226.737) [-2207.690] (-2211.739) -- 0:03:10
377500 -- (-2212.054) (-2210.702) [-2206.443] (-2221.911) * (-2209.837) (-2225.216) [-2213.597] (-2213.076) -- 0:03:11
378000 -- (-2217.086) (-2222.017) (-2206.214) [-2209.652] * [-2215.849] (-2214.872) (-2205.531) (-2209.834) -- 0:03:10
378500 -- [-2204.591] (-2208.948) (-2219.546) (-2218.446) * (-2205.553) [-2210.549] (-2212.437) (-2212.940) -- 0:03:10
379000 -- (-2216.132) (-2210.769) [-2209.255] (-2207.634) * (-2209.131) (-2208.678) [-2212.800] (-2221.484) -- 0:03:10
379500 -- [-2210.487] (-2219.080) (-2215.234) (-2207.942) * (-2211.417) (-2210.493) [-2214.355] (-2212.455) -- 0:03:09
380000 -- (-2207.341) (-2211.407) (-2222.220) [-2210.709] * [-2214.091] (-2216.406) (-2211.652) (-2219.236) -- 0:03:09
Average standard deviation of split frequencies: 0.012826
380500 -- (-2210.892) (-2220.670) (-2214.718) [-2211.024] * (-2203.843) (-2220.690) (-2217.492) [-2206.915] -- 0:03:10
381000 -- [-2210.054] (-2230.305) (-2217.564) (-2206.496) * (-2210.547) [-2206.866] (-2219.673) (-2212.784) -- 0:03:10
381500 -- [-2201.083] (-2224.122) (-2213.234) (-2215.692) * [-2209.636] (-2219.445) (-2214.271) (-2203.989) -- 0:03:09
382000 -- [-2202.765] (-2214.510) (-2201.880) (-2216.359) * (-2210.974) (-2226.252) [-2213.468] (-2210.102) -- 0:03:09
382500 -- (-2211.848) [-2215.935] (-2212.447) (-2228.164) * (-2214.102) (-2219.461) [-2210.346] (-2206.866) -- 0:03:08
383000 -- (-2207.010) [-2217.446] (-2211.342) (-2199.018) * [-2206.342] (-2213.767) (-2207.440) (-2202.360) -- 0:03:10
383500 -- [-2207.381] (-2217.883) (-2208.237) (-2213.650) * (-2209.368) (-2209.051) (-2216.716) [-2206.039] -- 0:03:09
384000 -- (-2207.331) (-2214.914) [-2207.640] (-2208.380) * (-2218.999) (-2221.583) [-2213.439] (-2205.229) -- 0:03:09
384500 -- (-2215.939) (-2213.487) (-2219.799) [-2210.225] * (-2210.099) (-2221.916) [-2209.387] (-2211.659) -- 0:03:08
385000 -- (-2213.159) (-2211.872) (-2216.937) [-2207.373] * [-2219.951] (-2217.923) (-2219.571) (-2211.364) -- 0:03:08
Average standard deviation of split frequencies: 0.012387
385500 -- (-2214.128) [-2203.564] (-2224.990) (-2212.272) * (-2211.865) (-2206.773) (-2227.573) [-2219.433] -- 0:03:08
386000 -- (-2213.844) [-2207.338] (-2223.003) (-2220.766) * [-2212.178] (-2207.743) (-2214.139) (-2207.772) -- 0:03:07
386500 -- (-2224.032) [-2203.540] (-2224.299) (-2213.896) * (-2208.617) (-2222.075) [-2210.093] (-2209.279) -- 0:03:08
387000 -- (-2218.489) [-2210.366] (-2218.363) (-2210.079) * (-2210.093) [-2207.869] (-2209.189) (-2209.228) -- 0:03:08
387500 -- (-2218.225) (-2208.598) (-2216.986) [-2203.518] * (-2209.548) [-2215.240] (-2214.406) (-2213.415) -- 0:03:08
388000 -- [-2210.025] (-2213.487) (-2213.088) (-2208.370) * [-2208.512] (-2229.392) (-2209.001) (-2221.192) -- 0:03:07
388500 -- (-2224.537) [-2208.941] (-2212.809) (-2209.349) * (-2212.363) [-2210.159] (-2219.468) (-2210.532) -- 0:03:07
389000 -- (-2221.880) (-2209.022) (-2216.603) [-2214.548] * [-2209.090] (-2207.611) (-2212.426) (-2206.572) -- 0:03:06
389500 -- (-2214.030) (-2204.973) (-2222.100) [-2209.566] * (-2208.107) (-2221.433) (-2204.715) [-2211.637] -- 0:03:06
390000 -- (-2217.721) [-2213.517] (-2207.917) (-2210.378) * [-2205.974] (-2215.874) (-2214.561) (-2234.460) -- 0:03:07
Average standard deviation of split frequencies: 0.011808
390500 -- (-2214.734) [-2210.395] (-2212.302) (-2213.856) * (-2213.216) (-2207.685) (-2216.189) [-2211.338] -- 0:03:07
391000 -- (-2211.544) [-2208.403] (-2215.140) (-2216.305) * (-2200.242) (-2214.712) (-2213.778) [-2204.268] -- 0:03:06
391500 -- (-2216.157) (-2207.024) (-2215.758) [-2209.420] * (-2219.602) (-2213.438) (-2213.754) [-2206.713] -- 0:03:06
392000 -- (-2219.810) (-2218.399) [-2215.552] (-2213.175) * [-2209.203] (-2201.263) (-2214.686) (-2202.794) -- 0:03:06
392500 -- (-2208.016) (-2220.435) [-2218.750] (-2206.547) * [-2210.716] (-2209.438) (-2214.668) (-2203.353) -- 0:03:05
393000 -- [-2208.477] (-2210.040) (-2215.512) (-2209.015) * (-2217.620) [-2211.159] (-2214.847) (-2209.656) -- 0:03:06
393500 -- [-2206.977] (-2216.729) (-2218.376) (-2205.977) * (-2206.511) (-2219.759) (-2216.223) [-2210.342] -- 0:03:06
394000 -- [-2214.989] (-2221.808) (-2221.574) (-2212.255) * (-2221.544) [-2199.014] (-2209.257) (-2211.307) -- 0:03:06
394500 -- (-2215.042) (-2225.532) [-2208.431] (-2215.490) * (-2214.437) [-2198.412] (-2224.048) (-2214.309) -- 0:03:05
395000 -- (-2223.433) (-2213.364) (-2204.642) [-2206.897] * (-2205.207) [-2203.125] (-2211.634) (-2214.978) -- 0:03:05
Average standard deviation of split frequencies: 0.013095
395500 -- (-2226.382) [-2207.868] (-2206.230) (-2204.409) * (-2211.289) [-2204.803] (-2223.505) (-2210.711) -- 0:03:06
396000 -- (-2215.334) (-2212.578) [-2208.371] (-2209.027) * (-2219.783) [-2201.514] (-2210.405) (-2210.913) -- 0:03:06
396500 -- (-2216.547) [-2216.794] (-2209.282) (-2214.760) * (-2220.614) (-2219.083) [-2209.144] (-2204.996) -- 0:03:05
397000 -- (-2214.796) (-2212.197) [-2203.077] (-2200.945) * (-2221.775) (-2217.502) [-2217.963] (-2209.983) -- 0:03:05
397500 -- (-2224.787) (-2211.388) [-2204.880] (-2221.897) * (-2213.231) (-2211.844) [-2202.312] (-2213.947) -- 0:03:04
398000 -- (-2217.343) (-2212.021) (-2209.694) [-2213.081] * (-2225.245) (-2210.238) (-2208.634) [-2205.754] -- 0:03:04
398500 -- (-2227.562) (-2228.872) [-2206.457] (-2204.299) * [-2207.871] (-2214.559) (-2214.429) (-2220.820) -- 0:03:05
399000 -- (-2223.859) (-2221.725) [-2206.930] (-2207.198) * [-2205.039] (-2211.828) (-2203.267) (-2213.823) -- 0:03:05
399500 -- (-2212.412) [-2209.957] (-2205.740) (-2216.238) * [-2214.528] (-2213.686) (-2210.841) (-2208.906) -- 0:03:04
400000 -- [-2204.080] (-2210.560) (-2209.217) (-2214.519) * (-2221.325) (-2214.296) [-2206.429] (-2204.897) -- 0:03:04
Average standard deviation of split frequencies: 0.012522
400500 -- [-2204.036] (-2210.053) (-2211.225) (-2217.334) * (-2212.307) (-2209.980) (-2204.751) [-2216.296] -- 0:03:05
401000 -- (-2205.058) (-2207.243) [-2211.762] (-2209.991) * [-2209.338] (-2204.526) (-2219.103) (-2221.096) -- 0:03:05
401500 -- [-2208.568] (-2217.700) (-2207.979) (-2215.696) * (-2207.475) [-2205.001] (-2214.318) (-2223.154) -- 0:03:04
402000 -- (-2222.183) [-2212.084] (-2222.894) (-2216.300) * (-2213.561) (-2231.185) [-2216.541] (-2212.564) -- 0:03:04
402500 -- (-2217.260) [-2211.638] (-2216.651) (-2224.357) * [-2213.080] (-2225.715) (-2201.234) (-2207.996) -- 0:03:04
403000 -- [-2207.282] (-2211.905) (-2216.749) (-2235.924) * (-2211.255) [-2201.903] (-2211.227) (-2211.635) -- 0:03:05
403500 -- [-2202.413] (-2207.394) (-2202.359) (-2228.907) * (-2217.699) (-2208.747) [-2206.590] (-2222.320) -- 0:03:04
404000 -- (-2220.438) (-2213.488) (-2203.236) [-2215.202] * (-2220.754) (-2202.841) (-2223.310) [-2210.594] -- 0:03:04
404500 -- [-2211.790] (-2212.851) (-2207.522) (-2221.657) * [-2203.265] (-2212.429) (-2212.665) (-2199.901) -- 0:03:04
405000 -- (-2206.209) (-2219.797) (-2217.730) [-2208.354] * (-2217.330) (-2212.778) [-2215.128] (-2217.304) -- 0:03:03
Average standard deviation of split frequencies: 0.012540
405500 -- (-2205.797) (-2217.602) (-2209.345) [-2196.473] * (-2211.458) (-2208.679) [-2205.457] (-2204.651) -- 0:03:03
406000 -- (-2207.419) [-2219.006] (-2216.799) (-2205.778) * (-2220.364) (-2209.175) (-2223.997) [-2214.294] -- 0:03:02
406500 -- (-2209.266) [-2203.904] (-2210.164) (-2203.613) * (-2215.376) (-2238.328) (-2205.245) [-2201.107] -- 0:03:03
407000 -- (-2206.014) (-2220.312) [-2203.690] (-2212.866) * (-2223.711) (-2213.390) (-2213.775) [-2204.764] -- 0:03:03
407500 -- [-2200.613] (-2219.834) (-2226.148) (-2212.648) * (-2220.847) (-2211.346) (-2205.321) [-2205.256] -- 0:03:03
408000 -- (-2205.086) (-2203.546) (-2213.930) [-2216.031] * (-2221.483) (-2206.469) (-2205.576) [-2202.220] -- 0:03:02
408500 -- (-2218.282) [-2202.808] (-2212.186) (-2211.948) * (-2214.141) [-2200.507] (-2216.723) (-2205.028) -- 0:03:02
409000 -- (-2210.197) (-2209.889) [-2212.178] (-2213.982) * (-2211.542) (-2218.472) [-2208.951] (-2202.761) -- 0:03:02
409500 -- [-2199.553] (-2215.514) (-2211.673) (-2215.228) * (-2211.848) (-2215.098) (-2221.219) [-2200.514] -- 0:03:01
410000 -- (-2209.853) (-2220.997) (-2217.258) [-2212.207] * [-2213.133] (-2216.466) (-2211.045) (-2204.014) -- 0:03:02
Average standard deviation of split frequencies: 0.012168
410500 -- (-2208.781) (-2221.381) (-2213.097) [-2211.751] * (-2227.693) [-2206.104] (-2206.785) (-2217.761) -- 0:03:02
411000 -- (-2216.518) [-2212.847] (-2204.995) (-2204.871) * (-2230.211) (-2205.227) [-2214.101] (-2211.931) -- 0:03:02
411500 -- (-2204.367) [-2213.670] (-2214.457) (-2213.584) * (-2222.302) [-2210.052] (-2213.332) (-2210.424) -- 0:03:01
412000 -- [-2215.142] (-2211.287) (-2216.687) (-2212.976) * (-2227.322) (-2224.407) (-2216.099) [-2223.971] -- 0:03:01
412500 -- (-2208.077) (-2209.615) (-2213.236) [-2216.664] * (-2226.503) (-2204.964) (-2230.539) [-2209.570] -- 0:03:00
413000 -- [-2211.480] (-2206.224) (-2224.273) (-2212.013) * (-2212.380) (-2201.927) (-2225.797) [-2208.841] -- 0:03:01
413500 -- (-2213.513) (-2214.587) (-2214.492) [-2206.386] * (-2216.464) (-2204.661) [-2209.907] (-2216.649) -- 0:03:01
414000 -- (-2219.949) (-2211.424) (-2214.386) [-2215.512] * (-2214.159) (-2210.837) [-2215.464] (-2228.229) -- 0:03:01
414500 -- [-2203.332] (-2202.332) (-2206.595) (-2218.607) * [-2201.047] (-2213.248) (-2209.315) (-2213.555) -- 0:03:00
415000 -- (-2215.483) (-2205.661) [-2206.319] (-2209.720) * [-2201.389] (-2214.612) (-2207.426) (-2214.663) -- 0:03:00
Average standard deviation of split frequencies: 0.012465
415500 -- (-2218.836) (-2211.400) [-2205.213] (-2210.543) * [-2201.072] (-2225.408) (-2211.602) (-2214.881) -- 0:03:00
416000 -- (-2210.056) (-2222.391) [-2211.810] (-2211.178) * (-2212.086) (-2214.835) [-2202.702] (-2210.450) -- 0:03:01
416500 -- (-2216.132) [-2212.137] (-2207.008) (-2221.737) * [-2211.356] (-2225.108) (-2214.892) (-2221.665) -- 0:03:00
417000 -- (-2209.046) (-2217.125) [-2215.351] (-2213.586) * [-2210.880] (-2213.402) (-2222.437) (-2206.153) -- 0:03:00
417500 -- [-2206.822] (-2216.357) (-2212.609) (-2223.347) * (-2203.530) [-2210.503] (-2211.696) (-2213.577) -- 0:02:59
418000 -- [-2203.497] (-2210.393) (-2213.231) (-2204.109) * (-2217.733) (-2208.730) [-2207.114] (-2214.648) -- 0:02:59
418500 -- (-2206.911) (-2212.017) (-2206.901) [-2203.415] * (-2217.861) (-2206.004) [-2206.960] (-2220.084) -- 0:02:59
419000 -- (-2201.517) (-2218.511) [-2202.473] (-2207.029) * (-2218.242) [-2208.930] (-2211.580) (-2210.199) -- 0:03:00
419500 -- (-2205.242) (-2216.806) [-2211.304] (-2203.142) * (-2210.093) (-2207.415) [-2209.863] (-2212.457) -- 0:02:59
420000 -- (-2210.704) (-2210.374) (-2218.723) [-2202.299] * (-2216.702) (-2223.652) [-2210.659] (-2213.457) -- 0:02:59
Average standard deviation of split frequencies: 0.014419
420500 -- (-2212.457) [-2210.982] (-2220.744) (-2201.151) * (-2212.422) [-2214.288] (-2210.795) (-2213.434) -- 0:02:59
421000 -- (-2210.128) [-2209.004] (-2221.326) (-2214.889) * (-2212.154) (-2219.379) [-2204.380] (-2214.888) -- 0:02:58
421500 -- (-2212.224) [-2207.694] (-2211.703) (-2219.731) * (-2219.555) (-2215.550) [-2215.855] (-2216.742) -- 0:02:58
422000 -- (-2220.986) [-2212.359] (-2220.642) (-2208.329) * (-2205.687) (-2219.231) (-2205.840) [-2207.964] -- 0:02:58
422500 -- (-2232.346) [-2201.115] (-2216.268) (-2211.046) * (-2214.498) (-2213.837) (-2205.565) [-2206.018] -- 0:02:57
423000 -- (-2217.582) (-2209.427) (-2220.237) [-2210.974] * (-2212.668) (-2211.672) (-2214.545) [-2210.417] -- 0:02:58
423500 -- (-2218.008) (-2230.018) [-2209.285] (-2230.835) * [-2216.452] (-2210.939) (-2221.877) (-2209.480) -- 0:02:58
424000 -- (-2225.505) (-2213.191) (-2208.423) [-2215.103] * [-2203.861] (-2210.630) (-2215.852) (-2206.176) -- 0:02:57
424500 -- (-2217.694) [-2213.320] (-2223.417) (-2217.624) * (-2215.699) [-2215.470] (-2209.623) (-2204.993) -- 0:02:57
425000 -- (-2218.109) (-2208.990) (-2214.744) [-2214.118] * [-2208.854] (-2219.678) (-2206.326) (-2208.673) -- 0:02:57
Average standard deviation of split frequencies: 0.014017
425500 -- (-2213.816) [-2204.986] (-2218.607) (-2214.792) * [-2207.170] (-2222.098) (-2214.169) (-2203.844) -- 0:02:56
426000 -- (-2210.714) (-2212.125) [-2204.386] (-2212.752) * (-2212.418) [-2215.258] (-2207.902) (-2207.277) -- 0:02:56
426500 -- (-2223.773) (-2204.735) [-2208.169] (-2204.086) * [-2203.977] (-2219.860) (-2211.674) (-2202.889) -- 0:02:57
427000 -- (-2207.064) [-2207.005] (-2217.149) (-2212.197) * (-2209.826) [-2213.370] (-2212.899) (-2208.174) -- 0:02:57
427500 -- [-2211.995] (-2206.212) (-2215.883) (-2212.747) * (-2220.607) [-2207.628] (-2212.708) (-2204.449) -- 0:02:56
428000 -- (-2217.927) (-2220.981) [-2203.557] (-2216.038) * (-2202.138) (-2219.333) (-2209.296) [-2211.606] -- 0:02:56
428500 -- (-2205.512) (-2219.888) [-2209.317] (-2211.499) * [-2209.926] (-2207.689) (-2214.651) (-2214.995) -- 0:02:56
429000 -- [-2215.024] (-2220.666) (-2214.186) (-2215.182) * (-2223.846) (-2216.706) (-2211.757) [-2209.415] -- 0:02:55
429500 -- [-2214.004] (-2210.535) (-2215.231) (-2222.556) * (-2217.072) [-2221.207] (-2213.071) (-2204.847) -- 0:02:55
430000 -- (-2204.059) [-2212.929] (-2207.883) (-2213.410) * [-2204.480] (-2221.929) (-2213.858) (-2210.172) -- 0:02:56
Average standard deviation of split frequencies: 0.014230
430500 -- (-2216.755) (-2214.385) (-2206.998) [-2207.259] * [-2214.456] (-2215.541) (-2231.659) (-2222.031) -- 0:02:55
431000 -- (-2211.917) [-2204.171] (-2219.758) (-2210.634) * [-2210.604] (-2205.470) (-2206.129) (-2215.171) -- 0:02:55
431500 -- (-2206.803) (-2215.649) [-2214.303] (-2212.721) * (-2200.230) (-2203.752) (-2219.474) [-2208.641] -- 0:02:55
432000 -- (-2211.775) (-2229.340) [-2215.883] (-2198.883) * (-2205.661) [-2208.958] (-2214.259) (-2219.818) -- 0:02:54
432500 -- [-2206.890] (-2222.830) (-2220.737) (-2223.262) * [-2203.143] (-2212.703) (-2213.116) (-2215.867) -- 0:02:55
433000 -- [-2208.579] (-2216.667) (-2232.787) (-2227.509) * (-2209.545) [-2209.108] (-2215.278) (-2224.956) -- 0:02:55
433500 -- (-2206.736) (-2231.533) (-2224.338) [-2209.253] * [-2204.072] (-2205.205) (-2208.777) (-2213.966) -- 0:02:55
434000 -- (-2222.408) [-2199.830] (-2218.643) (-2206.553) * [-2205.836] (-2212.732) (-2214.190) (-2216.415) -- 0:02:54
434500 -- (-2207.494) [-2204.433] (-2220.444) (-2217.931) * (-2211.727) (-2221.580) [-2210.290] (-2219.378) -- 0:02:54
435000 -- (-2206.394) (-2209.293) [-2221.135] (-2217.227) * [-2209.477] (-2204.600) (-2211.688) (-2210.010) -- 0:02:54
Average standard deviation of split frequencies: 0.015209
435500 -- (-2211.955) [-2208.835] (-2222.080) (-2208.586) * (-2208.509) (-2210.196) [-2208.499] (-2203.716) -- 0:02:54
436000 -- [-2204.507] (-2208.632) (-2215.879) (-2210.683) * [-2198.997] (-2205.925) (-2206.762) (-2214.558) -- 0:02:54
436500 -- (-2210.970) [-2208.471] (-2224.711) (-2208.023) * (-2215.958) (-2209.871) [-2202.812] (-2219.712) -- 0:02:54
437000 -- (-2211.428) (-2207.349) (-2215.699) [-2214.600] * [-2206.551] (-2208.121) (-2213.603) (-2212.497) -- 0:02:53
437500 -- (-2213.039) (-2211.386) (-2213.694) [-2199.886] * [-2215.468] (-2207.087) (-2211.869) (-2219.157) -- 0:02:53
438000 -- (-2218.793) [-2209.803] (-2226.561) (-2219.654) * (-2204.454) (-2216.476) (-2218.845) [-2220.897] -- 0:02:53
438500 -- (-2207.360) (-2211.502) [-2218.026] (-2212.390) * [-2214.139] (-2225.634) (-2207.940) (-2215.763) -- 0:02:52
439000 -- (-2223.448) [-2206.101] (-2205.530) (-2220.014) * (-2207.594) (-2226.902) [-2210.136] (-2204.593) -- 0:02:52
439500 -- (-2224.825) (-2211.045) (-2204.115) [-2211.605] * (-2220.502) [-2219.882] (-2217.452) (-2208.573) -- 0:02:53
440000 -- [-2202.471] (-2208.908) (-2205.552) (-2209.456) * (-2211.222) [-2208.158] (-2213.924) (-2211.232) -- 0:02:53
Average standard deviation of split frequencies: 0.014477
440500 -- (-2210.206) (-2215.810) (-2214.657) [-2210.219] * (-2213.105) (-2211.750) [-2208.711] (-2206.438) -- 0:02:52
441000 -- (-2211.377) [-2209.090] (-2214.107) (-2203.083) * (-2215.101) (-2202.881) (-2211.096) [-2210.376] -- 0:02:52
441500 -- (-2204.817) (-2212.025) [-2204.016] (-2206.245) * (-2213.067) (-2209.578) [-2205.982] (-2211.728) -- 0:02:52
442000 -- [-2206.454] (-2219.692) (-2211.227) (-2202.790) * (-2209.228) (-2207.944) [-2214.392] (-2216.334) -- 0:02:52
442500 -- (-2206.380) (-2223.207) (-2204.188) [-2207.589] * (-2216.483) (-2204.145) [-2213.114] (-2210.265) -- 0:02:52
443000 -- (-2204.777) (-2218.599) (-2225.708) [-2206.210] * [-2204.657] (-2223.444) (-2218.442) (-2225.477) -- 0:02:52
443500 -- (-2223.776) [-2221.990] (-2220.156) (-2209.267) * (-2223.477) (-2216.563) (-2216.259) [-2207.557] -- 0:02:51
444000 -- [-2214.338] (-2208.679) (-2203.067) (-2203.715) * (-2222.023) [-2210.671] (-2203.589) (-2211.995) -- 0:02:51
444500 -- [-2205.186] (-2207.516) (-2223.401) (-2215.605) * [-2208.015] (-2214.429) (-2219.789) (-2203.058) -- 0:02:51
445000 -- [-2208.322] (-2212.150) (-2218.092) (-2212.614) * (-2204.330) [-2210.958] (-2214.772) (-2215.978) -- 0:02:50
Average standard deviation of split frequencies: 0.013529
445500 -- [-2205.914] (-2207.771) (-2212.749) (-2210.813) * [-2210.973] (-2208.001) (-2205.446) (-2214.843) -- 0:02:51
446000 -- (-2211.086) (-2209.182) (-2210.754) [-2202.679] * (-2209.830) [-2206.159] (-2232.047) (-2212.585) -- 0:02:51
446500 -- [-2210.222] (-2222.043) (-2210.142) (-2204.902) * (-2211.201) (-2211.075) [-2224.578] (-2214.354) -- 0:02:51
447000 -- (-2208.519) (-2226.107) [-2201.932] (-2213.052) * [-2211.703] (-2214.542) (-2220.592) (-2214.337) -- 0:02:50
447500 -- (-2216.952) (-2208.526) [-2210.070] (-2218.249) * (-2211.842) [-2210.952] (-2226.640) (-2214.587) -- 0:02:50
448000 -- [-2205.675] (-2208.481) (-2229.286) (-2210.739) * (-2213.983) (-2214.873) (-2216.543) [-2210.383] -- 0:02:50
448500 -- (-2202.157) [-2208.182] (-2218.968) (-2216.129) * (-2213.226) (-2209.759) (-2219.158) [-2211.750] -- 0:02:49
449000 -- [-2210.564] (-2209.558) (-2210.797) (-2225.206) * (-2225.732) [-2217.219] (-2226.064) (-2210.615) -- 0:02:50
449500 -- (-2212.255) (-2219.306) (-2207.556) [-2208.036] * (-2224.153) (-2205.417) (-2219.529) [-2202.563] -- 0:02:50
450000 -- [-2211.601] (-2222.737) (-2216.932) (-2213.975) * [-2211.699] (-2220.360) (-2215.105) (-2209.692) -- 0:02:49
Average standard deviation of split frequencies: 0.013877
450500 -- (-2218.310) [-2212.576] (-2226.891) (-2216.809) * (-2219.922) [-2201.073] (-2217.936) (-2206.139) -- 0:02:49
451000 -- (-2212.263) (-2217.122) (-2237.725) [-2209.766] * (-2225.618) (-2210.400) (-2223.162) [-2212.032] -- 0:02:50
451500 -- [-2211.271] (-2212.084) (-2220.647) (-2215.712) * (-2206.865) (-2214.736) [-2214.907] (-2229.445) -- 0:02:50
452000 -- (-2227.431) (-2216.250) [-2212.694] (-2208.257) * (-2207.858) (-2214.700) [-2210.375] (-2225.009) -- 0:02:49
452500 -- (-2218.448) [-2212.789] (-2215.143) (-2210.253) * (-2207.820) [-2211.659] (-2203.954) (-2227.208) -- 0:02:49
453000 -- (-2215.183) (-2209.204) (-2215.648) [-2211.027] * (-2221.999) [-2214.613] (-2216.964) (-2212.860) -- 0:02:49
453500 -- (-2219.976) (-2211.964) (-2204.792) [-2215.612] * (-2215.035) (-2213.582) [-2214.738] (-2216.358) -- 0:02:48
454000 -- [-2207.941] (-2218.863) (-2212.473) (-2226.814) * [-2210.133] (-2213.027) (-2215.749) (-2208.765) -- 0:02:48
454500 -- (-2208.889) (-2208.798) (-2212.600) [-2207.901] * [-2207.182] (-2225.220) (-2225.473) (-2218.990) -- 0:02:49
455000 -- (-2218.023) (-2208.294) [-2209.731] (-2219.989) * (-2211.230) (-2210.939) [-2212.653] (-2219.857) -- 0:02:48
Average standard deviation of split frequencies: 0.014335
455500 -- (-2208.707) (-2218.386) (-2209.568) [-2210.380] * (-2204.708) (-2213.855) [-2209.552] (-2222.216) -- 0:02:48
456000 -- [-2213.461] (-2213.029) (-2220.115) (-2215.089) * [-2204.026] (-2202.062) (-2209.596) (-2215.078) -- 0:02:48
456500 -- (-2209.113) [-2206.457] (-2211.452) (-2203.923) * [-2202.407] (-2209.546) (-2210.360) (-2221.509) -- 0:02:47
457000 -- (-2213.176) (-2200.230) [-2216.982] (-2215.611) * (-2211.322) (-2217.016) [-2206.185] (-2215.503) -- 0:02:47
457500 -- (-2218.643) (-2206.674) [-2209.927] (-2214.984) * (-2218.893) [-2205.830] (-2226.052) (-2214.598) -- 0:02:47
458000 -- [-2205.734] (-2221.724) (-2211.548) (-2210.955) * (-2224.350) [-2206.727] (-2221.530) (-2218.136) -- 0:02:46
458500 -- (-2229.363) (-2222.140) (-2201.267) [-2207.231] * (-2204.687) (-2209.637) (-2227.753) [-2215.130] -- 0:02:47
459000 -- (-2208.975) (-2208.413) [-2210.972] (-2214.949) * (-2207.446) [-2207.403] (-2204.415) (-2214.654) -- 0:02:47
459500 -- [-2215.949] (-2218.471) (-2213.288) (-2218.141) * (-2213.613) (-2209.400) (-2209.003) [-2209.415] -- 0:02:47
460000 -- [-2214.159] (-2221.035) (-2206.338) (-2210.456) * (-2205.839) (-2220.109) [-2207.746] (-2206.019) -- 0:02:46
Average standard deviation of split frequencies: 0.013712
460500 -- (-2211.926) (-2226.685) [-2206.062] (-2211.563) * (-2202.450) [-2210.042] (-2206.062) (-2210.995) -- 0:02:46
461000 -- (-2209.630) (-2218.687) (-2211.461) [-2212.687] * [-2212.544] (-2210.283) (-2216.263) (-2213.165) -- 0:02:46
461500 -- [-2208.102] (-2210.685) (-2206.008) (-2219.708) * (-2207.968) (-2206.971) [-2218.136] (-2223.604) -- 0:02:45
462000 -- [-2215.209] (-2216.316) (-2206.897) (-2215.746) * (-2202.998) (-2211.353) [-2208.659] (-2228.727) -- 0:02:46
462500 -- (-2223.699) [-2212.835] (-2210.079) (-2213.314) * (-2209.687) (-2214.330) [-2198.249] (-2209.307) -- 0:02:46
463000 -- (-2215.820) (-2207.758) (-2206.411) [-2209.092] * (-2214.352) [-2210.221] (-2209.869) (-2214.064) -- 0:02:45
463500 -- (-2221.744) (-2205.139) [-2212.810] (-2210.886) * (-2217.013) (-2238.731) [-2211.122] (-2211.223) -- 0:02:45
464000 -- (-2210.252) (-2228.386) (-2209.535) [-2206.789] * (-2220.357) [-2212.029] (-2206.146) (-2223.826) -- 0:02:45
464500 -- (-2211.873) (-2222.190) (-2213.677) [-2205.765] * (-2216.492) [-2215.111] (-2209.578) (-2218.990) -- 0:02:44
465000 -- (-2215.973) (-2211.670) (-2214.664) [-2203.100] * [-2209.808] (-2216.754) (-2209.172) (-2218.869) -- 0:02:44
Average standard deviation of split frequencies: 0.013758
465500 -- [-2210.059] (-2209.394) (-2223.161) (-2205.555) * [-2214.239] (-2209.798) (-2211.333) (-2212.045) -- 0:02:45
466000 -- [-2207.472] (-2215.000) (-2221.978) (-2218.662) * [-2208.655] (-2216.354) (-2210.478) (-2208.372) -- 0:02:45
466500 -- [-2202.371] (-2216.658) (-2215.949) (-2208.674) * [-2204.230] (-2209.131) (-2216.044) (-2213.446) -- 0:02:44
467000 -- (-2201.538) (-2216.682) [-2210.969] (-2210.192) * (-2222.079) (-2229.794) (-2218.335) [-2209.477] -- 0:02:44
467500 -- [-2212.251] (-2213.988) (-2208.858) (-2222.058) * [-2212.632] (-2212.047) (-2215.876) (-2206.206) -- 0:02:44
468000 -- (-2209.356) (-2211.570) [-2202.307] (-2211.953) * [-2206.115] (-2217.742) (-2210.562) (-2215.477) -- 0:02:43
468500 -- (-2217.204) (-2206.586) (-2204.579) [-2197.891] * (-2219.020) (-2216.451) [-2205.978] (-2211.438) -- 0:02:43
469000 -- (-2206.066) (-2218.046) (-2212.452) [-2206.475] * (-2220.734) (-2214.720) (-2209.419) [-2201.541] -- 0:02:44
469500 -- (-2216.426) [-2211.367] (-2214.352) (-2217.670) * (-2218.278) (-2220.834) [-2205.459] (-2216.221) -- 0:02:43
470000 -- (-2203.069) [-2206.624] (-2206.618) (-2212.983) * (-2204.531) (-2227.097) [-2206.397] (-2206.603) -- 0:02:43
Average standard deviation of split frequencies: 0.013020
470500 -- (-2213.108) (-2214.478) (-2206.849) [-2209.140] * [-2205.788] (-2213.870) (-2211.699) (-2220.255) -- 0:02:43
471000 -- (-2209.484) (-2217.049) (-2208.356) [-2200.089] * [-2209.560] (-2220.837) (-2213.879) (-2231.941) -- 0:02:42
471500 -- (-2206.054) (-2216.218) [-2214.051] (-2204.706) * [-2204.079] (-2220.863) (-2214.505) (-2209.336) -- 0:02:42
472000 -- (-2218.051) (-2209.152) [-2204.259] (-2215.446) * (-2221.005) (-2213.173) (-2220.275) [-2208.242] -- 0:02:42
472500 -- (-2217.507) (-2207.160) [-2207.790] (-2206.629) * (-2212.142) [-2206.530] (-2219.882) (-2213.417) -- 0:02:42
473000 -- (-2214.819) [-2206.856] (-2216.124) (-2206.978) * (-2212.790) (-2208.809) (-2213.779) [-2207.606] -- 0:02:42
473500 -- [-2204.196] (-2211.161) (-2208.104) (-2207.531) * (-2217.644) (-2209.774) [-2210.790] (-2203.346) -- 0:02:42
474000 -- (-2215.660) [-2204.340] (-2214.325) (-2207.994) * [-2208.829] (-2222.618) (-2213.250) (-2214.972) -- 0:02:42
474500 -- (-2207.664) [-2205.008] (-2220.070) (-2220.569) * (-2217.606) (-2211.339) (-2214.626) [-2210.214] -- 0:02:41
475000 -- (-2214.985) [-2212.259] (-2224.788) (-2215.292) * (-2213.800) [-2202.341] (-2220.424) (-2212.350) -- 0:02:41
Average standard deviation of split frequencies: 0.012610
475500 -- [-2204.423] (-2205.307) (-2217.042) (-2207.385) * (-2212.032) (-2215.667) [-2218.195] (-2205.084) -- 0:02:41
476000 -- (-2208.013) [-2207.342] (-2216.284) (-2213.397) * (-2214.019) [-2207.419] (-2215.007) (-2204.032) -- 0:02:41
476500 -- [-2208.369] (-2209.447) (-2216.595) (-2206.168) * (-2216.452) (-2208.970) (-2216.718) [-2212.009] -- 0:02:41
477000 -- (-2213.585) (-2212.238) (-2207.679) [-2208.036] * (-2211.504) [-2218.329] (-2203.544) (-2229.155) -- 0:02:41
477500 -- (-2215.306) (-2205.692) [-2209.782] (-2211.552) * (-2217.290) (-2210.106) (-2208.465) [-2208.286] -- 0:02:40
478000 -- (-2214.675) (-2210.664) [-2212.451] (-2213.008) * (-2208.869) (-2211.260) [-2213.942] (-2208.083) -- 0:02:40
478500 -- (-2207.441) (-2213.194) (-2208.647) [-2210.677] * (-2209.565) (-2210.103) [-2212.386] (-2203.266) -- 0:02:40
479000 -- (-2210.373) [-2207.809] (-2213.519) (-2218.858) * [-2205.978] (-2231.575) (-2205.361) (-2208.033) -- 0:02:40
479500 -- [-2206.616] (-2232.852) (-2215.620) (-2218.475) * (-2210.773) (-2211.518) [-2206.548] (-2217.967) -- 0:02:40
480000 -- [-2208.752] (-2213.979) (-2217.947) (-2225.881) * (-2213.712) (-2223.884) [-2203.891] (-2208.443) -- 0:02:40
Average standard deviation of split frequencies: 0.013599
480500 -- (-2213.431) (-2222.263) (-2211.449) [-2210.817] * (-2211.193) (-2218.137) [-2214.271] (-2213.691) -- 0:02:40
481000 -- (-2216.429) (-2210.825) (-2219.404) [-2207.288] * [-2205.536] (-2213.100) (-2203.966) (-2218.843) -- 0:02:39
481500 -- [-2213.049] (-2212.013) (-2225.272) (-2222.317) * (-2217.060) [-2211.523] (-2206.905) (-2213.174) -- 0:02:39
482000 -- (-2217.295) [-2206.152] (-2223.182) (-2229.818) * [-2210.051] (-2211.598) (-2205.811) (-2214.831) -- 0:02:39
482500 -- (-2209.801) (-2207.901) (-2208.387) [-2212.594] * (-2223.274) [-2205.151] (-2211.146) (-2212.865) -- 0:02:39
483000 -- [-2212.447] (-2209.922) (-2218.851) (-2217.053) * (-2207.319) [-2203.297] (-2203.939) (-2207.994) -- 0:02:39
483500 -- (-2214.903) (-2220.332) (-2204.322) [-2209.251] * [-2208.431] (-2215.977) (-2204.139) (-2209.655) -- 0:02:39
484000 -- (-2212.309) (-2198.108) (-2207.799) [-2204.962] * (-2207.159) [-2208.626] (-2207.107) (-2213.166) -- 0:02:38
484500 -- (-2208.586) (-2202.832) [-2206.901] (-2212.334) * (-2208.488) [-2208.143] (-2208.485) (-2206.193) -- 0:02:38
485000 -- (-2208.339) (-2218.079) [-2203.310] (-2215.159) * [-2203.783] (-2203.174) (-2212.692) (-2213.983) -- 0:02:38
Average standard deviation of split frequencies: 0.014291
485500 -- (-2207.925) (-2205.174) (-2212.401) [-2208.510] * (-2209.728) [-2202.595] (-2225.584) (-2224.475) -- 0:02:37
486000 -- (-2211.433) [-2199.500] (-2208.138) (-2216.298) * (-2221.647) (-2211.463) [-2213.861] (-2215.302) -- 0:02:38
486500 -- (-2213.260) (-2208.278) [-2209.949] (-2217.856) * (-2210.614) (-2212.597) (-2229.782) [-2203.534] -- 0:02:38
487000 -- (-2202.381) (-2229.627) [-2214.377] (-2225.877) * (-2213.366) [-2206.195] (-2232.551) (-2203.309) -- 0:02:38
487500 -- (-2209.296) [-2213.656] (-2209.537) (-2223.876) * (-2213.262) (-2209.271) [-2211.333] (-2208.997) -- 0:02:37
488000 -- (-2212.755) (-2211.289) [-2211.133] (-2212.075) * [-2201.739] (-2205.515) (-2215.165) (-2219.204) -- 0:02:37
488500 -- (-2214.304) [-2201.199] (-2208.170) (-2208.879) * (-2214.008) (-2210.594) (-2222.535) [-2218.330] -- 0:02:38
489000 -- [-2214.415] (-2206.617) (-2211.234) (-2214.205) * (-2222.705) (-2217.181) (-2215.062) [-2208.326] -- 0:02:37
489500 -- (-2224.044) [-2207.032] (-2216.290) (-2219.563) * (-2205.899) [-2208.728] (-2215.561) (-2210.526) -- 0:02:37
490000 -- (-2214.672) (-2220.257) [-2208.716] (-2223.609) * (-2214.586) (-2214.861) (-2225.848) [-2213.230] -- 0:02:37
Average standard deviation of split frequencies: 0.013643
490500 -- (-2229.007) (-2215.963) [-2203.007] (-2213.380) * (-2200.929) [-2204.499] (-2217.439) (-2209.959) -- 0:02:36
491000 -- (-2216.652) [-2212.942] (-2221.421) (-2228.595) * (-2219.201) (-2210.611) [-2210.524] (-2204.377) -- 0:02:36
491500 -- (-2212.846) [-2208.612] (-2221.143) (-2224.661) * [-2221.430] (-2210.321) (-2208.070) (-2210.786) -- 0:02:36
492000 -- (-2212.821) (-2212.024) [-2216.181] (-2210.287) * [-2210.307] (-2219.504) (-2203.664) (-2222.770) -- 0:02:36
492500 -- [-2210.121] (-2206.716) (-2222.081) (-2214.237) * (-2211.140) (-2220.275) [-2208.557] (-2227.770) -- 0:02:36
493000 -- (-2209.121) (-2214.108) [-2212.175] (-2222.995) * (-2224.545) (-2214.574) [-2202.909] (-2223.150) -- 0:02:36
493500 -- (-2206.236) (-2207.876) (-2213.028) [-2199.360] * [-2207.321] (-2221.600) (-2211.751) (-2222.853) -- 0:02:36
494000 -- (-2210.432) (-2212.713) [-2211.991] (-2211.378) * (-2213.815) [-2210.541] (-2218.619) (-2216.644) -- 0:02:35
494500 -- (-2227.502) (-2212.007) (-2211.589) [-2212.005] * (-2221.295) (-2213.296) [-2205.161] (-2219.232) -- 0:02:35
495000 -- [-2231.522] (-2211.834) (-2211.096) (-2214.078) * (-2213.236) (-2213.747) (-2212.596) [-2210.499] -- 0:02:35
Average standard deviation of split frequencies: 0.012799
495500 -- (-2223.744) (-2205.202) (-2207.845) [-2208.618] * (-2221.464) (-2212.942) (-2212.180) [-2209.985] -- 0:02:35
496000 -- (-2222.591) [-2207.463] (-2229.648) (-2212.593) * (-2219.555) (-2207.178) (-2206.453) [-2203.683] -- 0:02:35
496500 -- (-2218.599) (-2210.494) [-2210.168] (-2209.874) * (-2214.372) (-2214.671) (-2218.412) [-2209.520] -- 0:02:35
497000 -- (-2211.521) (-2206.904) [-2207.682] (-2210.299) * (-2206.600) (-2211.613) [-2214.160] (-2216.401) -- 0:02:34
497500 -- (-2208.737) (-2207.588) [-2209.735] (-2205.918) * (-2214.008) (-2215.812) [-2211.283] (-2212.127) -- 0:02:34
498000 -- (-2211.368) [-2212.278] (-2210.012) (-2215.629) * (-2212.163) (-2223.184) (-2210.624) [-2206.153] -- 0:02:34
498500 -- (-2216.024) (-2219.736) [-2205.717] (-2208.314) * (-2205.848) (-2215.888) (-2218.970) [-2208.003] -- 0:02:33
499000 -- (-2214.284) (-2201.364) (-2217.133) [-2201.260] * (-2208.022) [-2219.720] (-2212.944) (-2219.811) -- 0:02:34
499500 -- (-2215.848) (-2205.811) [-2230.614] (-2205.883) * (-2206.524) (-2222.341) [-2214.127] (-2222.874) -- 0:02:34
500000 -- [-2207.824] (-2226.207) (-2213.119) (-2216.903) * (-2213.439) (-2214.291) [-2214.630] (-2217.494) -- 0:02:34
Average standard deviation of split frequencies: 0.012429
500500 -- (-2209.315) (-2209.977) (-2221.371) [-2202.605] * (-2217.651) (-2208.698) [-2206.882] (-2217.475) -- 0:02:33
501000 -- (-2217.690) (-2215.412) (-2209.384) [-2213.237] * (-2218.035) (-2221.004) [-2211.767] (-2217.790) -- 0:02:33
501500 -- (-2222.097) [-2209.263] (-2213.618) (-2211.683) * (-2210.215) [-2203.406] (-2207.463) (-2212.234) -- 0:02:33
502000 -- (-2211.010) [-2206.161] (-2203.650) (-2222.635) * (-2224.174) (-2213.465) [-2203.318] (-2218.007) -- 0:02:33
502500 -- (-2214.933) (-2211.451) [-2208.241] (-2203.440) * (-2209.486) [-2208.330] (-2213.841) (-2221.384) -- 0:02:33
503000 -- (-2216.879) (-2210.919) [-2218.247] (-2209.415) * [-2204.217] (-2208.608) (-2211.735) (-2210.394) -- 0:02:33
503500 -- [-2208.961] (-2215.211) (-2219.533) (-2215.452) * (-2204.813) [-2206.865] (-2213.286) (-2210.857) -- 0:02:32
504000 -- (-2202.639) (-2219.520) [-2205.751] (-2224.752) * (-2209.619) [-2206.764] (-2210.113) (-2212.708) -- 0:02:32
504500 -- (-2208.550) (-2206.829) [-2209.986] (-2220.880) * (-2212.450) (-2208.565) (-2211.448) [-2209.447] -- 0:02:32
505000 -- (-2202.502) (-2217.635) [-2206.037] (-2216.325) * [-2213.150] (-2209.978) (-2213.773) (-2208.968) -- 0:02:32
Average standard deviation of split frequencies: 0.010869
505500 -- (-2206.266) (-2236.142) [-2207.183] (-2206.225) * (-2206.447) [-2212.515] (-2203.076) (-2214.668) -- 0:02:32
506000 -- (-2208.811) (-2209.626) [-2209.204] (-2207.226) * (-2211.612) (-2221.473) (-2217.424) [-2205.754] -- 0:02:32
506500 -- (-2214.293) (-2209.031) [-2203.507] (-2210.205) * [-2216.719] (-2201.782) (-2219.116) (-2209.439) -- 0:02:31
507000 -- (-2216.285) (-2216.271) [-2214.730] (-2211.952) * (-2223.510) (-2217.077) (-2209.939) [-2208.321] -- 0:02:31
507500 -- (-2202.381) [-2201.852] (-2225.648) (-2219.072) * (-2210.551) (-2210.699) (-2209.079) [-2215.425] -- 0:02:31
508000 -- (-2222.460) [-2203.248] (-2206.821) (-2205.003) * [-2202.403] (-2218.930) (-2212.978) (-2212.117) -- 0:02:31
508500 -- (-2219.184) (-2208.141) [-2206.148] (-2216.871) * (-2206.287) (-2210.882) [-2205.983] (-2219.600) -- 0:02:31
509000 -- (-2231.743) (-2208.052) (-2207.494) [-2210.401] * (-2219.485) [-2217.772] (-2221.597) (-2214.191) -- 0:02:31
509500 -- (-2221.447) (-2211.003) [-2220.196] (-2217.334) * (-2212.460) [-2206.332] (-2216.625) (-2206.094) -- 0:02:31
510000 -- (-2215.494) (-2207.777) [-2204.307] (-2212.593) * (-2214.967) (-2217.861) [-2223.298] (-2211.514) -- 0:02:30
Average standard deviation of split frequencies: 0.010893
510500 -- (-2217.874) (-2209.358) (-2219.089) [-2208.475] * (-2212.560) [-2207.827] (-2219.511) (-2212.420) -- 0:02:30
511000 -- [-2208.839] (-2213.124) (-2214.171) (-2211.302) * (-2207.443) (-2208.257) (-2210.457) [-2214.343] -- 0:02:30
511500 -- (-2216.075) (-2207.275) (-2212.602) [-2210.786] * (-2204.841) (-2225.653) [-2212.970] (-2212.898) -- 0:02:29
512000 -- (-2212.316) [-2205.208] (-2213.305) (-2208.381) * [-2202.769] (-2216.525) (-2210.707) (-2221.414) -- 0:02:30
512500 -- (-2213.966) [-2212.271] (-2215.962) (-2220.118) * (-2202.551) [-2210.594] (-2205.397) (-2208.879) -- 0:02:30
513000 -- (-2212.126) [-2219.614] (-2214.149) (-2210.471) * (-2209.311) (-2216.308) (-2216.743) [-2216.774] -- 0:02:29
513500 -- [-2211.706] (-2218.324) (-2206.797) (-2208.797) * [-2210.348] (-2217.332) (-2210.476) (-2208.274) -- 0:02:29
514000 -- (-2218.972) (-2216.354) [-2217.470] (-2206.492) * (-2224.306) (-2221.918) [-2209.562] (-2217.961) -- 0:02:29
514500 -- [-2207.808] (-2225.021) (-2218.337) (-2218.683) * [-2212.441] (-2214.776) (-2207.047) (-2217.719) -- 0:02:29
515000 -- (-2216.560) (-2212.857) [-2207.669] (-2225.998) * (-2220.638) (-2229.779) [-2207.609] (-2220.364) -- 0:02:28
Average standard deviation of split frequencies: 0.012120
515500 -- (-2219.573) (-2219.691) [-2217.389] (-2219.229) * (-2215.464) [-2207.633] (-2215.001) (-2216.596) -- 0:02:29
516000 -- (-2212.434) [-2210.810] (-2216.956) (-2215.638) * [-2211.455] (-2214.355) (-2214.000) (-2213.177) -- 0:02:29
516500 -- (-2213.451) (-2221.538) [-2205.225] (-2221.828) * (-2205.894) (-2220.260) [-2199.473] (-2212.424) -- 0:02:28
517000 -- [-2202.548] (-2221.372) (-2214.722) (-2213.051) * (-2207.093) (-2214.078) [-2211.367] (-2221.312) -- 0:02:28
517500 -- (-2206.842) (-2218.527) (-2219.435) [-2203.775] * (-2215.137) (-2218.543) (-2205.622) [-2205.825] -- 0:02:28
518000 -- (-2213.181) [-2201.412] (-2210.535) (-2220.537) * (-2225.100) (-2217.695) [-2212.676] (-2205.970) -- 0:02:27
518500 -- (-2211.811) [-2202.430] (-2203.743) (-2216.979) * (-2210.795) [-2208.965] (-2216.145) (-2207.465) -- 0:02:27
519000 -- (-2215.402) [-2206.978] (-2209.038) (-2215.582) * [-2217.035] (-2219.509) (-2223.720) (-2212.502) -- 0:02:28
519500 -- [-2215.888] (-2206.793) (-2211.913) (-2217.546) * (-2212.464) (-2221.154) [-2209.287] (-2218.295) -- 0:02:27
520000 -- (-2213.363) (-2213.395) [-2229.121] (-2228.998) * (-2211.081) [-2213.228] (-2218.526) (-2215.148) -- 0:02:27
Average standard deviation of split frequencies: 0.011589
520500 -- [-2215.170] (-2210.267) (-2206.612) (-2210.993) * [-2205.238] (-2218.172) (-2218.093) (-2216.481) -- 0:02:27
521000 -- [-2215.130] (-2204.122) (-2208.879) (-2217.683) * (-2215.408) (-2210.223) (-2210.614) [-2207.839] -- 0:02:27
521500 -- (-2206.027) (-2218.257) (-2215.507) [-2207.578] * (-2210.107) [-2208.721] (-2209.500) (-2213.353) -- 0:02:26
522000 -- (-2226.117) [-2207.365] (-2215.731) (-2216.675) * (-2206.011) [-2201.380] (-2213.659) (-2212.840) -- 0:02:26
522500 -- (-2235.386) (-2210.437) [-2217.466] (-2201.227) * (-2210.547) (-2215.894) [-2213.964] (-2214.704) -- 0:02:26
523000 -- (-2212.811) [-2205.112] (-2220.945) (-2216.819) * (-2208.950) (-2210.717) [-2210.433] (-2214.725) -- 0:02:26
523500 -- (-2216.797) (-2220.986) (-2231.797) [-2208.943] * (-2221.921) (-2205.971) [-2205.042] (-2207.191) -- 0:02:26
524000 -- [-2207.048] (-2227.578) (-2209.050) (-2205.517) * (-2203.898) (-2216.137) [-2201.605] (-2220.969) -- 0:02:26
524500 -- (-2210.288) (-2216.611) [-2211.777] (-2209.162) * (-2198.337) [-2209.262] (-2203.820) (-2227.014) -- 0:02:25
525000 -- (-2223.244) [-2207.145] (-2208.670) (-2217.735) * (-2220.888) (-2215.249) (-2212.759) [-2215.515] -- 0:02:25
Average standard deviation of split frequencies: 0.012188
525500 -- (-2218.239) (-2208.271) [-2214.896] (-2205.606) * [-2203.158] (-2209.357) (-2213.480) (-2211.550) -- 0:02:25
526000 -- [-2205.000] (-2211.420) (-2209.160) (-2203.775) * (-2211.662) (-2209.734) [-2211.336] (-2209.480) -- 0:02:25
526500 -- [-2209.557] (-2214.773) (-2216.762) (-2212.805) * (-2210.929) [-2209.336] (-2202.970) (-2213.578) -- 0:02:25
527000 -- [-2207.490] (-2205.807) (-2216.185) (-2213.963) * (-2207.947) [-2210.088] (-2219.397) (-2211.873) -- 0:02:25
527500 -- (-2215.340) [-2206.742] (-2201.232) (-2215.962) * (-2213.875) [-2201.234] (-2228.526) (-2213.270) -- 0:02:25
528000 -- (-2207.336) (-2208.958) [-2203.269] (-2219.534) * (-2223.954) (-2216.834) (-2217.925) [-2207.667] -- 0:02:24
528500 -- (-2205.671) (-2216.721) (-2212.174) [-2205.634] * (-2216.364) (-2208.387) (-2222.355) [-2206.260] -- 0:02:24
529000 -- (-2209.465) (-2218.914) (-2222.100) [-2209.341] * (-2205.618) (-2207.461) (-2224.320) [-2204.818] -- 0:02:24
529500 -- (-2222.022) (-2202.257) (-2214.667) [-2204.760] * (-2209.639) (-2214.534) (-2234.040) [-2210.579] -- 0:02:23
530000 -- (-2213.719) (-2209.487) (-2233.006) [-2209.390] * [-2203.118] (-2220.713) (-2215.889) (-2227.461) -- 0:02:24
Average standard deviation of split frequencies: 0.012200
530500 -- (-2208.388) (-2215.061) [-2217.106] (-2222.198) * [-2211.906] (-2223.383) (-2217.614) (-2218.957) -- 0:02:24
531000 -- (-2214.392) (-2231.827) [-2209.733] (-2215.852) * (-2220.235) (-2219.178) [-2218.295] (-2205.089) -- 0:02:23
531500 -- (-2205.114) (-2217.403) [-2208.803] (-2207.784) * (-2214.254) (-2209.411) [-2216.585] (-2216.666) -- 0:02:23
532000 -- (-2210.536) (-2216.353) [-2218.330] (-2213.045) * [-2206.692] (-2205.853) (-2209.960) (-2201.107) -- 0:02:23
532500 -- (-2209.694) [-2202.748] (-2207.959) (-2214.746) * [-2205.288] (-2212.019) (-2210.734) (-2206.938) -- 0:02:23
533000 -- (-2211.454) [-2210.139] (-2212.564) (-2212.401) * (-2219.152) (-2212.154) (-2207.312) [-2217.596] -- 0:02:22
533500 -- (-2203.724) [-2206.685] (-2204.210) (-2202.895) * (-2215.321) (-2215.983) (-2206.793) [-2210.552] -- 0:02:23
534000 -- (-2214.684) [-2201.863] (-2224.628) (-2221.655) * (-2218.676) (-2214.463) (-2209.233) [-2215.357] -- 0:02:23
534500 -- [-2215.543] (-2205.870) (-2224.438) (-2208.571) * (-2224.146) [-2209.116] (-2212.601) (-2218.568) -- 0:02:22
535000 -- (-2207.346) [-2209.477] (-2211.557) (-2211.930) * (-2216.567) (-2207.402) (-2215.165) [-2210.717] -- 0:02:22
Average standard deviation of split frequencies: 0.012137
535500 -- (-2213.556) [-2204.570] (-2201.546) (-2220.872) * (-2210.132) [-2201.534] (-2222.054) (-2207.633) -- 0:02:22
536000 -- (-2215.563) (-2210.784) [-2206.932] (-2225.999) * (-2211.287) [-2203.364] (-2208.520) (-2221.389) -- 0:02:21
536500 -- (-2208.520) (-2202.103) [-2202.010] (-2208.013) * (-2212.181) (-2213.147) (-2207.210) [-2211.022] -- 0:02:21
537000 -- (-2206.295) (-2206.077) [-2209.678] (-2208.481) * (-2216.789) (-2210.242) (-2207.508) [-2209.332] -- 0:02:22
537500 -- [-2208.096] (-2207.545) (-2207.944) (-2203.733) * (-2201.887) (-2225.314) [-2208.512] (-2208.429) -- 0:02:21
538000 -- (-2212.169) (-2210.365) [-2204.168] (-2210.300) * [-2208.197] (-2218.599) (-2221.449) (-2215.574) -- 0:02:21
538500 -- (-2217.083) (-2215.557) [-2206.725] (-2210.489) * (-2209.155) (-2215.343) [-2212.557] (-2199.659) -- 0:02:21
539000 -- (-2226.158) [-2205.401] (-2210.341) (-2211.542) * (-2216.526) (-2222.586) [-2214.957] (-2212.790) -- 0:02:21
539500 -- (-2212.643) (-2208.067) [-2211.008] (-2216.606) * (-2200.332) (-2221.814) [-2211.259] (-2207.597) -- 0:02:20
540000 -- (-2212.945) (-2206.891) [-2205.509] (-2215.596) * (-2204.043) (-2215.347) [-2206.810] (-2214.050) -- 0:02:20
Average standard deviation of split frequencies: 0.012497
540500 -- (-2210.352) [-2213.552] (-2204.190) (-2224.172) * (-2209.062) (-2208.313) (-2219.972) [-2213.341] -- 0:02:20
541000 -- (-2213.526) (-2212.962) [-2210.304] (-2205.692) * [-2221.588] (-2221.520) (-2208.131) (-2209.971) -- 0:02:20
541500 -- [-2203.290] (-2213.398) (-2208.410) (-2215.267) * (-2222.778) [-2207.393] (-2223.098) (-2206.295) -- 0:02:20
542000 -- (-2210.085) (-2223.448) (-2210.894) [-2204.710] * [-2212.357] (-2218.216) (-2229.110) (-2210.509) -- 0:02:20
542500 -- (-2213.047) [-2214.433] (-2217.021) (-2228.745) * [-2211.406] (-2220.928) (-2225.311) (-2215.303) -- 0:02:19
543000 -- (-2215.991) [-2214.481] (-2206.508) (-2218.629) * (-2206.460) [-2209.121] (-2225.322) (-2209.256) -- 0:02:19
543500 -- (-2202.457) (-2211.532) [-2204.563] (-2210.382) * [-2216.904] (-2217.741) (-2223.882) (-2210.300) -- 0:02:19
544000 -- (-2212.285) [-2206.985] (-2211.536) (-2204.801) * [-2211.067] (-2212.153) (-2213.905) (-2211.735) -- 0:02:19
544500 -- [-2207.708] (-2211.234) (-2218.923) (-2227.275) * (-2218.471) (-2202.711) (-2209.840) [-2206.073] -- 0:02:19
545000 -- [-2207.776] (-2212.919) (-2212.318) (-2206.318) * (-2221.271) (-2211.298) [-2207.813] (-2219.441) -- 0:02:19
Average standard deviation of split frequencies: 0.012893
545500 -- (-2218.114) (-2212.755) [-2208.434] (-2223.447) * (-2233.097) (-2208.821) [-2203.825] (-2216.374) -- 0:02:19
546000 -- [-2202.735] (-2206.772) (-2214.012) (-2207.622) * [-2202.962] (-2202.362) (-2216.392) (-2212.818) -- 0:02:18
546500 -- [-2206.861] (-2216.040) (-2220.020) (-2208.603) * [-2209.730] (-2209.030) (-2231.919) (-2225.245) -- 0:02:18
547000 -- [-2212.155] (-2216.110) (-2198.983) (-2219.489) * (-2218.129) (-2214.567) (-2226.207) [-2221.635] -- 0:02:18
547500 -- (-2212.937) (-2218.108) [-2203.196] (-2221.986) * (-2222.622) (-2213.706) (-2207.297) [-2206.319] -- 0:02:18
548000 -- (-2214.556) (-2213.896) [-2217.018] (-2209.620) * (-2202.977) [-2204.668] (-2224.751) (-2208.515) -- 0:02:18
548500 -- (-2215.713) (-2214.982) [-2213.491] (-2219.419) * (-2211.147) [-2205.935] (-2210.267) (-2208.531) -- 0:02:18
549000 -- [-2204.530] (-2218.096) (-2211.173) (-2221.357) * (-2203.719) [-2199.561] (-2212.270) (-2211.416) -- 0:02:18
549500 -- (-2215.146) (-2228.118) (-2202.657) [-2216.351] * (-2209.388) (-2217.013) [-2216.086] (-2208.291) -- 0:02:17
550000 -- (-2214.798) (-2226.600) [-2206.537] (-2223.649) * [-2208.352] (-2214.901) (-2214.547) (-2209.806) -- 0:02:17
Average standard deviation of split frequencies: 0.010786
550500 -- (-2216.039) (-2210.286) (-2206.255) [-2210.472] * (-2214.065) [-2210.907] (-2216.186) (-2208.775) -- 0:02:17
551000 -- (-2205.976) [-2213.272] (-2207.045) (-2216.661) * [-2213.846] (-2215.000) (-2210.305) (-2222.385) -- 0:02:16
551500 -- (-2219.694) (-2216.989) (-2211.869) [-2204.404] * [-2208.582] (-2211.209) (-2205.186) (-2211.628) -- 0:02:17
552000 -- [-2216.558] (-2221.293) (-2211.690) (-2211.269) * [-2207.958] (-2208.927) (-2213.528) (-2224.058) -- 0:02:17
552500 -- (-2216.607) [-2210.020] (-2206.343) (-2207.803) * (-2213.743) [-2212.336] (-2213.870) (-2220.064) -- 0:02:16
553000 -- (-2205.717) (-2222.784) (-2221.343) [-2209.371] * (-2207.312) (-2210.894) (-2229.084) [-2203.445] -- 0:02:16
553500 -- [-2205.883] (-2211.399) (-2211.345) (-2238.483) * (-2219.582) [-2208.914] (-2214.134) (-2209.718) -- 0:02:16
554000 -- (-2212.408) (-2219.383) (-2212.562) [-2209.503] * [-2204.789] (-2215.023) (-2217.286) (-2220.374) -- 0:02:16
554500 -- (-2216.202) (-2210.061) (-2207.781) [-2206.424] * (-2216.204) (-2215.225) (-2207.283) [-2207.397] -- 0:02:16
555000 -- (-2213.326) [-2199.150] (-2208.098) (-2211.013) * (-2220.015) (-2203.935) [-2214.299] (-2213.605) -- 0:02:16
Average standard deviation of split frequencies: 0.010683
555500 -- (-2210.621) [-2200.552] (-2207.180) (-2212.560) * (-2220.670) [-2201.090] (-2204.536) (-2220.895) -- 0:02:16
556000 -- [-2212.444] (-2213.326) (-2212.353) (-2213.521) * (-2223.521) [-2211.062] (-2209.543) (-2213.091) -- 0:02:15
556500 -- (-2202.574) (-2216.696) [-2209.304] (-2210.064) * (-2219.467) [-2215.908] (-2213.573) (-2213.231) -- 0:02:15
557000 -- [-2211.765] (-2217.938) (-2208.663) (-2216.195) * (-2230.789) (-2207.086) (-2210.712) [-2212.170] -- 0:02:16
557500 -- [-2203.579] (-2213.838) (-2214.706) (-2213.195) * (-2212.487) (-2222.960) (-2211.092) [-2210.954] -- 0:02:15
558000 -- [-2203.224] (-2215.997) (-2205.823) (-2209.965) * (-2219.482) [-2202.790] (-2217.246) (-2210.382) -- 0:02:15
558500 -- [-2208.672] (-2221.310) (-2223.372) (-2218.732) * [-2218.077] (-2209.047) (-2199.479) (-2213.671) -- 0:02:15
559000 -- [-2203.672] (-2214.549) (-2213.760) (-2216.106) * (-2223.938) [-2207.851] (-2215.728) (-2212.258) -- 0:02:14
559500 -- (-2204.078) (-2209.141) [-2209.363] (-2223.774) * (-2211.386) [-2209.215] (-2219.281) (-2205.710) -- 0:02:14
560000 -- (-2206.834) (-2225.941) (-2212.933) [-2207.215] * (-2217.709) (-2208.979) (-2208.217) [-2204.277] -- 0:02:14
Average standard deviation of split frequencies: 0.011267
560500 -- (-2212.037) (-2216.185) (-2208.931) [-2208.125] * (-2212.589) (-2208.333) [-2205.751] (-2208.201) -- 0:02:14
561000 -- [-2213.520] (-2220.506) (-2213.488) (-2224.814) * (-2204.576) (-2217.843) [-2214.869] (-2204.657) -- 0:02:14
561500 -- (-2214.572) (-2206.723) (-2222.595) [-2216.178] * [-2212.053] (-2211.740) (-2222.253) (-2217.745) -- 0:02:14
562000 -- (-2218.035) [-2210.947] (-2221.166) (-2210.579) * (-2221.888) (-2218.894) [-2207.875] (-2206.366) -- 0:02:14
562500 -- [-2208.200] (-2212.556) (-2215.714) (-2209.387) * (-2217.976) [-2209.845] (-2210.137) (-2213.025) -- 0:02:13
563000 -- (-2207.742) (-2228.653) [-2205.529] (-2208.483) * (-2216.593) [-2209.419] (-2227.480) (-2219.796) -- 0:02:13
563500 -- [-2205.376] (-2215.198) (-2215.238) (-2205.422) * (-2223.221) (-2207.718) [-2204.571] (-2219.907) -- 0:02:13
564000 -- (-2211.751) (-2202.315) [-2213.137] (-2209.267) * (-2227.401) (-2211.879) (-2212.560) [-2213.473] -- 0:02:13
564500 -- (-2218.494) (-2202.300) (-2206.486) [-2212.561] * (-2215.439) (-2211.059) [-2208.971] (-2211.197) -- 0:02:13
565000 -- (-2217.895) [-2206.434] (-2213.858) (-2209.185) * [-2211.360] (-2211.703) (-2216.312) (-2212.105) -- 0:02:13
Average standard deviation of split frequencies: 0.010827
565500 -- (-2216.752) (-2203.139) [-2202.395] (-2206.076) * (-2211.262) (-2213.112) (-2210.474) [-2210.688] -- 0:02:12
566000 -- (-2208.490) (-2214.500) [-2215.215] (-2206.317) * (-2220.065) (-2204.145) [-2204.789] (-2213.355) -- 0:02:12
566500 -- (-2218.126) (-2206.610) (-2203.528) [-2205.783] * (-2221.572) (-2214.027) [-2214.823] (-2211.795) -- 0:02:12
567000 -- [-2210.613] (-2210.171) (-2210.512) (-2215.300) * (-2209.831) (-2212.618) [-2212.804] (-2214.026) -- 0:02:12
567500 -- (-2212.363) [-2216.411] (-2207.019) (-2213.867) * (-2213.493) [-2218.411] (-2219.960) (-2201.296) -- 0:02:12
568000 -- (-2213.310) [-2207.886] (-2213.530) (-2211.190) * (-2209.387) (-2205.996) (-2211.192) [-2210.669] -- 0:02:12
568500 -- (-2220.041) (-2208.590) [-2211.833] (-2207.720) * (-2213.751) (-2206.325) (-2209.806) [-2212.153] -- 0:02:12
569000 -- (-2214.040) (-2215.220) [-2205.272] (-2210.803) * (-2207.026) (-2224.884) [-2215.015] (-2214.454) -- 0:02:11
569500 -- [-2206.761] (-2215.911) (-2207.712) (-2215.796) * (-2210.293) (-2215.870) (-2210.168) [-2207.723] -- 0:02:11
570000 -- (-2206.420) [-2210.712] (-2214.031) (-2209.890) * [-2216.916] (-2213.558) (-2216.823) (-2203.729) -- 0:02:11
Average standard deviation of split frequencies: 0.011234
570500 -- (-2206.913) (-2209.673) [-2213.503] (-2217.870) * (-2217.465) (-2217.271) [-2204.979] (-2208.936) -- 0:02:11
571000 -- (-2208.099) (-2206.328) [-2214.468] (-2222.582) * (-2211.928) (-2225.693) (-2207.288) [-2202.594] -- 0:02:11
571500 -- [-2205.532] (-2209.749) (-2203.201) (-2216.793) * (-2215.735) [-2212.544] (-2218.148) (-2216.389) -- 0:02:11
572000 -- [-2203.962] (-2224.335) (-2230.050) (-2219.679) * [-2203.442] (-2217.435) (-2208.109) (-2209.987) -- 0:02:10
572500 -- (-2234.355) [-2207.802] (-2204.914) (-2214.251) * [-2211.541] (-2206.951) (-2204.980) (-2208.777) -- 0:02:10
573000 -- (-2220.178) (-2218.540) [-2208.375] (-2210.784) * (-2215.792) [-2206.627] (-2205.075) (-2216.511) -- 0:02:10
573500 -- [-2214.445] (-2211.056) (-2211.133) (-2228.255) * (-2214.899) [-2201.772] (-2215.285) (-2216.181) -- 0:02:10
574000 -- [-2204.134] (-2216.031) (-2212.787) (-2212.147) * [-2200.248] (-2202.829) (-2210.354) (-2226.077) -- 0:02:10
574500 -- (-2212.736) (-2222.373) (-2211.274) [-2214.404] * (-2212.198) (-2219.865) [-2201.594] (-2218.971) -- 0:02:10
575000 -- (-2221.124) (-2213.560) (-2208.944) [-2208.182] * (-2210.355) [-2201.647] (-2209.887) (-2213.194) -- 0:02:10
Average standard deviation of split frequencies: 0.010585
575500 -- [-2203.783] (-2220.198) (-2210.545) (-2211.592) * [-2207.428] (-2207.026) (-2226.086) (-2205.893) -- 0:02:09
576000 -- (-2203.461) (-2222.314) [-2213.356] (-2216.955) * (-2210.003) [-2205.703] (-2220.623) (-2212.380) -- 0:02:09
576500 -- (-2214.360) [-2212.538] (-2219.459) (-2218.764) * (-2212.188) (-2215.136) [-2210.165] (-2219.308) -- 0:02:09
577000 -- [-2216.650] (-2198.664) (-2203.767) (-2211.464) * (-2214.275) (-2218.228) (-2225.516) [-2212.413] -- 0:02:09
577500 -- (-2213.312) [-2215.226] (-2214.183) (-2205.249) * [-2206.953] (-2212.192) (-2203.427) (-2215.891) -- 0:02:09
578000 -- (-2215.172) (-2211.162) (-2214.848) [-2206.325] * [-2213.427] (-2211.108) (-2218.393) (-2219.498) -- 0:02:09
578500 -- [-2219.706] (-2220.027) (-2213.593) (-2210.887) * [-2217.134] (-2211.038) (-2222.547) (-2203.519) -- 0:02:08
579000 -- (-2213.033) (-2218.329) (-2217.905) [-2214.405] * (-2207.825) (-2215.370) (-2201.976) [-2212.839] -- 0:02:08
579500 -- (-2202.401) (-2227.371) (-2214.401) [-2205.099] * (-2210.051) (-2219.920) [-2205.046] (-2205.068) -- 0:02:08
580000 -- [-2208.416] (-2215.649) (-2207.207) (-2227.545) * [-2198.526] (-2223.879) (-2219.048) (-2203.833) -- 0:02:08
Average standard deviation of split frequencies: 0.009201
580500 -- [-2205.458] (-2212.140) (-2220.054) (-2214.256) * [-2208.734] (-2220.861) (-2230.425) (-2204.290) -- 0:02:07
581000 -- [-2210.935] (-2211.207) (-2216.570) (-2223.949) * [-2206.141] (-2216.383) (-2220.492) (-2233.820) -- 0:02:08
581500 -- (-2229.220) [-2216.346] (-2212.374) (-2225.335) * (-2210.659) (-2210.038) [-2203.025] (-2217.573) -- 0:02:08
582000 -- [-2205.634] (-2209.751) (-2207.208) (-2224.557) * (-2212.486) [-2204.835] (-2203.992) (-2214.346) -- 0:02:07
582500 -- (-2206.018) [-2210.946] (-2205.854) (-2222.675) * [-2220.052] (-2213.666) (-2209.973) (-2208.561) -- 0:02:07
583000 -- (-2218.927) (-2213.850) [-2209.054] (-2213.166) * (-2231.642) (-2208.569) [-2207.536] (-2210.183) -- 0:02:07
583500 -- (-2210.243) (-2211.462) [-2206.438] (-2204.957) * (-2215.091) (-2209.355) [-2208.664] (-2218.438) -- 0:02:07
584000 -- [-2211.457] (-2209.060) (-2212.778) (-2211.937) * (-2210.241) (-2208.854) [-2207.846] (-2217.405) -- 0:02:06
584500 -- (-2216.261) [-2206.247] (-2212.240) (-2210.404) * (-2219.404) [-2205.462] (-2223.506) (-2225.746) -- 0:02:07
585000 -- [-2201.471] (-2213.711) (-2229.362) (-2203.473) * [-2208.864] (-2220.503) (-2211.315) (-2216.992) -- 0:02:06
Average standard deviation of split frequencies: 0.009171
585500 -- (-2205.358) (-2224.307) (-2209.522) [-2211.076] * [-2202.781] (-2219.044) (-2220.995) (-2208.573) -- 0:02:06
586000 -- (-2205.915) (-2216.403) (-2209.619) [-2213.257] * (-2211.686) [-2206.552] (-2218.222) (-2214.463) -- 0:02:06
586500 -- (-2211.866) [-2211.385] (-2218.596) (-2217.601) * [-2207.124] (-2210.941) (-2209.715) (-2215.037) -- 0:02:06
587000 -- [-2206.984] (-2206.615) (-2207.671) (-2213.008) * (-2211.868) (-2220.753) (-2213.114) [-2208.834] -- 0:02:05
587500 -- [-2208.756] (-2205.440) (-2227.696) (-2229.932) * (-2221.340) (-2230.444) [-2207.831] (-2206.688) -- 0:02:05
588000 -- (-2217.256) (-2217.663) [-2200.460] (-2216.492) * (-2211.966) [-2202.940] (-2210.488) (-2209.857) -- 0:02:06
588500 -- (-2209.694) [-2209.614] (-2204.267) (-2218.453) * (-2209.936) [-2202.276] (-2223.462) (-2216.265) -- 0:02:05
589000 -- (-2219.775) (-2219.321) [-2200.147] (-2213.444) * (-2202.754) (-2219.642) (-2208.909) [-2212.463] -- 0:02:05
589500 -- (-2210.998) [-2210.633] (-2216.855) (-2218.674) * (-2199.052) [-2214.893] (-2211.821) (-2219.819) -- 0:02:05
590000 -- [-2214.272] (-2217.599) (-2205.535) (-2228.474) * (-2204.184) (-2207.716) [-2217.422] (-2219.887) -- 0:02:05
Average standard deviation of split frequencies: 0.009364
590500 -- (-2226.639) (-2206.420) [-2206.033] (-2221.358) * (-2214.554) (-2216.108) (-2212.768) [-2220.327] -- 0:02:04
591000 -- (-2215.152) (-2210.730) (-2202.259) [-2203.663] * (-2208.774) (-2226.769) (-2214.163) [-2203.829] -- 0:02:04
591500 -- (-2207.932) (-2210.046) (-2208.441) [-2200.728] * [-2208.485] (-2231.115) (-2212.927) (-2206.888) -- 0:02:05
592000 -- (-2207.359) (-2208.875) (-2212.870) [-2201.437] * (-2204.245) (-2212.263) (-2212.967) [-2199.789] -- 0:02:04
592500 -- (-2206.961) (-2208.120) [-2202.337] (-2218.470) * (-2204.109) (-2207.061) [-2216.344] (-2211.598) -- 0:02:04
593000 -- (-2210.462) (-2227.078) [-2208.630] (-2205.660) * [-2217.595] (-2209.578) (-2222.404) (-2214.197) -- 0:02:04
593500 -- (-2215.831) (-2207.405) [-2223.277] (-2210.049) * (-2219.953) [-2227.535] (-2212.203) (-2223.288) -- 0:02:03
594000 -- (-2212.365) (-2209.090) (-2219.032) [-2213.405] * (-2211.469) (-2232.839) (-2208.554) [-2211.086] -- 0:02:03
594500 -- [-2215.189] (-2209.556) (-2215.571) (-2215.883) * (-2208.023) (-2211.631) [-2211.042] (-2211.988) -- 0:02:03
595000 -- (-2216.826) (-2209.630) [-2226.796] (-2215.232) * (-2211.505) [-2211.725] (-2216.895) (-2212.974) -- 0:02:03
Average standard deviation of split frequencies: 0.009333
595500 -- (-2217.602) (-2221.626) (-2223.493) [-2208.687] * (-2215.211) (-2217.256) [-2204.355] (-2220.959) -- 0:02:03
596000 -- (-2224.910) (-2212.506) [-2209.051] (-2216.765) * (-2210.963) [-2222.855] (-2227.769) (-2210.922) -- 0:02:03
596500 -- (-2207.000) (-2217.078) [-2215.457] (-2221.518) * (-2207.183) (-2213.054) [-2209.709] (-2211.678) -- 0:02:03
597000 -- (-2211.135) (-2216.251) (-2211.253) [-2208.995] * (-2214.604) (-2226.190) [-2201.189] (-2218.398) -- 0:02:02
597500 -- [-2210.048] (-2207.868) (-2231.566) (-2214.268) * (-2202.965) (-2233.378) [-2215.128] (-2204.755) -- 0:02:02
598000 -- (-2203.676) [-2209.481] (-2210.588) (-2220.828) * (-2201.185) (-2218.501) [-2210.565] (-2207.837) -- 0:02:02
598500 -- [-2210.437] (-2223.379) (-2213.291) (-2221.221) * (-2214.860) (-2223.543) (-2203.007) [-2212.801] -- 0:02:02
599000 -- (-2206.962) (-2222.266) [-2205.458] (-2208.410) * [-2212.987] (-2223.480) (-2211.972) (-2222.748) -- 0:02:02
599500 -- [-2213.574] (-2218.879) (-2211.103) (-2212.615) * (-2221.713) [-2217.917] (-2203.324) (-2218.043) -- 0:02:02
600000 -- [-2210.665] (-2208.062) (-2220.630) (-2210.391) * (-2217.763) [-2207.423] (-2206.754) (-2221.845) -- 0:02:02
Average standard deviation of split frequencies: 0.010098
600500 -- [-2218.569] (-2211.639) (-2210.555) (-2222.013) * (-2224.857) [-2218.517] (-2207.772) (-2218.261) -- 0:02:01
601000 -- (-2219.842) [-2206.196] (-2209.662) (-2205.642) * [-2206.776] (-2219.198) (-2211.397) (-2211.770) -- 0:02:01
601500 -- (-2216.200) (-2213.904) [-2213.873] (-2206.063) * (-2210.455) (-2206.993) [-2209.528] (-2208.749) -- 0:02:01
602000 -- (-2225.837) [-2207.972] (-2207.614) (-2212.654) * (-2215.737) (-2214.917) [-2205.863] (-2217.153) -- 0:02:00
602500 -- (-2217.036) (-2214.222) (-2210.602) [-2209.105] * [-2212.433] (-2211.724) (-2209.991) (-2210.933) -- 0:02:01
603000 -- [-2216.968] (-2210.954) (-2216.653) (-2207.011) * [-2201.760] (-2216.409) (-2211.682) (-2221.537) -- 0:02:01
603500 -- (-2215.368) (-2222.497) [-2210.072] (-2211.852) * (-2207.661) [-2206.651] (-2217.989) (-2234.165) -- 0:02:00
604000 -- (-2207.771) (-2210.697) (-2223.864) [-2208.336] * (-2214.866) (-2219.665) [-2213.730] (-2219.415) -- 0:02:00
604500 -- (-2213.736) (-2217.181) (-2211.103) [-2210.794] * [-2211.336] (-2217.009) (-2216.928) (-2207.754) -- 0:02:00
605000 -- (-2213.465) (-2218.245) (-2210.312) [-2208.322] * [-2204.210] (-2211.663) (-2207.722) (-2208.571) -- 0:02:00
Average standard deviation of split frequencies: 0.008712
605500 -- (-2214.176) [-2214.203] (-2211.622) (-2217.507) * [-2212.311] (-2209.624) (-2217.327) (-2207.604) -- 0:01:59
606000 -- [-2204.407] (-2210.271) (-2208.460) (-2220.135) * (-2216.105) (-2210.238) [-2204.248] (-2213.983) -- 0:02:00
606500 -- [-2206.828] (-2223.880) (-2214.125) (-2227.554) * (-2212.000) (-2206.178) (-2216.372) [-2206.575] -- 0:02:00
607000 -- (-2207.520) (-2210.982) [-2206.003] (-2227.930) * (-2215.089) [-2209.000] (-2201.554) (-2208.885) -- 0:01:59
607500 -- [-2211.593] (-2204.486) (-2205.316) (-2227.091) * [-2210.590] (-2214.522) (-2210.031) (-2207.484) -- 0:01:59
608000 -- (-2217.652) (-2213.848) [-2216.041] (-2223.464) * (-2214.026) (-2207.302) [-2211.771] (-2220.801) -- 0:01:59
608500 -- (-2222.715) (-2216.315) [-2206.321] (-2207.834) * (-2204.385) [-2210.986] (-2215.080) (-2216.943) -- 0:01:59
609000 -- (-2208.790) [-2206.804] (-2207.698) (-2216.178) * (-2215.777) [-2204.226] (-2203.566) (-2225.372) -- 0:01:58
609500 -- [-2199.599] (-2209.872) (-2212.279) (-2213.543) * (-2225.084) (-2214.063) [-2201.751] (-2231.925) -- 0:01:59
610000 -- (-2211.288) [-2211.652] (-2222.778) (-2210.638) * [-2206.097] (-2214.655) (-2220.149) (-2216.662) -- 0:01:58
Average standard deviation of split frequencies: 0.007359
610500 -- (-2215.629) [-2207.837] (-2212.723) (-2209.255) * [-2208.898] (-2211.820) (-2214.277) (-2208.656) -- 0:01:58
611000 -- (-2220.440) (-2210.464) [-2203.409] (-2210.438) * [-2207.173] (-2217.728) (-2222.158) (-2209.481) -- 0:01:58
611500 -- (-2225.251) (-2211.919) [-2218.656] (-2215.641) * (-2205.626) (-2211.697) (-2226.303) [-2199.872] -- 0:01:58
612000 -- (-2221.415) (-2213.128) [-2210.529] (-2220.651) * [-2201.810] (-2210.942) (-2221.952) (-2206.115) -- 0:01:57
612500 -- (-2228.082) [-2212.902] (-2213.487) (-2216.711) * (-2202.409) (-2229.948) (-2209.256) [-2202.735] -- 0:01:57
613000 -- (-2212.933) [-2209.896] (-2209.449) (-2216.865) * [-2213.085] (-2216.880) (-2214.867) (-2205.007) -- 0:01:58
613500 -- [-2207.448] (-2220.747) (-2224.317) (-2205.154) * (-2221.889) (-2217.412) (-2221.410) [-2204.519] -- 0:01:57
614000 -- (-2214.997) (-2222.000) (-2219.667) [-2209.867] * (-2206.072) (-2210.398) (-2214.134) [-2204.352] -- 0:01:57
614500 -- (-2210.208) (-2214.399) [-2208.752] (-2213.083) * (-2208.510) (-2229.046) (-2208.285) [-2224.322] -- 0:01:57
615000 -- [-2210.985] (-2208.985) (-2209.210) (-2208.906) * [-2208.504] (-2202.366) (-2214.630) (-2224.330) -- 0:01:57
Average standard deviation of split frequencies: 0.007245
615500 -- (-2217.385) (-2209.769) [-2202.852] (-2216.484) * (-2209.528) (-2210.691) [-2213.837] (-2220.972) -- 0:01:56
616000 -- (-2214.803) (-2207.828) (-2204.818) [-2215.071] * [-2200.612] (-2206.510) (-2209.209) (-2212.492) -- 0:01:57
616500 -- (-2220.173) (-2212.022) (-2213.392) [-2218.891] * (-2203.932) (-2220.311) [-2209.946] (-2213.480) -- 0:01:56
617000 -- [-2208.297] (-2198.994) (-2208.137) (-2218.570) * (-2209.747) (-2214.700) [-2207.350] (-2207.587) -- 0:01:56
617500 -- [-2208.099] (-2209.173) (-2210.142) (-2219.791) * [-2211.079] (-2206.377) (-2212.436) (-2212.701) -- 0:01:56
618000 -- [-2209.662] (-2209.550) (-2218.161) (-2219.913) * (-2211.601) (-2220.219) (-2212.793) [-2220.976] -- 0:01:56
618500 -- (-2209.803) (-2213.329) [-2203.405] (-2218.512) * (-2206.711) (-2212.837) (-2207.135) [-2210.330] -- 0:01:55
619000 -- [-2206.595] (-2209.189) (-2209.442) (-2245.540) * (-2214.934) (-2216.337) [-2202.024] (-2213.425) -- 0:01:55
619500 -- (-2222.778) (-2217.827) [-2215.785] (-2224.266) * (-2216.358) (-2213.504) (-2211.573) [-2210.353] -- 0:01:56
620000 -- [-2202.004] (-2214.834) (-2217.862) (-2217.555) * (-2212.869) (-2216.118) [-2210.559] (-2207.805) -- 0:01:55
Average standard deviation of split frequencies: 0.006734
620500 -- (-2209.756) (-2216.523) (-2209.429) [-2210.133] * (-2218.309) [-2209.851] (-2215.996) (-2208.769) -- 0:01:55
621000 -- (-2216.724) (-2201.908) [-2205.456] (-2218.618) * [-2210.032] (-2216.837) (-2214.557) (-2219.943) -- 0:01:55
621500 -- (-2209.709) [-2204.001] (-2221.407) (-2211.349) * (-2219.564) [-2207.279] (-2212.840) (-2206.545) -- 0:01:55
622000 -- (-2226.312) (-2204.588) [-2209.727] (-2215.214) * (-2224.813) [-2211.282] (-2214.169) (-2203.827) -- 0:01:54
622500 -- (-2216.083) (-2202.311) (-2202.556) [-2209.633] * (-2220.208) (-2205.925) (-2207.971) [-2208.513] -- 0:01:54
623000 -- [-2217.633] (-2205.597) (-2211.881) (-2207.251) * [-2209.433] (-2210.393) (-2219.085) (-2205.756) -- 0:01:54
623500 -- (-2216.699) [-2207.060] (-2210.164) (-2218.871) * (-2227.295) [-2199.912] (-2215.004) (-2215.278) -- 0:01:54
624000 -- (-2212.355) (-2219.662) (-2210.053) [-2216.904] * [-2215.408] (-2208.167) (-2211.899) (-2214.711) -- 0:01:54
624500 -- [-2213.065] (-2211.225) (-2206.241) (-2224.302) * (-2215.529) (-2208.735) [-2206.669] (-2209.355) -- 0:01:54
625000 -- [-2208.863] (-2208.240) (-2224.836) (-2214.746) * (-2209.713) [-2215.488] (-2232.511) (-2206.932) -- 0:01:54
Average standard deviation of split frequencies: 0.007129
625500 -- (-2217.393) [-2209.249] (-2225.593) (-2210.684) * (-2211.719) (-2206.754) (-2219.578) [-2204.675] -- 0:01:53
626000 -- (-2218.623) (-2210.144) [-2208.870] (-2204.318) * (-2217.545) [-2203.719] (-2222.858) (-2205.809) -- 0:01:53
626500 -- [-2211.812] (-2219.802) (-2210.869) (-2210.481) * (-2215.139) [-2202.562] (-2215.827) (-2212.506) -- 0:01:53
627000 -- (-2217.063) [-2219.027] (-2210.824) (-2217.733) * (-2226.509) (-2223.222) (-2207.584) [-2210.561] -- 0:01:53
627500 -- [-2211.161] (-2213.127) (-2215.814) (-2225.340) * [-2209.864] (-2213.695) (-2229.364) (-2209.671) -- 0:01:53
628000 -- (-2216.186) [-2214.629] (-2223.604) (-2237.915) * [-2206.061] (-2209.504) (-2218.640) (-2221.254) -- 0:01:53
628500 -- (-2206.352) [-2217.471] (-2221.545) (-2225.594) * [-2203.985] (-2209.858) (-2223.722) (-2215.007) -- 0:01:52
629000 -- (-2214.063) [-2206.868] (-2213.483) (-2222.694) * [-2208.039] (-2225.247) (-2215.192) (-2207.646) -- 0:01:52
629500 -- [-2212.719] (-2221.537) (-2211.546) (-2226.101) * [-2207.548] (-2209.456) (-2218.780) (-2212.463) -- 0:01:52
630000 -- (-2211.209) [-2210.552] (-2215.587) (-2222.655) * (-2211.985) [-2205.030] (-2224.811) (-2205.122) -- 0:01:52
Average standard deviation of split frequencies: 0.006777
630500 -- (-2212.637) (-2206.022) [-2220.105] (-2217.248) * (-2216.233) (-2208.633) (-2218.171) [-2204.009] -- 0:01:52
631000 -- (-2220.052) (-2219.534) [-2210.793] (-2225.517) * (-2211.957) (-2218.190) (-2217.658) [-2205.354] -- 0:01:52
631500 -- (-2216.455) [-2210.414] (-2208.084) (-2224.618) * (-2202.584) [-2212.265] (-2210.278) (-2208.397) -- 0:01:52
632000 -- (-2210.872) (-2226.059) [-2204.405] (-2214.812) * (-2219.164) (-2211.379) (-2223.842) [-2202.930] -- 0:01:51
632500 -- (-2211.187) (-2213.598) [-2208.154] (-2210.547) * (-2221.470) [-2205.213] (-2205.918) (-2208.849) -- 0:01:51
633000 -- (-2214.831) (-2231.833) [-2204.762] (-2226.442) * (-2210.531) [-2208.608] (-2214.291) (-2205.136) -- 0:01:51
633500 -- [-2233.078] (-2234.913) (-2214.872) (-2202.647) * (-2209.712) [-2203.565] (-2213.945) (-2211.466) -- 0:01:51
634000 -- (-2207.896) (-2214.401) (-2212.724) [-2209.675] * (-2214.491) [-2207.271] (-2212.271) (-2223.198) -- 0:01:51
634500 -- (-2211.442) (-2224.445) (-2206.395) [-2214.401] * (-2218.873) (-2215.467) [-2215.489] (-2216.082) -- 0:01:51
635000 -- [-2207.228] (-2224.505) (-2215.302) (-2208.246) * (-2208.894) (-2221.975) [-2211.944] (-2206.246) -- 0:01:50
Average standard deviation of split frequencies: 0.006671
635500 -- (-2203.473) (-2213.532) (-2216.455) [-2210.969] * (-2208.406) (-2217.296) (-2218.789) [-2217.124] -- 0:01:50
636000 -- (-2220.188) [-2232.797] (-2213.520) (-2219.167) * (-2210.481) [-2204.099] (-2211.213) (-2211.997) -- 0:01:50
636500 -- (-2219.395) (-2228.808) (-2215.950) [-2208.897] * (-2210.277) [-2206.693] (-2211.115) (-2229.315) -- 0:01:50
637000 -- [-2211.163] (-2220.040) (-2220.187) (-2210.141) * (-2218.050) [-2205.943] (-2212.352) (-2213.805) -- 0:01:50
637500 -- (-2211.404) (-2211.262) (-2223.385) [-2215.799] * [-2209.834] (-2214.260) (-2218.308) (-2224.546) -- 0:01:50
638000 -- (-2202.840) (-2220.439) [-2214.024] (-2228.341) * [-2202.821] (-2203.892) (-2215.171) (-2215.224) -- 0:01:50
638500 -- [-2206.289] (-2210.565) (-2216.677) (-2211.544) * [-2205.687] (-2216.215) (-2211.009) (-2203.131) -- 0:01:49
639000 -- (-2210.672) (-2215.933) (-2210.784) [-2206.912] * (-2211.746) (-2215.329) (-2214.393) [-2205.660] -- 0:01:49
639500 -- (-2214.754) (-2213.449) (-2204.093) [-2204.959] * [-2208.824] (-2212.978) (-2207.540) (-2209.836) -- 0:01:49
640000 -- [-2199.256] (-2220.532) (-2207.777) (-2214.521) * [-2210.565] (-2217.971) (-2206.617) (-2210.040) -- 0:01:49
Average standard deviation of split frequencies: 0.006377
640500 -- [-2213.057] (-2215.626) (-2206.765) (-2212.828) * [-2207.188] (-2202.969) (-2214.815) (-2207.614) -- 0:01:49
641000 -- (-2215.399) (-2208.643) (-2225.774) [-2208.786] * [-2212.544] (-2211.114) (-2208.680) (-2210.016) -- 0:01:49
641500 -- (-2210.656) [-2210.124] (-2217.958) (-2205.287) * (-2213.544) (-2216.597) (-2226.990) [-2215.010] -- 0:01:48
642000 -- [-2205.621] (-2206.953) (-2211.131) (-2225.407) * (-2207.537) (-2212.135) (-2211.140) [-2206.800] -- 0:01:48
642500 -- (-2206.914) [-2202.838] (-2217.538) (-2222.611) * [-2207.069] (-2211.061) (-2216.784) (-2214.723) -- 0:01:49
643000 -- (-2217.134) [-2210.476] (-2213.596) (-2210.468) * [-2209.066] (-2230.790) (-2212.603) (-2203.950) -- 0:01:48
643500 -- [-2205.037] (-2214.690) (-2207.353) (-2214.492) * [-2205.407] (-2205.194) (-2207.515) (-2220.691) -- 0:01:48
644000 -- (-2219.457) (-2218.630) [-2211.587] (-2211.113) * (-2207.506) [-2206.345] (-2209.012) (-2219.729) -- 0:01:48
644500 -- (-2218.249) (-2215.653) [-2205.555] (-2210.663) * [-2211.954] (-2207.751) (-2212.169) (-2214.825) -- 0:01:48
645000 -- [-2203.494] (-2210.305) (-2206.707) (-2215.343) * (-2211.609) (-2213.395) (-2223.109) [-2209.704] -- 0:01:47
Average standard deviation of split frequencies: 0.005838
645500 -- (-2213.258) [-2207.130] (-2207.248) (-2203.464) * (-2207.658) (-2218.470) (-2210.419) [-2207.995] -- 0:01:47
646000 -- [-2208.849] (-2220.655) (-2214.630) (-2219.004) * (-2211.464) (-2214.202) (-2217.094) [-2208.771] -- 0:01:47
646500 -- (-2216.395) (-2208.607) [-2214.267] (-2214.951) * (-2215.017) [-2213.085] (-2207.993) (-2214.393) -- 0:01:47
647000 -- (-2204.611) (-2223.852) (-2214.846) [-2214.257] * (-2210.768) [-2211.613] (-2210.744) (-2203.162) -- 0:01:47
647500 -- [-2214.556] (-2212.595) (-2223.920) (-2211.232) * (-2220.230) (-2207.890) [-2215.050] (-2207.986) -- 0:01:47
648000 -- [-2226.388] (-2218.445) (-2217.090) (-2212.139) * [-2209.109] (-2205.909) (-2206.239) (-2204.117) -- 0:01:47
648500 -- (-2233.015) (-2217.176) [-2215.481] (-2224.514) * (-2212.877) (-2232.876) (-2208.047) [-2208.143] -- 0:01:47
649000 -- [-2221.778] (-2219.266) (-2214.001) (-2209.379) * [-2209.301] (-2226.633) (-2207.326) (-2221.349) -- 0:01:47
649500 -- (-2214.097) (-2208.620) (-2221.219) [-2208.496] * [-2212.645] (-2213.441) (-2206.523) (-2220.668) -- 0:01:46
650000 -- (-2209.839) [-2213.565] (-2212.684) (-2209.036) * (-2212.462) (-2217.163) [-2209.172] (-2231.978) -- 0:01:46
Average standard deviation of split frequencies: 0.005989
650500 -- (-2203.554) [-2217.851] (-2212.613) (-2221.292) * [-2207.960] (-2224.220) (-2205.948) (-2212.694) -- 0:01:46
651000 -- (-2212.054) [-2206.728] (-2213.876) (-2220.476) * (-2212.088) (-2214.530) [-2200.917] (-2213.764) -- 0:01:46
651500 -- (-2213.883) [-2209.419] (-2214.780) (-2217.447) * (-2223.750) (-2213.839) (-2212.384) [-2207.909] -- 0:01:46
652000 -- [-2206.614] (-2204.968) (-2202.052) (-2212.753) * (-2207.633) [-2214.013] (-2214.820) (-2206.929) -- 0:01:46
652500 -- [-2197.339] (-2205.886) (-2221.162) (-2208.885) * (-2220.348) (-2219.080) [-2213.449] (-2207.567) -- 0:01:45
653000 -- (-2204.942) (-2216.747) (-2214.540) [-2204.527] * (-2214.183) (-2219.835) [-2213.171] (-2213.979) -- 0:01:45
653500 -- (-2223.660) [-2202.457] (-2212.645) (-2208.404) * (-2213.214) (-2218.722) (-2222.063) [-2209.308] -- 0:01:45
654000 -- (-2222.020) (-2206.468) [-2217.156] (-2212.896) * (-2212.040) (-2215.231) [-2207.178] (-2216.327) -- 0:01:45
654500 -- [-2221.907] (-2208.893) (-2220.557) (-2215.034) * (-2219.043) [-2209.725] (-2219.190) (-2223.289) -- 0:01:45
655000 -- (-2216.852) [-2217.727] (-2216.101) (-2214.171) * [-2212.217] (-2218.537) (-2221.304) (-2218.266) -- 0:01:45
Average standard deviation of split frequencies: 0.005845
655500 -- (-2208.520) [-2201.176] (-2214.714) (-2216.298) * (-2212.517) (-2209.380) (-2219.748) [-2205.356] -- 0:01:45
656000 -- [-2212.770] (-2217.626) (-2214.198) (-2221.418) * (-2210.498) (-2217.220) (-2218.616) [-2215.349] -- 0:01:44
656500 -- (-2210.968) (-2212.166) (-2205.930) [-2212.839] * (-2211.890) (-2222.117) (-2214.219) [-2212.018] -- 0:01:44
657000 -- (-2215.769) (-2224.375) [-2215.172] (-2208.024) * (-2210.893) (-2209.578) (-2224.913) [-2218.250] -- 0:01:44
657500 -- (-2210.207) (-2207.131) (-2209.250) [-2211.107] * (-2220.820) [-2219.171] (-2217.024) (-2211.002) -- 0:01:44
658000 -- (-2210.957) (-2228.848) (-2217.143) [-2208.794] * (-2213.660) [-2209.392] (-2218.734) (-2220.659) -- 0:01:44
658500 -- (-2211.383) [-2209.180] (-2223.625) (-2211.138) * (-2209.996) (-2215.323) [-2206.529] (-2213.776) -- 0:01:44
659000 -- [-2203.134] (-2211.203) (-2209.106) (-2213.565) * [-2204.703] (-2207.200) (-2214.517) (-2221.875) -- 0:01:44
659500 -- [-2206.625] (-2219.285) (-2200.469) (-2225.166) * (-2215.589) (-2216.665) [-2214.725] (-2216.418) -- 0:01:43
660000 -- [-2208.338] (-2210.118) (-2222.777) (-2220.255) * [-2205.505] (-2201.150) (-2220.516) (-2214.320) -- 0:01:43
Average standard deviation of split frequencies: 0.006089
660500 -- (-2212.681) (-2213.444) [-2208.867] (-2216.746) * [-2215.122] (-2212.353) (-2216.701) (-2213.373) -- 0:01:43
661000 -- (-2209.712) (-2214.806) (-2208.803) [-2205.521] * (-2206.333) (-2210.738) [-2208.374] (-2211.440) -- 0:01:43
661500 -- (-2219.867) [-2205.705] (-2215.450) (-2211.597) * [-2203.962] (-2232.094) (-2216.707) (-2212.889) -- 0:01:43
662000 -- [-2208.971] (-2211.511) (-2212.550) (-2219.144) * [-2205.870] (-2217.983) (-2220.854) (-2201.183) -- 0:01:43
662500 -- [-2220.615] (-2220.878) (-2221.632) (-2210.830) * [-2212.441] (-2217.150) (-2213.328) (-2223.990) -- 0:01:42
663000 -- (-2221.622) (-2202.372) [-2213.028] (-2217.727) * (-2211.490) [-2203.214] (-2231.771) (-2219.385) -- 0:01:42
663500 -- (-2221.438) [-2203.530] (-2206.141) (-2204.328) * [-2201.464] (-2213.238) (-2218.054) (-2217.290) -- 0:01:42
664000 -- (-2216.255) [-2207.244] (-2213.344) (-2204.238) * (-2218.082) [-2217.163] (-2205.893) (-2214.863) -- 0:01:42
664500 -- (-2209.941) (-2205.695) (-2218.841) [-2212.188] * (-2213.275) (-2210.832) (-2212.369) [-2207.095] -- 0:01:41
665000 -- (-2216.127) (-2209.400) [-2215.986] (-2214.579) * (-2201.143) (-2215.052) (-2206.589) [-2202.614] -- 0:01:42
Average standard deviation of split frequencies: 0.006229
665500 -- [-2212.557] (-2210.598) (-2212.570) (-2219.775) * (-2204.014) (-2210.815) (-2208.496) [-2213.993] -- 0:01:42
666000 -- (-2219.890) (-2218.917) [-2203.703] (-2206.530) * (-2210.398) [-2211.746] (-2218.478) (-2216.697) -- 0:01:41
666500 -- (-2207.755) [-2209.432] (-2206.902) (-2210.952) * [-2202.675] (-2209.479) (-2210.537) (-2215.426) -- 0:01:41
667000 -- (-2214.080) (-2220.786) (-2207.001) [-2208.549] * (-2220.621) (-2216.316) (-2218.636) [-2221.274] -- 0:01:41
667500 -- (-2212.280) (-2212.662) [-2213.226] (-2218.270) * (-2211.253) [-2220.448] (-2218.370) (-2212.470) -- 0:01:41
668000 -- [-2214.486] (-2212.871) (-2214.592) (-2216.553) * (-2226.390) (-2221.409) [-2205.925] (-2207.510) -- 0:01:41
668500 -- (-2214.588) [-2204.413] (-2219.276) (-2216.299) * (-2213.417) (-2213.895) [-2204.270] (-2221.041) -- 0:01:41
669000 -- (-2211.093) [-2209.259] (-2211.277) (-2215.279) * (-2211.313) [-2210.760] (-2213.833) (-2216.899) -- 0:01:40
669500 -- [-2210.185] (-2212.757) (-2221.315) (-2209.463) * (-2213.386) (-2219.737) (-2199.904) [-2208.396] -- 0:01:40
670000 -- (-2215.760) [-2205.792] (-2211.976) (-2209.806) * (-2212.934) (-2220.684) (-2210.161) [-2208.340] -- 0:01:40
Average standard deviation of split frequencies: 0.005389
670500 -- (-2228.505) (-2207.880) [-2211.172] (-2213.111) * (-2210.386) (-2217.068) [-2209.918] (-2212.568) -- 0:01:40
671000 -- (-2208.739) (-2205.964) [-2208.625] (-2227.791) * [-2213.858] (-2207.537) (-2210.687) (-2225.956) -- 0:01:40
671500 -- (-2217.698) [-2203.652] (-2204.517) (-2208.003) * (-2218.035) (-2219.454) (-2211.558) [-2211.109] -- 0:01:40
672000 -- (-2232.149) [-2206.451] (-2212.656) (-2207.859) * (-2220.976) (-2201.360) (-2214.789) [-2210.069] -- 0:01:40
672500 -- (-2219.244) (-2220.650) [-2217.940] (-2220.069) * (-2217.785) [-2211.037] (-2227.243) (-2212.826) -- 0:01:39
673000 -- (-2210.866) (-2219.451) [-2208.365] (-2208.297) * (-2215.689) [-2200.953] (-2218.825) (-2219.202) -- 0:01:39
673500 -- (-2207.726) (-2209.638) (-2206.131) [-2208.956] * [-2213.016] (-2216.913) (-2227.725) (-2208.336) -- 0:01:39
674000 -- [-2207.391] (-2206.559) (-2214.006) (-2212.608) * (-2214.892) (-2220.003) [-2206.206] (-2211.993) -- 0:01:39
674500 -- (-2216.609) [-2209.675] (-2208.496) (-2208.610) * [-2212.533] (-2203.739) (-2211.470) (-2217.713) -- 0:01:39
675000 -- [-2207.188] (-2212.009) (-2219.617) (-2217.763) * [-2215.856] (-2208.450) (-2216.376) (-2211.008) -- 0:01:39
Average standard deviation of split frequencies: 0.005160
675500 -- (-2204.896) [-2206.838] (-2215.461) (-2209.267) * (-2217.743) [-2205.799] (-2213.774) (-2223.784) -- 0:01:38
676000 -- (-2210.009) [-2209.784] (-2206.261) (-2216.902) * (-2212.742) (-2213.214) (-2223.195) [-2209.738] -- 0:01:38
676500 -- [-2209.266] (-2209.013) (-2205.955) (-2216.408) * [-2207.322] (-2203.584) (-2215.806) (-2213.585) -- 0:01:38
677000 -- [-2215.458] (-2212.209) (-2204.019) (-2214.900) * (-2211.283) (-2216.498) [-2207.514] (-2222.574) -- 0:01:38
677500 -- (-2204.426) (-2211.323) [-2201.757] (-2218.409) * (-2212.907) [-2199.501] (-2210.674) (-2216.620) -- 0:01:38
678000 -- [-2201.770] (-2208.854) (-2209.809) (-2211.775) * [-2212.464] (-2214.755) (-2210.522) (-2208.839) -- 0:01:38
678500 -- (-2214.057) [-2211.177] (-2212.040) (-2215.337) * (-2215.059) (-2207.390) (-2217.676) [-2206.865] -- 0:01:38
679000 -- (-2204.286) (-2204.664) (-2217.160) [-2203.374] * (-2206.638) (-2211.170) [-2212.611] (-2214.308) -- 0:01:37
679500 -- [-2209.922] (-2212.683) (-2215.409) (-2219.307) * (-2210.246) [-2208.604] (-2204.448) (-2208.167) -- 0:01:37
680000 -- (-2219.275) [-2203.412] (-2212.017) (-2214.315) * [-2200.852] (-2218.183) (-2218.523) (-2215.082) -- 0:01:37
Average standard deviation of split frequencies: 0.004894
680500 -- (-2206.112) [-2211.770] (-2214.562) (-2226.973) * (-2216.331) (-2214.609) [-2207.330] (-2226.727) -- 0:01:37
681000 -- (-2210.572) (-2214.982) (-2217.186) [-2216.250] * [-2201.032] (-2208.324) (-2214.095) (-2202.950) -- 0:01:37
681500 -- (-2211.300) [-2208.742] (-2222.924) (-2219.855) * (-2213.292) [-2211.242] (-2214.467) (-2218.603) -- 0:01:37
682000 -- [-2205.843] (-2213.215) (-2217.785) (-2221.238) * (-2221.643) (-2204.329) [-2205.071] (-2209.733) -- 0:01:36
682500 -- [-2206.524] (-2225.044) (-2218.777) (-2227.389) * (-2221.757) [-2208.293] (-2211.897) (-2227.898) -- 0:01:36
683000 -- (-2212.880) (-2215.339) (-2204.948) [-2211.857] * [-2208.606] (-2218.519) (-2218.870) (-2214.690) -- 0:01:36
683500 -- (-2232.187) (-2215.125) [-2207.873] (-2218.022) * (-2210.228) (-2214.273) [-2213.253] (-2211.831) -- 0:01:36
684000 -- [-2208.062] (-2210.864) (-2218.460) (-2227.085) * (-2209.353) (-2207.937) (-2206.223) [-2212.541] -- 0:01:36
684500 -- (-2211.080) (-2216.429) (-2209.427) [-2209.500] * (-2213.492) [-2212.765] (-2207.066) (-2221.359) -- 0:01:35
685000 -- (-2225.124) (-2212.951) (-2223.427) [-2211.413] * (-2221.284) (-2214.543) [-2207.388] (-2217.357) -- 0:01:36
Average standard deviation of split frequencies: 0.005131
685500 -- [-2205.171] (-2221.757) (-2211.461) (-2213.308) * [-2210.931] (-2214.610) (-2223.870) (-2208.331) -- 0:01:35
686000 -- (-2208.723) (-2213.512) (-2212.845) [-2212.153] * (-2208.491) (-2204.591) [-2212.118] (-2227.406) -- 0:01:35
686500 -- [-2207.918] (-2210.359) (-2216.127) (-2224.365) * (-2239.198) (-2206.233) (-2212.399) [-2212.866] -- 0:01:35
687000 -- (-2212.000) (-2208.482) [-2215.281] (-2212.763) * [-2211.814] (-2220.540) (-2213.379) (-2209.543) -- 0:01:35
687500 -- [-2203.747] (-2219.630) (-2220.050) (-2208.079) * (-2220.886) (-2212.557) [-2210.228] (-2209.998) -- 0:01:35
688000 -- [-2207.264] (-2210.950) (-2207.038) (-2213.560) * (-2212.780) (-2217.034) (-2222.338) [-2206.158] -- 0:01:34
688500 -- (-2209.547) [-2207.961] (-2216.740) (-2209.941) * (-2223.322) [-2204.289] (-2209.780) (-2212.898) -- 0:01:35
689000 -- (-2217.767) (-2211.462) (-2217.391) [-2208.507] * (-2213.884) [-2205.022] (-2221.470) (-2215.591) -- 0:01:34
689500 -- [-2209.000] (-2215.467) (-2211.914) (-2208.714) * [-2202.642] (-2206.972) (-2226.247) (-2220.024) -- 0:01:34
690000 -- [-2206.970] (-2226.963) (-2210.714) (-2222.168) * [-2205.301] (-2219.697) (-2221.996) (-2210.337) -- 0:01:34
Average standard deviation of split frequencies: 0.004641
690500 -- [-2204.038] (-2212.847) (-2207.902) (-2206.603) * (-2208.728) (-2219.018) [-2204.716] (-2214.840) -- 0:01:34
691000 -- (-2211.001) [-2212.242] (-2217.664) (-2213.033) * (-2215.142) (-2213.090) [-2204.377] (-2222.932) -- 0:01:33
691500 -- (-2214.294) (-2227.099) [-2208.371] (-2207.037) * (-2213.944) [-2211.824] (-2225.539) (-2213.785) -- 0:01:33
692000 -- [-2211.393] (-2213.300) (-2214.819) (-2207.650) * (-2209.785) (-2209.702) (-2206.081) [-2209.533] -- 0:01:33
692500 -- (-2224.398) (-2215.774) (-2209.504) [-2205.282] * [-2211.426] (-2209.730) (-2211.830) (-2215.797) -- 0:01:33
693000 -- [-2205.659] (-2210.346) (-2210.884) (-2212.678) * (-2201.103) (-2210.928) [-2209.287] (-2207.060) -- 0:01:33
693500 -- (-2225.486) [-2206.988] (-2205.839) (-2216.355) * [-2215.529] (-2215.666) (-2212.845) (-2207.343) -- 0:01:33
694000 -- [-2211.369] (-2232.042) (-2218.502) (-2212.634) * [-2210.466] (-2208.648) (-2226.094) (-2207.473) -- 0:01:33
694500 -- [-2206.950] (-2227.361) (-2203.774) (-2210.655) * (-2219.431) [-2209.243] (-2204.350) (-2210.212) -- 0:01:33
695000 -- [-2217.919] (-2206.485) (-2207.155) (-2213.138) * [-2211.332] (-2211.830) (-2219.383) (-2220.362) -- 0:01:33
Average standard deviation of split frequencies: 0.004741
695500 -- (-2221.485) [-2205.029] (-2204.141) (-2219.394) * (-2213.326) (-2204.025) [-2212.001] (-2207.445) -- 0:01:32
696000 -- (-2217.527) [-2208.676] (-2207.021) (-2215.654) * [-2209.256] (-2201.193) (-2217.956) (-2216.314) -- 0:01:32
696500 -- [-2210.878] (-2205.214) (-2212.458) (-2208.995) * (-2218.037) (-2220.149) (-2215.641) [-2201.603] -- 0:01:32
697000 -- (-2207.417) (-2207.103) [-2208.939] (-2217.035) * (-2208.878) [-2212.929] (-2210.572) (-2214.188) -- 0:01:32
697500 -- (-2202.137) (-2212.648) (-2215.373) [-2206.490] * (-2210.310) (-2206.207) [-2202.599] (-2228.268) -- 0:01:32
698000 -- [-2210.833] (-2213.198) (-2211.511) (-2207.034) * (-2216.275) (-2223.036) [-2214.043] (-2211.608) -- 0:01:32
698500 -- (-2220.737) [-2209.550] (-2231.243) (-2207.135) * (-2207.659) (-2215.996) (-2206.416) [-2199.913] -- 0:01:31
699000 -- [-2201.829] (-2222.670) (-2219.338) (-2208.511) * (-2207.645) (-2216.590) [-2209.839] (-2225.444) -- 0:01:31
699500 -- (-2204.999) (-2220.223) (-2219.160) [-2211.333] * [-2205.785] (-2209.745) (-2208.408) (-2212.936) -- 0:01:31
700000 -- (-2202.205) [-2206.320] (-2210.605) (-2203.440) * (-2216.471) (-2218.922) (-2207.778) [-2215.688] -- 0:01:31
Average standard deviation of split frequencies: 0.004979
700500 -- (-2206.655) (-2215.592) (-2223.600) [-2212.019] * (-2226.003) [-2206.959] (-2209.284) (-2210.673) -- 0:01:31
701000 -- (-2215.272) (-2226.562) (-2203.712) [-2211.244] * (-2209.911) (-2206.398) (-2213.482) [-2223.557] -- 0:01:31
701500 -- (-2207.129) (-2230.734) (-2203.475) [-2205.100] * [-2214.025] (-2209.081) (-2218.104) (-2211.481) -- 0:01:31
702000 -- (-2204.122) (-2212.309) (-2224.247) [-2205.089] * (-2210.258) [-2204.488] (-2209.280) (-2230.847) -- 0:01:30
702500 -- (-2209.497) (-2228.294) (-2226.303) [-2205.626] * (-2210.184) (-2208.215) [-2206.626] (-2215.242) -- 0:01:30
703000 -- (-2225.801) (-2222.355) (-2224.349) [-2204.340] * (-2208.945) (-2206.729) (-2203.474) [-2212.818] -- 0:01:30
703500 -- (-2216.329) (-2213.953) (-2217.492) [-2204.939] * [-2202.302] (-2209.375) (-2212.116) (-2215.353) -- 0:01:30
704000 -- (-2218.850) [-2203.133] (-2212.263) (-2212.823) * [-2212.577] (-2210.610) (-2215.505) (-2218.478) -- 0:01:30
704500 -- (-2218.450) [-2208.602] (-2224.670) (-2219.858) * (-2208.289) [-2218.234] (-2215.873) (-2224.087) -- 0:01:30
705000 -- (-2218.238) (-2229.005) (-2220.929) [-2206.327] * (-2212.737) [-2208.092] (-2206.481) (-2213.720) -- 0:01:29
Average standard deviation of split frequencies: 0.005253
705500 -- (-2224.131) (-2218.811) (-2217.834) [-2202.757] * (-2209.781) [-2204.550] (-2213.582) (-2218.767) -- 0:01:29
706000 -- [-2216.088] (-2210.183) (-2234.365) (-2209.603) * (-2204.547) (-2226.868) [-2213.726] (-2211.397) -- 0:01:29
706500 -- (-2216.292) [-2209.217] (-2231.655) (-2210.202) * (-2217.141) [-2206.851] (-2214.877) (-2231.479) -- 0:01:29
707000 -- (-2214.749) (-2211.141) [-2202.632] (-2225.246) * [-2211.131] (-2207.329) (-2222.360) (-2215.380) -- 0:01:29
707500 -- (-2207.756) (-2212.890) [-2204.164] (-2222.391) * [-2206.693] (-2207.160) (-2211.329) (-2207.770) -- 0:01:29
708000 -- (-2218.143) (-2205.799) (-2208.942) [-2207.989] * (-2222.529) (-2210.235) (-2211.061) [-2207.066] -- 0:01:29
708500 -- (-2206.983) (-2212.011) [-2202.648] (-2205.039) * (-2209.352) (-2220.008) [-2201.567] (-2217.291) -- 0:01:28
709000 -- (-2222.957) [-2215.202] (-2212.334) (-2209.234) * (-2210.295) [-2203.810] (-2208.266) (-2221.146) -- 0:01:28
709500 -- [-2202.964] (-2220.667) (-2219.552) (-2203.691) * (-2212.387) (-2207.539) [-2209.079] (-2222.042) -- 0:01:28
710000 -- (-2214.571) (-2210.424) (-2233.755) [-2201.773] * (-2209.281) (-2210.462) [-2205.710] (-2208.532) -- 0:01:28
Average standard deviation of split frequencies: 0.004997
710500 -- (-2216.831) [-2205.384] (-2226.625) (-2210.673) * (-2205.963) (-2210.054) (-2216.199) [-2210.123] -- 0:01:28
711000 -- (-2214.199) (-2216.510) (-2220.949) [-2205.128] * (-2215.851) (-2215.017) [-2203.167] (-2213.232) -- 0:01:28
711500 -- (-2209.112) (-2206.177) (-2212.699) [-2205.312] * (-2206.650) (-2220.518) (-2214.749) [-2206.467] -- 0:01:27
712000 -- [-2213.104] (-2210.821) (-2233.749) (-2207.129) * [-2210.881] (-2217.925) (-2206.915) (-2211.465) -- 0:01:27
712500 -- (-2232.118) [-2206.840] (-2239.551) (-2212.448) * (-2212.772) [-2208.866] (-2217.367) (-2206.544) -- 0:01:27
713000 -- [-2215.306] (-2214.653) (-2212.988) (-2216.335) * [-2221.163] (-2217.233) (-2228.486) (-2212.212) -- 0:01:27
713500 -- (-2223.277) [-2206.301] (-2215.452) (-2207.321) * [-2210.854] (-2205.221) (-2230.129) (-2219.473) -- 0:01:27
714000 -- (-2219.060) [-2206.145] (-2226.707) (-2216.090) * [-2214.509] (-2226.064) (-2223.096) (-2211.224) -- 0:01:27
714500 -- (-2218.325) (-2217.408) [-2210.047] (-2226.394) * (-2211.933) (-2217.983) (-2237.570) [-2203.412] -- 0:01:27
715000 -- (-2219.763) (-2227.933) [-2212.255] (-2224.851) * (-2208.003) (-2214.034) [-2210.002] (-2213.389) -- 0:01:26
Average standard deviation of split frequencies: 0.005223
715500 -- [-2208.299] (-2220.178) (-2206.897) (-2211.922) * (-2210.719) (-2222.416) [-2208.913] (-2222.040) -- 0:01:26
716000 -- (-2208.098) [-2210.452] (-2216.407) (-2219.854) * (-2211.218) (-2206.377) (-2222.755) [-2212.230] -- 0:01:26
716500 -- (-2209.079) [-2212.694] (-2199.865) (-2207.750) * (-2209.874) (-2204.995) (-2209.780) [-2210.609] -- 0:01:26
717000 -- (-2216.769) (-2226.135) (-2203.869) [-2203.569] * (-2206.272) [-2210.233] (-2221.239) (-2218.961) -- 0:01:26
717500 -- (-2210.632) (-2217.750) (-2221.120) [-2210.169] * (-2214.919) [-2211.485] (-2227.565) (-2207.175) -- 0:01:26
718000 -- (-2223.900) (-2202.936) [-2204.724] (-2208.071) * (-2226.060) (-2215.991) (-2223.360) [-2213.477] -- 0:01:26
718500 -- (-2207.617) (-2214.049) (-2203.394) [-2209.605] * (-2224.614) [-2197.820] (-2212.197) (-2216.492) -- 0:01:25
719000 -- (-2216.397) (-2213.354) (-2208.350) [-2213.212] * (-2211.348) (-2214.057) (-2204.632) [-2210.263] -- 0:01:25
719500 -- (-2219.543) [-2201.679] (-2205.296) (-2208.280) * (-2229.413) (-2231.043) [-2202.491] (-2210.087) -- 0:01:25
720000 -- (-2215.524) (-2206.164) [-2213.388] (-2210.160) * (-2208.805) (-2211.377) (-2208.933) [-2208.889] -- 0:01:25
Average standard deviation of split frequencies: 0.005538
720500 -- (-2220.017) (-2213.923) [-2214.943] (-2220.126) * [-2209.673] (-2212.586) (-2218.689) (-2216.068) -- 0:01:25
721000 -- (-2214.460) [-2209.615] (-2210.039) (-2207.945) * [-2207.539] (-2209.905) (-2214.078) (-2208.821) -- 0:01:25
721500 -- (-2209.138) [-2205.200] (-2212.726) (-2214.617) * (-2205.259) (-2210.462) [-2201.650] (-2216.916) -- 0:01:24
722000 -- (-2211.265) (-2208.785) (-2213.136) [-2206.696] * (-2205.626) (-2217.716) (-2203.915) [-2216.100] -- 0:01:24
722500 -- (-2214.012) [-2204.274] (-2212.582) (-2216.013) * [-2211.234] (-2222.329) (-2213.661) (-2213.440) -- 0:01:24
723000 -- [-2208.123] (-2218.644) (-2215.772) (-2211.104) * (-2210.640) (-2211.712) (-2211.689) [-2204.885] -- 0:01:24
723500 -- (-2208.093) [-2222.968] (-2227.165) (-2205.122) * (-2207.424) (-2222.538) (-2204.970) [-2216.555] -- 0:01:24
724000 -- (-2208.026) [-2201.309] (-2220.913) (-2231.806) * (-2202.754) (-2234.148) [-2207.477] (-2215.908) -- 0:01:24
724500 -- (-2205.830) [-2204.994] (-2216.451) (-2206.408) * (-2219.846) (-2236.518) [-2205.833] (-2222.813) -- 0:01:24
725000 -- (-2219.113) (-2224.973) [-2209.135] (-2209.044) * (-2206.547) [-2217.207] (-2202.560) (-2220.623) -- 0:01:23
Average standard deviation of split frequencies: 0.005801
725500 -- [-2207.379] (-2206.742) (-2219.610) (-2215.378) * (-2209.908) (-2218.561) [-2209.507] (-2218.157) -- 0:01:23
726000 -- (-2216.683) [-2209.413] (-2211.589) (-2215.501) * (-2207.773) (-2211.131) (-2222.259) [-2214.396] -- 0:01:23
726500 -- (-2221.193) [-2206.587] (-2221.188) (-2219.474) * (-2218.061) (-2214.747) (-2213.996) [-2208.584] -- 0:01:23
727000 -- (-2215.685) [-2211.655] (-2217.444) (-2206.014) * (-2215.153) [-2210.885] (-2218.927) (-2221.240) -- 0:01:22
727500 -- (-2208.801) (-2211.041) [-2209.053] (-2213.330) * [-2205.904] (-2218.048) (-2227.801) (-2209.965) -- 0:01:23
728000 -- [-2208.430] (-2216.100) (-2208.359) (-2209.503) * (-2204.329) (-2220.983) [-2211.084] (-2209.757) -- 0:01:22
728500 -- (-2207.409) (-2210.299) (-2219.334) [-2204.749] * (-2218.812) (-2211.306) (-2209.809) [-2210.994] -- 0:01:22
729000 -- (-2218.453) (-2209.217) [-2205.986] (-2208.903) * (-2215.515) (-2223.320) [-2218.577] (-2213.403) -- 0:01:22
729500 -- (-2211.671) (-2213.001) [-2214.559] (-2227.034) * (-2203.836) [-2210.876] (-2212.629) (-2208.043) -- 0:01:22
730000 -- (-2204.107) (-2221.261) (-2204.062) [-2204.825] * (-2214.174) [-2207.827] (-2229.168) (-2210.787) -- 0:01:22
Average standard deviation of split frequencies: 0.005721
730500 -- [-2212.262] (-2213.040) (-2217.611) (-2208.500) * (-2208.689) [-2209.700] (-2207.480) (-2218.725) -- 0:01:21
731000 -- (-2214.382) (-2215.028) (-2216.872) [-2201.688] * [-2210.802] (-2206.608) (-2219.042) (-2211.666) -- 0:01:22
731500 -- [-2211.737] (-2221.300) (-2221.275) (-2215.964) * (-2209.031) (-2220.253) [-2210.973] (-2224.031) -- 0:01:21
732000 -- (-2203.938) (-2227.205) (-2221.001) [-2209.442] * [-2207.559] (-2215.068) (-2209.276) (-2212.495) -- 0:01:21
732500 -- (-2229.863) (-2216.334) [-2206.532] (-2219.498) * (-2205.981) (-2221.557) [-2206.725] (-2210.485) -- 0:01:21
733000 -- (-2217.488) (-2209.778) (-2212.487) [-2205.426] * [-2205.679] (-2213.674) (-2214.924) (-2211.332) -- 0:01:21
733500 -- [-2203.305] (-2207.060) (-2228.686) (-2209.548) * (-2206.210) (-2214.131) (-2211.581) [-2212.751] -- 0:01:21
734000 -- (-2210.793) [-2206.003] (-2220.621) (-2209.855) * (-2211.270) (-2223.614) (-2202.926) [-2204.464] -- 0:01:20
734500 -- [-2212.048] (-2209.776) (-2212.761) (-2211.797) * [-2208.643] (-2213.088) (-2214.744) (-2209.126) -- 0:01:20
735000 -- (-2214.661) (-2215.977) (-2219.934) [-2202.728] * (-2209.847) (-2217.904) (-2206.968) [-2204.044] -- 0:01:20
Average standard deviation of split frequencies: 0.005978
735500 -- (-2210.485) [-2203.757] (-2206.414) (-2218.206) * (-2207.201) (-2210.683) (-2207.563) [-2206.723] -- 0:01:20
736000 -- [-2205.750] (-2205.296) (-2223.400) (-2216.082) * [-2206.068] (-2213.495) (-2208.713) (-2205.972) -- 0:01:20
736500 -- (-2202.393) (-2213.388) (-2214.625) [-2210.338] * (-2220.781) (-2225.419) [-2221.886] (-2201.119) -- 0:01:20
737000 -- (-2214.511) (-2217.660) (-2216.331) [-2213.111] * (-2213.133) [-2212.843] (-2219.234) (-2217.038) -- 0:01:19
737500 -- [-2208.272] (-2216.249) (-2214.563) (-2213.706) * (-2204.913) [-2220.527] (-2214.434) (-2212.223) -- 0:01:20
738000 -- (-2221.744) [-2207.804] (-2230.921) (-2209.739) * [-2201.130] (-2209.916) (-2218.653) (-2223.451) -- 0:01:19
738500 -- (-2210.603) [-2202.721] (-2211.641) (-2200.931) * (-2215.208) [-2215.636] (-2219.360) (-2210.262) -- 0:01:19
739000 -- [-2212.322] (-2206.375) (-2227.443) (-2210.406) * (-2201.255) (-2224.515) [-2214.299] (-2214.397) -- 0:01:19
739500 -- [-2212.749] (-2212.505) (-2210.534) (-2209.325) * (-2208.457) (-2205.415) [-2207.203] (-2230.815) -- 0:01:19
740000 -- (-2207.139) (-2205.363) [-2215.606] (-2211.291) * (-2213.850) [-2210.971] (-2226.924) (-2226.835) -- 0:01:19
Average standard deviation of split frequencies: 0.006068
740500 -- (-2211.972) (-2223.565) [-2207.613] (-2203.371) * [-2205.343] (-2211.875) (-2218.372) (-2219.256) -- 0:01:18
741000 -- (-2213.441) (-2224.155) [-2214.089] (-2205.965) * (-2202.201) (-2224.929) (-2213.139) [-2203.096] -- 0:01:18
741500 -- (-2206.381) (-2208.601) [-2214.185] (-2207.985) * (-2221.428) (-2210.899) [-2204.804] (-2210.336) -- 0:01:18
742000 -- [-2205.834] (-2219.485) (-2225.198) (-2218.258) * (-2217.081) (-2209.135) (-2207.747) [-2209.767] -- 0:01:18
742500 -- [-2201.115] (-2214.177) (-2211.786) (-2211.335) * (-2204.195) (-2207.758) (-2212.366) [-2210.258] -- 0:01:18
743000 -- [-2204.418] (-2223.681) (-2212.919) (-2217.882) * (-2205.937) (-2210.776) (-2227.669) [-2216.641] -- 0:01:18
743500 -- (-2215.485) (-2213.226) (-2214.550) [-2209.739] * (-2209.334) [-2205.310] (-2213.099) (-2207.582) -- 0:01:18
744000 -- (-2208.515) [-2210.119] (-2212.707) (-2206.472) * (-2210.379) [-2210.027] (-2216.440) (-2209.996) -- 0:01:18
744500 -- (-2212.787) (-2210.104) [-2205.557] (-2211.036) * (-2218.386) (-2213.697) (-2203.524) [-2201.962] -- 0:01:17
745000 -- (-2207.472) [-2209.234] (-2208.470) (-2223.355) * (-2230.666) (-2202.225) (-2219.569) [-2206.406] -- 0:01:17
Average standard deviation of split frequencies: 0.005940
745500 -- [-2209.378] (-2215.491) (-2211.604) (-2224.411) * [-2205.723] (-2211.826) (-2230.276) (-2206.556) -- 0:01:17
746000 -- (-2203.717) [-2207.362] (-2217.682) (-2222.376) * (-2202.726) [-2211.720] (-2219.446) (-2211.610) -- 0:01:17
746500 -- (-2215.978) [-2216.233] (-2226.045) (-2209.564) * (-2210.389) (-2218.810) (-2214.487) [-2206.895] -- 0:01:17
747000 -- (-2207.288) (-2202.112) [-2212.732] (-2217.359) * (-2211.230) [-2209.077] (-2210.289) (-2208.980) -- 0:01:17
747500 -- (-2218.716) [-2213.293] (-2211.373) (-2214.783) * (-2216.229) (-2212.533) [-2210.675] (-2225.604) -- 0:01:17
748000 -- (-2217.984) (-2220.451) (-2218.172) [-2211.983] * (-2215.501) (-2209.460) [-2207.926] (-2209.274) -- 0:01:16
748500 -- (-2212.205) [-2205.288] (-2227.841) (-2204.725) * (-2201.927) (-2209.577) (-2215.403) [-2210.273] -- 0:01:16
749000 -- (-2229.545) [-2206.509] (-2219.970) (-2213.891) * (-2202.330) (-2202.653) (-2204.524) [-2203.066] -- 0:01:16
749500 -- [-2209.396] (-2206.883) (-2213.092) (-2222.136) * (-2206.102) (-2219.829) (-2211.121) [-2210.990] -- 0:01:16
750000 -- [-2214.179] (-2213.261) (-2211.969) (-2213.300) * (-2213.718) (-2211.714) (-2216.510) [-2202.162] -- 0:01:16
Average standard deviation of split frequencies: 0.005694
750500 -- (-2208.169) (-2203.560) [-2203.736] (-2210.214) * (-2230.433) (-2215.329) [-2211.050] (-2207.948) -- 0:01:16
751000 -- (-2220.343) [-2221.506] (-2205.958) (-2219.784) * (-2206.847) (-2218.569) [-2202.718] (-2213.624) -- 0:01:15
751500 -- (-2222.024) (-2215.809) (-2211.307) [-2209.684] * [-2200.730] (-2211.180) (-2205.499) (-2210.562) -- 0:01:15
752000 -- (-2218.969) [-2203.120] (-2225.500) (-2202.693) * (-2230.080) [-2216.850] (-2217.378) (-2206.806) -- 0:01:15
752500 -- (-2232.953) [-2209.950] (-2217.864) (-2210.343) * (-2217.373) (-2212.094) [-2218.874] (-2221.367) -- 0:01:15
753000 -- [-2209.589] (-2217.018) (-2207.406) (-2206.828) * [-2214.485] (-2217.484) (-2203.329) (-2224.536) -- 0:01:15
753500 -- (-2204.251) [-2214.887] (-2216.981) (-2229.030) * (-2222.734) (-2205.028) [-2207.576] (-2209.104) -- 0:01:15
754000 -- [-2218.070] (-2236.311) (-2218.781) (-2220.406) * (-2221.138) [-2200.993] (-2209.535) (-2209.697) -- 0:01:15
754500 -- [-2204.467] (-2212.166) (-2218.301) (-2217.240) * (-2210.162) [-2213.814] (-2205.957) (-2220.762) -- 0:01:14
755000 -- (-2211.231) [-2203.183] (-2215.554) (-2227.821) * (-2216.251) (-2213.783) [-2199.651] (-2210.535) -- 0:01:14
Average standard deviation of split frequencies: 0.005487
755500 -- (-2214.538) [-2211.581] (-2212.126) (-2210.333) * [-2204.585] (-2209.522) (-2210.728) (-2225.531) -- 0:01:14
756000 -- (-2223.610) [-2206.564] (-2220.937) (-2210.898) * [-2209.640] (-2218.479) (-2220.696) (-2213.467) -- 0:01:14
756500 -- [-2210.692] (-2205.183) (-2211.646) (-2214.698) * (-2220.076) [-2211.233] (-2213.214) (-2213.131) -- 0:01:14
757000 -- (-2213.693) [-2209.409] (-2209.174) (-2211.214) * (-2217.352) (-2204.619) [-2206.997] (-2208.939) -- 0:01:14
757500 -- (-2221.181) [-2207.214] (-2213.442) (-2209.123) * (-2217.752) (-2210.408) (-2216.398) [-2211.502] -- 0:01:13
758000 -- (-2215.178) (-2218.134) (-2217.513) [-2210.711] * (-2202.253) (-2205.981) [-2205.054] (-2222.860) -- 0:01:13
758500 -- [-2205.940] (-2207.187) (-2218.045) (-2210.110) * [-2204.664] (-2217.211) (-2225.864) (-2227.082) -- 0:01:13
759000 -- [-2207.099] (-2232.118) (-2211.481) (-2206.718) * (-2205.029) (-2217.629) (-2219.573) [-2203.966] -- 0:01:13
759500 -- (-2205.229) [-2212.784] (-2209.687) (-2221.218) * (-2226.219) (-2215.557) (-2230.931) [-2211.212] -- 0:01:13
760000 -- (-2206.663) (-2211.556) (-2209.117) [-2199.972] * [-2221.003] (-2207.433) (-2222.773) (-2215.993) -- 0:01:13
Average standard deviation of split frequencies: 0.005247
760500 -- (-2213.299) (-2212.480) [-2208.748] (-2205.541) * [-2210.563] (-2208.930) (-2215.081) (-2204.799) -- 0:01:13
761000 -- [-2207.126] (-2206.849) (-2210.060) (-2217.282) * (-2217.417) [-2214.900] (-2212.279) (-2214.650) -- 0:01:12
761500 -- [-2205.341] (-2208.232) (-2216.237) (-2216.597) * [-2203.903] (-2212.925) (-2216.751) (-2212.691) -- 0:01:12
762000 -- [-2202.475] (-2220.920) (-2220.304) (-2217.869) * (-2212.170) (-2209.127) (-2220.549) [-2206.228] -- 0:01:12
762500 -- [-2199.786] (-2206.161) (-2223.138) (-2215.815) * (-2203.575) (-2206.036) (-2219.976) [-2205.841] -- 0:01:12
763000 -- [-2208.295] (-2210.290) (-2215.646) (-2212.200) * [-2211.452] (-2208.178) (-2217.450) (-2215.129) -- 0:01:12
763500 -- (-2206.163) [-2203.498] (-2216.418) (-2208.755) * (-2209.612) (-2207.606) (-2217.021) [-2207.344] -- 0:01:12
764000 -- (-2211.997) (-2218.091) [-2206.272] (-2215.610) * [-2215.130] (-2220.641) (-2208.775) (-2216.727) -- 0:01:11
764500 -- (-2212.727) (-2222.031) [-2213.841] (-2215.621) * (-2214.072) [-2198.655] (-2214.740) (-2212.386) -- 0:01:11
765000 -- (-2217.430) (-2215.889) [-2207.957] (-2207.096) * (-2205.872) (-2209.102) [-2207.334] (-2206.782) -- 0:01:11
Average standard deviation of split frequencies: 0.005416
765500 -- (-2208.597) (-2211.513) (-2209.402) [-2205.601] * (-2206.585) [-2209.804] (-2221.629) (-2210.956) -- 0:01:11
766000 -- [-2206.429] (-2217.164) (-2215.359) (-2220.884) * (-2222.539) (-2214.203) (-2216.465) [-2208.103] -- 0:01:11
766500 -- [-2203.238] (-2231.857) (-2206.980) (-2213.508) * (-2209.470) [-2223.368] (-2221.625) (-2213.060) -- 0:01:11
767000 -- (-2221.008) [-2215.129] (-2210.992) (-2218.162) * (-2212.374) [-2212.129] (-2210.185) (-2211.111) -- 0:01:11
767500 -- (-2212.644) (-2212.997) (-2202.935) [-2220.055] * (-2204.436) (-2212.071) [-2201.472] (-2211.987) -- 0:01:10
768000 -- (-2217.297) (-2220.204) [-2212.214] (-2200.372) * (-2213.695) [-2209.417] (-2206.418) (-2223.039) -- 0:01:10
768500 -- (-2205.548) (-2217.179) (-2217.092) [-2214.834] * (-2216.364) (-2221.505) [-2200.893] (-2210.406) -- 0:01:10
769000 -- [-2204.106] (-2215.337) (-2208.228) (-2215.139) * (-2226.606) [-2198.752] (-2209.149) (-2215.747) -- 0:01:10
769500 -- (-2224.522) (-2213.074) (-2203.649) [-2212.187] * (-2231.540) [-2212.190] (-2211.464) (-2211.896) -- 0:01:10
770000 -- [-2211.787] (-2211.658) (-2231.899) (-2215.506) * [-2216.703] (-2212.275) (-2215.792) (-2217.474) -- 0:01:10
Average standard deviation of split frequencies: 0.004934
770500 -- (-2214.983) [-2204.175] (-2222.777) (-2215.996) * (-2218.839) (-2207.024) [-2208.920] (-2215.604) -- 0:01:09
771000 -- (-2211.277) (-2216.401) (-2206.404) [-2204.247] * [-2206.888] (-2209.310) (-2223.186) (-2205.260) -- 0:01:10
771500 -- (-2212.465) [-2211.824] (-2221.244) (-2206.045) * [-2203.114] (-2218.356) (-2213.849) (-2206.201) -- 0:01:09
772000 -- [-2205.608] (-2208.286) (-2220.942) (-2209.491) * (-2215.313) (-2212.807) [-2203.488] (-2213.232) -- 0:01:09
772500 -- (-2219.279) [-2199.503] (-2205.686) (-2218.145) * (-2219.186) (-2207.458) [-2213.722] (-2214.469) -- 0:01:09
773000 -- (-2216.052) [-2219.425] (-2217.368) (-2219.680) * (-2210.412) [-2214.437] (-2202.330) (-2221.630) -- 0:01:09
773500 -- (-2212.589) [-2207.046] (-2211.344) (-2206.371) * (-2227.183) [-2205.484] (-2215.273) (-2218.008) -- 0:01:09
774000 -- (-2208.820) (-2218.153) [-2215.255] (-2206.960) * (-2215.813) [-2212.355] (-2211.879) (-2213.804) -- 0:01:09
774500 -- (-2206.694) (-2210.203) [-2214.668] (-2214.653) * (-2217.742) (-2207.285) (-2222.714) [-2209.430] -- 0:01:09
775000 -- (-2211.765) (-2218.540) (-2209.100) [-2200.223] * (-2216.043) (-2206.228) (-2216.585) [-2229.944] -- 0:01:08
Average standard deviation of split frequencies: 0.004900
775500 -- (-2207.693) (-2217.345) [-2214.782] (-2205.920) * [-2206.214] (-2205.107) (-2221.076) (-2225.747) -- 0:01:08
776000 -- [-2206.061] (-2226.245) (-2211.985) (-2205.739) * (-2206.784) (-2220.176) [-2209.163] (-2216.077) -- 0:01:08
776500 -- (-2202.125) (-2203.871) (-2218.335) [-2207.633] * (-2201.136) (-2213.773) (-2213.254) [-2207.198] -- 0:01:08
777000 -- (-2225.883) (-2215.599) [-2224.023] (-2208.928) * (-2213.745) (-2207.077) (-2217.647) [-2200.848] -- 0:01:08
777500 -- (-2212.401) (-2219.706) [-2216.023] (-2219.416) * (-2214.402) (-2207.659) (-2225.383) [-2199.451] -- 0:01:08
778000 -- [-2212.066] (-2218.027) (-2218.114) (-2217.258) * (-2215.946) [-2207.055] (-2222.502) (-2208.847) -- 0:01:07
778500 -- (-2214.842) (-2210.014) (-2214.289) [-2202.787] * (-2209.937) (-2208.077) (-2215.307) [-2207.108] -- 0:01:07
779000 -- (-2218.679) (-2210.610) [-2208.368] (-2215.899) * [-2204.815] (-2226.859) (-2212.497) (-2208.350) -- 0:01:07
779500 -- (-2217.873) (-2213.953) [-2210.910] (-2219.044) * [-2204.242] (-2207.849) (-2213.016) (-2207.270) -- 0:01:07
780000 -- [-2199.345] (-2209.588) (-2213.327) (-2225.368) * (-2223.795) (-2221.055) [-2206.156] (-2220.008) -- 0:01:07
Average standard deviation of split frequencies: 0.005394
780500 -- (-2213.912) (-2213.103) [-2209.757] (-2220.888) * [-2212.678] (-2221.323) (-2214.062) (-2205.186) -- 0:01:07
781000 -- (-2211.780) [-2204.353] (-2212.182) (-2205.683) * [-2208.596] (-2225.204) (-2214.092) (-2210.492) -- 0:01:07
781500 -- (-2230.163) [-2208.224] (-2211.329) (-2204.388) * (-2203.864) (-2217.242) (-2220.085) [-2213.138] -- 0:01:07
782000 -- (-2223.737) (-2209.252) (-2217.563) [-2207.545] * (-2214.207) (-2204.851) (-2225.198) [-2205.895] -- 0:01:06
782500 -- (-2214.683) [-2211.530] (-2225.873) (-2208.337) * (-2221.813) (-2214.380) [-2211.084] (-2211.665) -- 0:01:06
783000 -- (-2204.910) [-2205.044] (-2211.592) (-2220.597) * (-2215.953) (-2217.334) (-2209.984) [-2210.271] -- 0:01:06
783500 -- (-2224.378) (-2207.750) [-2203.226] (-2207.619) * [-2196.626] (-2211.932) (-2211.479) (-2209.117) -- 0:01:06
784000 -- (-2211.594) (-2204.999) [-2218.812] (-2210.683) * (-2205.660) (-2217.696) [-2207.460] (-2217.578) -- 0:01:06
784500 -- (-2203.523) [-2209.775] (-2214.759) (-2226.498) * (-2218.065) [-2214.644] (-2206.603) (-2207.826) -- 0:01:05
785000 -- (-2206.583) (-2207.579) [-2211.940] (-2218.285) * [-2209.779] (-2212.356) (-2203.307) (-2223.054) -- 0:01:06
Average standard deviation of split frequencies: 0.005518
785500 -- (-2240.143) (-2206.284) (-2223.390) [-2214.576] * (-2209.310) (-2214.843) [-2206.263] (-2209.024) -- 0:01:05
786000 -- (-2208.687) [-2206.233] (-2215.819) (-2215.590) * (-2205.723) (-2206.353) (-2226.629) [-2205.110] -- 0:01:05
786500 -- (-2209.484) [-2204.307] (-2217.445) (-2214.470) * (-2210.895) (-2220.473) [-2207.604] (-2208.999) -- 0:01:05
787000 -- [-2217.823] (-2210.133) (-2208.363) (-2206.413) * (-2209.350) (-2223.445) (-2214.564) [-2208.282] -- 0:01:05
787500 -- (-2216.462) (-2221.303) (-2206.505) [-2204.421] * [-2208.408] (-2211.227) (-2223.717) (-2211.275) -- 0:01:05
788000 -- (-2213.307) (-2203.825) (-2226.268) [-2198.324] * [-2203.225] (-2210.937) (-2203.518) (-2209.810) -- 0:01:04
788500 -- (-2214.057) [-2205.824] (-2213.209) (-2206.515) * (-2206.731) (-2223.869) [-2204.809] (-2208.016) -- 0:01:04
789000 -- (-2214.841) (-2220.034) [-2208.167] (-2218.105) * [-2208.155] (-2218.437) (-2214.743) (-2213.561) -- 0:01:04
789500 -- (-2223.730) (-2210.591) [-2219.879] (-2210.464) * [-2211.210] (-2224.783) (-2205.528) (-2220.144) -- 0:01:04
790000 -- (-2214.032) (-2206.267) (-2218.684) [-2206.917] * (-2201.483) (-2215.281) (-2207.591) [-2211.282] -- 0:01:04
Average standard deviation of split frequencies: 0.005803
790500 -- [-2208.264] (-2207.204) (-2213.863) (-2219.350) * (-2210.425) (-2209.077) [-2198.743] (-2225.200) -- 0:01:04
791000 -- (-2208.486) (-2213.826) [-2213.565] (-2213.555) * (-2207.328) [-2205.305] (-2204.912) (-2217.438) -- 0:01:03
791500 -- [-2212.002] (-2209.417) (-2199.879) (-2208.866) * (-2218.104) [-2203.818] (-2204.213) (-2219.602) -- 0:01:03
792000 -- (-2217.930) (-2202.841) [-2205.004] (-2226.268) * (-2207.764) [-2209.409] (-2214.480) (-2207.564) -- 0:01:03
792500 -- (-2217.398) (-2213.442) [-2208.357] (-2212.764) * [-2203.340] (-2214.888) (-2218.137) (-2220.488) -- 0:01:03
793000 -- (-2215.067) (-2225.189) (-2204.056) [-2206.861] * [-2214.765] (-2214.820) (-2225.782) (-2211.469) -- 0:01:03
793500 -- (-2210.844) (-2210.960) [-2206.606] (-2208.279) * (-2209.326) [-2213.336] (-2217.636) (-2210.872) -- 0:01:03
794000 -- (-2210.385) (-2210.661) (-2216.546) [-2206.538] * (-2208.612) (-2207.789) [-2211.624] (-2204.428) -- 0:01:03
794500 -- (-2211.407) (-2211.614) [-2211.587] (-2223.738) * (-2207.569) (-2218.734) (-2210.652) [-2206.540] -- 0:01:02
795000 -- (-2199.136) (-2206.346) (-2226.833) [-2213.228] * (-2219.187) [-2202.378] (-2217.519) (-2215.061) -- 0:01:02
Average standard deviation of split frequencies: 0.005330
795500 -- (-2217.865) (-2209.187) (-2213.989) [-2207.987] * [-2215.803] (-2212.191) (-2220.965) (-2208.276) -- 0:01:02
796000 -- [-2215.689] (-2224.449) (-2203.143) (-2209.441) * (-2228.873) (-2226.610) [-2214.573] (-2220.704) -- 0:01:02
796500 -- (-2224.190) (-2216.797) (-2212.662) [-2208.568] * (-2220.131) (-2201.754) [-2213.846] (-2210.104) -- 0:01:02
797000 -- (-2210.996) [-2208.539] (-2210.785) (-2211.575) * (-2222.973) [-2207.385] (-2212.844) (-2210.825) -- 0:01:02
797500 -- (-2215.449) (-2224.616) [-2204.879] (-2218.185) * (-2216.003) (-2214.485) [-2214.646] (-2221.238) -- 0:01:01
798000 -- (-2224.046) (-2204.756) (-2206.759) [-2206.961] * (-2223.622) (-2204.404) (-2211.975) [-2213.988] -- 0:01:01
798500 -- [-2208.018] (-2208.101) (-2200.126) (-2212.344) * (-2218.206) (-2215.498) [-2220.152] (-2213.181) -- 0:01:01
799000 -- (-2216.429) (-2220.845) [-2215.534] (-2202.333) * (-2210.977) (-2201.261) (-2216.657) [-2215.008] -- 0:01:01
799500 -- [-2210.137] (-2217.175) (-2219.225) (-2222.172) * (-2213.114) [-2211.991] (-2220.723) (-2208.200) -- 0:01:01
800000 -- [-2209.043] (-2228.312) (-2209.287) (-2220.287) * (-2224.132) (-2216.734) (-2220.381) [-2207.396] -- 0:01:01
Average standard deviation of split frequencies: 0.005063
800500 -- [-2206.039] (-2211.783) (-2214.152) (-2206.395) * (-2212.926) (-2225.440) [-2203.782] (-2220.115) -- 0:01:01
801000 -- (-2208.180) [-2216.147] (-2206.003) (-2220.486) * (-2199.847) (-2208.795) [-2203.560] (-2225.282) -- 0:01:00
801500 -- [-2209.850] (-2222.943) (-2209.201) (-2214.635) * (-2206.720) (-2215.218) [-2197.098] (-2217.806) -- 0:01:00
802000 -- [-2201.623] (-2220.959) (-2210.992) (-2207.522) * (-2209.932) (-2212.342) [-2204.444] (-2218.489) -- 0:01:00
802500 -- [-2205.246] (-2213.065) (-2217.411) (-2214.980) * (-2208.436) [-2201.407] (-2207.710) (-2216.090) -- 0:01:00
803000 -- (-2213.349) (-2210.778) (-2207.266) [-2205.779] * (-2207.268) [-2206.853] (-2212.570) (-2216.317) -- 0:01:00
803500 -- (-2214.746) (-2209.289) (-2202.889) [-2203.582] * [-2208.963] (-2218.091) (-2215.613) (-2213.411) -- 0:01:00
804000 -- (-2217.812) (-2220.525) [-2204.761] (-2216.649) * (-2208.610) (-2216.350) [-2209.182] (-2213.076) -- 0:00:59
804500 -- (-2213.842) [-2208.835] (-2220.374) (-2214.918) * (-2219.124) (-2209.881) [-2203.606] (-2216.003) -- 0:00:59
805000 -- (-2217.743) [-2207.493] (-2214.719) (-2206.963) * [-2214.505] (-2214.324) (-2215.284) (-2214.686) -- 0:00:59
Average standard deviation of split frequencies: 0.005225
805500 -- (-2212.738) [-2215.705] (-2211.678) (-2215.136) * (-2209.983) (-2210.421) [-2213.536] (-2214.020) -- 0:00:59
806000 -- (-2208.461) (-2213.219) (-2210.931) [-2206.188] * (-2207.308) [-2207.067] (-2207.268) (-2217.162) -- 0:00:59
806500 -- [-2209.294] (-2211.430) (-2219.339) (-2204.747) * (-2204.340) [-2208.224] (-2219.137) (-2212.707) -- 0:00:59
807000 -- (-2217.387) [-2210.428] (-2221.403) (-2215.859) * (-2204.529) [-2212.061] (-2201.700) (-2216.056) -- 0:00:59
807500 -- [-2210.100] (-2220.541) (-2205.994) (-2216.230) * (-2205.085) [-2206.707] (-2217.163) (-2209.673) -- 0:00:58
808000 -- [-2208.168] (-2219.658) (-2206.119) (-2204.746) * (-2210.040) (-2210.057) [-2209.462] (-2206.341) -- 0:00:58
808500 -- (-2211.753) (-2200.749) (-2218.779) [-2212.983] * (-2221.917) [-2204.801] (-2215.573) (-2209.422) -- 0:00:58
809000 -- (-2212.040) (-2213.161) (-2218.249) [-2203.942] * (-2211.112) [-2211.997] (-2216.866) (-2215.449) -- 0:00:58
809500 -- (-2214.023) (-2210.733) [-2207.414] (-2226.033) * [-2201.872] (-2217.954) (-2213.026) (-2211.038) -- 0:00:58
810000 -- (-2211.283) [-2210.157] (-2214.249) (-2209.290) * (-2204.913) (-2212.972) [-2210.596] (-2212.459) -- 0:00:58
Average standard deviation of split frequencies: 0.005893
810500 -- [-2205.856] (-2210.448) (-2217.521) (-2210.671) * (-2218.703) [-2206.465] (-2220.558) (-2222.945) -- 0:00:57
811000 -- (-2208.692) [-2211.102] (-2208.141) (-2215.263) * (-2208.269) [-2214.309] (-2211.192) (-2218.680) -- 0:00:57
811500 -- (-2205.548) (-2205.853) (-2208.223) [-2208.757] * [-2210.527] (-2210.499) (-2221.246) (-2212.329) -- 0:00:57
812000 -- (-2222.265) (-2218.217) [-2199.324] (-2210.590) * (-2215.539) (-2216.096) [-2214.649] (-2207.209) -- 0:00:57
812500 -- (-2206.861) [-2218.951] (-2213.847) (-2213.597) * (-2210.564) (-2215.360) (-2211.366) [-2217.307] -- 0:00:57
813000 -- (-2216.845) [-2208.233] (-2214.853) (-2202.961) * (-2211.345) (-2213.311) (-2208.381) [-2201.784] -- 0:00:57
813500 -- (-2226.558) (-2217.037) (-2218.409) [-2209.964] * (-2230.818) [-2207.553] (-2203.194) (-2208.979) -- 0:00:57
814000 -- (-2231.863) [-2218.518] (-2209.275) (-2216.166) * (-2212.681) (-2209.683) [-2215.878] (-2218.394) -- 0:00:56
814500 -- (-2233.095) (-2225.113) [-2211.762] (-2205.103) * (-2218.288) (-2212.249) [-2212.716] (-2216.186) -- 0:00:56
815000 -- (-2204.235) (-2208.547) (-2216.713) [-2202.820] * (-2207.481) [-2210.487] (-2213.580) (-2208.520) -- 0:00:56
Average standard deviation of split frequencies: 0.005816
815500 -- [-2208.051] (-2223.699) (-2202.652) (-2207.185) * (-2203.723) (-2212.557) (-2207.318) [-2214.553] -- 0:00:56
816000 -- (-2209.375) (-2220.790) (-2207.475) [-2206.309] * (-2218.773) [-2206.803] (-2199.271) (-2224.177) -- 0:00:56
816500 -- (-2220.393) (-2217.846) [-2201.490] (-2208.465) * (-2208.990) (-2211.038) (-2215.051) [-2213.433] -- 0:00:56
817000 -- (-2211.497) (-2223.538) [-2215.346] (-2209.917) * [-2210.538] (-2209.150) (-2209.529) (-2212.095) -- 0:00:55
817500 -- [-2208.327] (-2210.164) (-2211.230) (-2218.200) * (-2214.418) (-2231.194) [-2214.643] (-2216.291) -- 0:00:55
818000 -- (-2209.303) (-2212.213) (-2221.308) [-2207.097] * (-2212.515) (-2207.667) [-2203.000] (-2215.524) -- 0:00:55
818500 -- (-2220.932) (-2208.539) [-2214.127] (-2217.309) * [-2209.828] (-2209.683) (-2220.321) (-2215.298) -- 0:00:55
819000 -- (-2211.421) (-2220.962) (-2206.398) [-2209.951] * (-2212.650) (-2209.669) [-2217.776] (-2212.081) -- 0:00:55
819500 -- (-2210.123) (-2217.598) [-2216.338] (-2223.350) * [-2205.663] (-2223.464) (-2216.470) (-2222.277) -- 0:00:55
820000 -- (-2224.645) [-2202.248] (-2208.241) (-2219.270) * [-2210.702] (-2228.361) (-2222.752) (-2210.084) -- 0:00:55
Average standard deviation of split frequencies: 0.005936
820500 -- (-2213.159) (-2215.511) (-2218.579) [-2207.649] * (-2216.486) [-2213.820] (-2211.550) (-2214.651) -- 0:00:54
821000 -- (-2220.036) [-2206.005] (-2230.678) (-2211.333) * (-2223.909) (-2219.806) (-2220.869) [-2213.049] -- 0:00:54
821500 -- [-2211.678] (-2216.962) (-2215.178) (-2214.177) * [-2205.107] (-2219.978) (-2223.110) (-2229.321) -- 0:00:54
822000 -- [-2201.799] (-2214.824) (-2217.442) (-2218.278) * (-2211.597) [-2211.615] (-2214.583) (-2220.295) -- 0:00:54
822500 -- (-2208.076) (-2216.757) (-2208.647) [-2208.238] * (-2210.940) [-2208.814] (-2225.080) (-2222.821) -- 0:00:54
823000 -- (-2225.411) [-2203.547] (-2221.113) (-2214.136) * [-2210.702] (-2214.793) (-2227.069) (-2214.086) -- 0:00:54
823500 -- (-2214.607) (-2209.438) (-2212.887) [-2207.081] * (-2212.361) [-2210.822] (-2217.814) (-2228.257) -- 0:00:54
824000 -- (-2214.593) (-2216.340) [-2206.564] (-2221.846) * (-2216.283) (-2214.963) [-2216.983] (-2214.469) -- 0:00:53
824500 -- (-2210.718) [-2204.652] (-2202.952) (-2238.131) * (-2215.214) (-2206.599) [-2208.424] (-2216.310) -- 0:00:53
825000 -- (-2214.767) (-2212.145) (-2219.834) [-2210.820] * (-2219.837) [-2208.365] (-2210.463) (-2206.851) -- 0:00:53
Average standard deviation of split frequencies: 0.006316
825500 -- [-2219.993] (-2225.302) (-2213.499) (-2228.166) * (-2203.321) (-2205.334) (-2229.869) [-2212.763] -- 0:00:53
826000 -- [-2209.329] (-2204.082) (-2212.032) (-2222.907) * (-2221.258) [-2204.336] (-2215.033) (-2205.447) -- 0:00:53
826500 -- (-2216.242) (-2208.209) [-2201.682] (-2226.633) * (-2217.034) [-2215.558] (-2214.720) (-2214.618) -- 0:00:53
827000 -- (-2206.892) (-2203.314) [-2206.724] (-2211.359) * (-2215.082) [-2205.959] (-2204.585) (-2210.115) -- 0:00:53
827500 -- (-2205.435) [-2207.526] (-2213.661) (-2208.527) * (-2211.567) (-2208.533) (-2221.307) [-2208.027] -- 0:00:52
828000 -- (-2222.852) (-2210.896) [-2204.958] (-2215.704) * [-2206.229] (-2215.437) (-2226.279) (-2215.506) -- 0:00:52
828500 -- (-2213.394) [-2206.076] (-2223.394) (-2219.141) * [-2203.716] (-2210.035) (-2215.802) (-2211.893) -- 0:00:52
829000 -- (-2213.700) (-2210.429) (-2223.949) [-2217.542] * [-2198.944] (-2210.987) (-2219.208) (-2208.374) -- 0:00:52
829500 -- [-2202.053] (-2212.940) (-2216.805) (-2215.509) * (-2205.073) (-2202.194) (-2221.438) [-2205.595] -- 0:00:52
830000 -- (-2220.253) (-2219.283) [-2208.191] (-2211.661) * (-2208.934) (-2205.958) (-2211.553) [-2204.466] -- 0:00:52
Average standard deviation of split frequencies: 0.006280
830500 -- (-2222.025) (-2225.105) (-2224.265) [-2207.502] * (-2205.515) (-2211.339) (-2217.533) [-2206.543] -- 0:00:52
831000 -- [-2223.397] (-2212.125) (-2206.914) (-2219.555) * (-2208.655) (-2233.553) (-2207.548) [-2216.272] -- 0:00:51
831500 -- (-2227.235) [-2222.487] (-2204.580) (-2212.746) * (-2213.672) (-2226.976) (-2217.309) [-2213.474] -- 0:00:51
832000 -- [-2202.903] (-2241.405) (-2213.323) (-2212.695) * (-2202.213) (-2216.013) [-2210.547] (-2206.590) -- 0:00:51
832500 -- (-2210.984) (-2212.080) [-2215.383] (-2212.415) * [-2207.560] (-2218.572) (-2224.995) (-2212.640) -- 0:00:51
833000 -- (-2208.539) (-2207.841) [-2201.503] (-2214.589) * [-2208.115] (-2223.665) (-2226.349) (-2204.675) -- 0:00:51
833500 -- [-2203.537] (-2222.793) (-2213.771) (-2206.719) * (-2218.989) [-2210.083] (-2220.823) (-2206.991) -- 0:00:51
834000 -- (-2212.738) [-2209.741] (-2222.254) (-2217.167) * (-2217.173) (-2221.440) (-2216.229) [-2213.802] -- 0:00:50
834500 -- (-2227.649) (-2209.419) (-2212.031) [-2216.692] * [-2206.856] (-2223.771) (-2212.767) (-2212.493) -- 0:00:50
835000 -- (-2224.131) (-2219.116) [-2208.254] (-2211.360) * [-2212.670] (-2220.263) (-2212.527) (-2208.140) -- 0:00:50
Average standard deviation of split frequencies: 0.005977
835500 -- (-2226.298) (-2213.436) (-2223.094) [-2215.043] * (-2220.343) (-2227.715) [-2204.952] (-2207.764) -- 0:00:50
836000 -- (-2222.648) [-2215.588] (-2211.629) (-2218.828) * (-2221.836) (-2217.787) (-2212.285) [-2201.791] -- 0:00:50
836500 -- (-2204.955) (-2214.693) [-2204.230] (-2222.143) * (-2209.727) (-2208.751) [-2207.681] (-2210.977) -- 0:00:50
837000 -- (-2215.445) (-2208.201) (-2209.246) [-2210.805] * (-2220.171) (-2208.350) (-2209.152) [-2210.461] -- 0:00:50
837500 -- [-2201.510] (-2216.880) (-2217.032) (-2218.355) * (-2204.399) (-2213.190) (-2219.257) [-2215.427] -- 0:00:49
838000 -- [-2207.182] (-2214.996) (-2220.596) (-2216.905) * (-2197.217) (-2221.249) [-2205.827] (-2208.749) -- 0:00:49
838500 -- (-2214.774) (-2225.281) (-2213.077) [-2211.774] * [-2200.661] (-2215.213) (-2216.379) (-2204.862) -- 0:00:49
839000 -- (-2221.465) [-2215.265] (-2217.679) (-2216.055) * (-2217.711) (-2212.284) [-2218.616] (-2209.715) -- 0:00:49
839500 -- (-2209.291) (-2214.059) (-2219.815) [-2214.019] * [-2206.033] (-2213.021) (-2204.796) (-2213.883) -- 0:00:49
840000 -- [-2207.195] (-2219.741) (-2213.139) (-2217.579) * (-2211.978) (-2208.288) [-2217.958] (-2212.334) -- 0:00:49
Average standard deviation of split frequencies: 0.005794
840500 -- (-2205.630) (-2214.143) (-2207.224) [-2207.608] * (-2214.926) (-2206.727) (-2211.514) [-2202.041] -- 0:00:48
841000 -- (-2206.490) (-2206.684) (-2206.385) [-2203.756] * [-2205.999] (-2210.531) (-2218.678) (-2213.488) -- 0:00:48
841500 -- (-2204.040) (-2224.866) (-2205.491) [-2207.456] * (-2214.836) (-2206.745) (-2209.717) [-2216.588] -- 0:00:48
842000 -- (-2209.759) (-2207.797) [-2206.361] (-2199.673) * (-2218.081) (-2205.785) (-2215.550) [-2210.462] -- 0:00:48
842500 -- [-2197.538] (-2216.404) (-2211.866) (-2213.970) * [-2204.845] (-2209.381) (-2217.370) (-2216.815) -- 0:00:48
843000 -- (-2208.865) (-2218.142) [-2201.937] (-2205.731) * (-2215.544) (-2211.344) (-2218.750) [-2207.294] -- 0:00:48
843500 -- (-2207.351) (-2205.705) [-2204.952] (-2217.164) * [-2212.816] (-2211.248) (-2218.515) (-2210.470) -- 0:00:48
844000 -- (-2229.251) (-2212.164) [-2205.658] (-2217.683) * (-2207.826) (-2220.449) [-2208.963] (-2209.404) -- 0:00:47
844500 -- (-2230.652) (-2218.934) [-2214.378] (-2207.065) * (-2205.931) (-2214.267) (-2221.676) [-2204.268] -- 0:00:47
845000 -- (-2221.212) [-2204.957] (-2213.020) (-2206.969) * (-2229.182) (-2208.008) (-2222.338) [-2217.180] -- 0:00:47
Average standard deviation of split frequencies: 0.005906
845500 -- (-2220.177) (-2216.675) [-2213.617] (-2208.913) * (-2226.448) (-2221.765) [-2208.915] (-2203.115) -- 0:00:47
846000 -- (-2220.318) [-2207.846] (-2223.487) (-2216.719) * (-2216.197) [-2206.576] (-2211.019) (-2225.919) -- 0:00:47
846500 -- (-2220.228) (-2219.341) [-2213.302] (-2203.795) * [-2213.695] (-2209.449) (-2208.901) (-2214.392) -- 0:00:47
847000 -- (-2212.479) (-2207.519) (-2223.013) [-2209.498] * [-2208.728] (-2229.022) (-2202.186) (-2209.759) -- 0:00:46
847500 -- (-2219.302) (-2208.813) (-2223.773) [-2207.979] * [-2208.185] (-2215.505) (-2218.445) (-2210.212) -- 0:00:46
848000 -- (-2209.917) [-2216.457] (-2213.804) (-2218.839) * (-2210.293) [-2209.552] (-2223.303) (-2208.896) -- 0:00:46
848500 -- (-2217.503) (-2213.693) (-2218.939) [-2208.343] * (-2218.932) (-2210.397) (-2217.354) [-2212.935] -- 0:00:46
849000 -- (-2219.162) (-2207.006) (-2213.427) [-2209.067] * [-2206.638] (-2211.478) (-2216.856) (-2215.631) -- 0:00:46
849500 -- (-2217.166) [-2205.550] (-2203.628) (-2206.266) * (-2213.160) [-2208.723] (-2207.774) (-2217.078) -- 0:00:46
850000 -- (-2207.551) (-2217.459) [-2205.101] (-2221.094) * (-2207.531) (-2206.279) (-2217.174) [-2201.732] -- 0:00:46
Average standard deviation of split frequencies: 0.005357
850500 -- (-2216.169) (-2211.084) (-2204.652) [-2223.310] * (-2210.386) (-2212.614) (-2221.341) [-2206.180] -- 0:00:45
851000 -- [-2210.308] (-2224.532) (-2212.885) (-2220.516) * (-2206.990) (-2204.142) (-2219.761) [-2214.137] -- 0:00:45
851500 -- (-2213.961) [-2216.547] (-2218.950) (-2218.639) * (-2209.734) [-2216.182] (-2210.001) (-2210.251) -- 0:00:45
852000 -- (-2216.396) (-2216.101) (-2208.315) [-2209.275] * (-2221.123) [-2203.806] (-2207.576) (-2207.929) -- 0:00:45
852500 -- [-2202.281] (-2216.432) (-2215.161) (-2221.589) * (-2214.584) (-2204.570) [-2208.762] (-2218.158) -- 0:00:45
853000 -- (-2214.857) (-2221.415) (-2213.303) [-2206.645] * [-2216.890] (-2215.349) (-2202.632) (-2210.011) -- 0:00:44
853500 -- (-2204.443) (-2213.378) (-2207.354) [-2202.440] * [-2214.438] (-2205.947) (-2216.349) (-2220.113) -- 0:00:44
854000 -- (-2210.437) (-2229.081) [-2204.150] (-2210.183) * [-2208.967] (-2207.284) (-2218.707) (-2221.399) -- 0:00:44
854500 -- (-2217.051) (-2213.981) (-2209.984) [-2200.867] * (-2221.928) [-2202.733] (-2214.754) (-2209.636) -- 0:00:44
855000 -- (-2224.485) [-2225.127] (-2205.941) (-2218.485) * (-2220.714) [-2200.203] (-2209.847) (-2206.029) -- 0:00:44
Average standard deviation of split frequencies: 0.005654
855500 -- (-2222.899) [-2211.747] (-2204.567) (-2210.979) * (-2224.608) [-2206.146] (-2216.560) (-2205.115) -- 0:00:44
856000 -- (-2210.171) (-2209.051) (-2209.370) [-2215.935] * (-2213.965) (-2209.502) (-2244.190) [-2209.870] -- 0:00:44
856500 -- (-2209.131) (-2209.569) (-2210.138) [-2206.380] * (-2218.996) (-2205.312) (-2217.327) [-2205.902] -- 0:00:44
857000 -- (-2211.721) (-2213.099) [-2206.601] (-2210.294) * (-2205.918) [-2209.370] (-2217.082) (-2207.996) -- 0:00:43
857500 -- (-2221.040) (-2213.638) [-2204.102] (-2219.434) * (-2213.747) [-2206.225] (-2211.189) (-2212.236) -- 0:00:43
858000 -- (-2211.489) (-2216.587) [-2199.891] (-2218.589) * (-2207.613) (-2219.026) [-2207.866] (-2217.184) -- 0:00:43
858500 -- [-2208.516] (-2225.881) (-2209.893) (-2210.553) * (-2209.660) (-2208.496) [-2207.994] (-2211.025) -- 0:00:43
859000 -- (-2205.951) [-2208.697] (-2204.198) (-2216.177) * (-2214.154) [-2210.449] (-2205.515) (-2215.567) -- 0:00:43
859500 -- [-2206.804] (-2230.479) (-2205.723) (-2219.641) * (-2211.374) [-2205.401] (-2218.322) (-2219.312) -- 0:00:43
860000 -- (-2210.441) (-2212.182) [-2203.222] (-2212.535) * (-2213.939) [-2208.170] (-2223.387) (-2226.671) -- 0:00:42
Average standard deviation of split frequencies: 0.005842
860500 -- (-2209.993) (-2215.670) (-2210.344) [-2206.935] * (-2211.039) [-2206.632] (-2215.068) (-2220.848) -- 0:00:42
861000 -- (-2218.348) (-2214.763) [-2208.629] (-2217.210) * (-2217.472) (-2210.827) [-2212.783] (-2215.171) -- 0:00:42
861500 -- (-2206.127) (-2205.417) [-2208.351] (-2213.241) * (-2214.099) (-2212.621) [-2208.375] (-2222.856) -- 0:00:42
862000 -- (-2214.932) [-2206.372] (-2221.606) (-2214.486) * (-2211.835) (-2220.287) [-2209.098] (-2222.839) -- 0:00:42
862500 -- (-2222.727) (-2217.868) [-2201.471] (-2216.095) * (-2206.355) (-2216.821) (-2210.027) [-2213.030] -- 0:00:42
863000 -- [-2212.151] (-2217.637) (-2205.755) (-2222.724) * (-2201.707) (-2226.484) (-2214.438) [-2206.425] -- 0:00:42
863500 -- (-2211.420) (-2217.515) [-2204.417] (-2207.144) * (-2208.653) [-2207.668] (-2217.576) (-2206.488) -- 0:00:41
864000 -- [-2202.537] (-2217.949) (-2210.316) (-2209.691) * [-2207.297] (-2223.568) (-2217.791) (-2214.123) -- 0:00:41
864500 -- (-2213.354) (-2212.421) (-2216.132) [-2210.519] * (-2211.570) (-2210.458) [-2201.266] (-2215.271) -- 0:00:41
865000 -- [-2210.582] (-2218.505) (-2219.605) (-2220.789) * (-2218.547) (-2203.152) (-2214.521) [-2206.642] -- 0:00:41
Average standard deviation of split frequencies: 0.005480
865500 -- (-2209.321) [-2210.302] (-2211.155) (-2207.503) * [-2206.736] (-2218.269) (-2209.958) (-2216.057) -- 0:00:41
866000 -- (-2222.506) (-2224.343) [-2209.562] (-2211.509) * (-2205.266) (-2219.710) [-2203.147] (-2211.964) -- 0:00:41
866500 -- [-2209.908] (-2215.747) (-2210.152) (-2213.446) * [-2200.865] (-2211.442) (-2206.875) (-2215.593) -- 0:00:40
867000 -- (-2212.309) [-2211.414] (-2222.076) (-2215.226) * (-2225.799) [-2212.922] (-2225.764) (-2219.841) -- 0:00:40
867500 -- (-2212.900) (-2214.611) (-2225.913) [-2210.198] * (-2217.823) (-2209.676) (-2213.014) [-2208.511] -- 0:00:40
868000 -- (-2212.023) [-2204.458] (-2220.498) (-2208.715) * (-2217.841) (-2210.293) [-2206.197] (-2215.547) -- 0:00:40
868500 -- (-2216.000) (-2204.557) [-2208.844] (-2230.408) * (-2212.191) (-2223.572) [-2210.736] (-2221.312) -- 0:00:40
869000 -- (-2211.520) [-2204.231] (-2226.720) (-2205.168) * (-2203.412) [-2203.435] (-2216.753) (-2223.601) -- 0:00:40
869500 -- (-2208.913) (-2215.440) (-2212.628) [-2211.950] * [-2204.633] (-2215.323) (-2214.264) (-2215.717) -- 0:00:40
870000 -- (-2215.604) (-2221.232) [-2222.597] (-2208.878) * [-2209.042] (-2223.811) (-2210.253) (-2213.059) -- 0:00:39
Average standard deviation of split frequencies: 0.005847
870500 -- (-2214.225) (-2214.195) (-2220.297) [-2215.104] * (-2207.993) [-2215.913] (-2223.937) (-2210.803) -- 0:00:39
871000 -- (-2216.892) (-2219.670) [-2224.691] (-2206.385) * [-2205.110] (-2215.252) (-2212.766) (-2215.129) -- 0:00:39
871500 -- (-2209.097) [-2204.714] (-2216.038) (-2212.470) * (-2213.430) (-2214.944) (-2201.029) [-2203.468] -- 0:00:39
872000 -- [-2214.839] (-2209.225) (-2230.346) (-2215.852) * (-2206.306) (-2209.342) [-2200.921] (-2213.473) -- 0:00:39
872500 -- (-2205.231) (-2224.442) (-2232.171) [-2214.145] * (-2218.297) [-2205.610] (-2210.029) (-2205.289) -- 0:00:39
873000 -- [-2201.650] (-2220.976) (-2231.473) (-2218.004) * (-2215.591) (-2209.495) (-2216.419) [-2204.918] -- 0:00:38
873500 -- [-2213.824] (-2226.223) (-2225.624) (-2207.304) * (-2219.332) [-2207.356] (-2217.793) (-2210.046) -- 0:00:38
874000 -- (-2203.353) [-2214.321] (-2214.386) (-2219.546) * (-2206.233) [-2209.393] (-2212.762) (-2213.246) -- 0:00:38
874500 -- [-2202.319] (-2215.313) (-2223.938) (-2216.390) * (-2212.667) (-2215.079) (-2211.076) [-2204.049] -- 0:00:38
875000 -- (-2213.107) (-2210.230) (-2213.660) [-2205.288] * (-2215.824) (-2207.345) (-2213.011) [-2205.741] -- 0:00:38
Average standard deviation of split frequencies: 0.005668
875500 -- [-2203.863] (-2222.837) (-2218.343) (-2208.626) * (-2213.062) [-2202.905] (-2217.457) (-2208.800) -- 0:00:38
876000 -- [-2208.447] (-2209.959) (-2208.713) (-2215.842) * (-2213.357) [-2204.224] (-2216.162) (-2209.944) -- 0:00:38
876500 -- (-2213.117) [-2200.006] (-2203.128) (-2220.568) * (-2207.232) [-2205.327] (-2218.067) (-2231.107) -- 0:00:37
877000 -- (-2219.820) [-2202.328] (-2215.056) (-2215.600) * (-2218.994) (-2208.653) [-2217.611] (-2205.783) -- 0:00:37
877500 -- (-2212.373) (-2208.208) [-2209.390] (-2218.520) * (-2217.985) (-2214.114) [-2209.180] (-2219.379) -- 0:00:37
878000 -- (-2218.688) (-2219.651) [-2216.039] (-2213.436) * (-2218.615) [-2208.383] (-2218.357) (-2212.867) -- 0:00:37
878500 -- (-2212.962) (-2208.450) (-2215.615) [-2208.540] * (-2211.612) (-2207.720) [-2216.713] (-2215.770) -- 0:00:37
879000 -- (-2213.061) (-2214.132) (-2210.818) [-2207.266] * (-2213.037) (-2219.668) (-2213.012) [-2210.967] -- 0:00:37
879500 -- (-2208.040) (-2209.176) (-2217.408) [-2207.721] * (-2207.489) (-2225.605) (-2206.129) [-2214.570] -- 0:00:36
880000 -- (-2212.479) [-2225.285] (-2211.355) (-2211.404) * [-2215.518] (-2223.465) (-2204.448) (-2212.544) -- 0:00:36
Average standard deviation of split frequencies: 0.005710
880500 -- [-2200.933] (-2207.719) (-2217.376) (-2216.084) * [-2204.155] (-2213.913) (-2206.178) (-2209.663) -- 0:00:36
881000 -- (-2205.548) (-2211.348) (-2225.828) [-2208.285] * [-2207.680] (-2202.902) (-2225.727) (-2221.366) -- 0:00:36
881500 -- (-2210.083) (-2233.670) [-2211.539] (-2222.892) * [-2208.751] (-2214.121) (-2205.866) (-2216.551) -- 0:00:36
882000 -- (-2205.922) [-2202.156] (-2209.523) (-2209.192) * (-2212.048) (-2214.507) (-2213.831) [-2205.204] -- 0:00:36
882500 -- [-2211.029] (-2203.694) (-2207.377) (-2206.921) * [-2207.393] (-2224.146) (-2213.734) (-2213.693) -- 0:00:36
883000 -- (-2221.837) (-2204.440) (-2208.989) [-2210.121] * (-2215.470) [-2205.694] (-2216.712) (-2205.764) -- 0:00:35
883500 -- (-2212.609) (-2204.943) (-2225.554) [-2208.315] * [-2205.825] (-2209.320) (-2216.175) (-2228.027) -- 0:00:35
884000 -- [-2202.131] (-2217.415) (-2225.430) (-2215.077) * (-2208.396) (-2214.514) [-2205.319] (-2212.259) -- 0:00:35
884500 -- [-2207.262] (-2209.578) (-2212.609) (-2222.263) * (-2203.988) (-2210.832) [-2203.506] (-2209.026) -- 0:00:35
885000 -- [-2207.312] (-2221.085) (-2212.109) (-2207.292) * (-2212.224) [-2206.748] (-2204.299) (-2221.795) -- 0:00:35
Average standard deviation of split frequencies: 0.005250
885500 -- (-2207.641) (-2204.423) [-2204.682] (-2213.308) * (-2207.039) (-2217.227) [-2205.049] (-2211.341) -- 0:00:35
886000 -- [-2220.802] (-2211.920) (-2216.047) (-2221.241) * (-2205.650) (-2233.446) [-2205.533] (-2218.952) -- 0:00:34
886500 -- (-2212.646) (-2217.909) [-2202.973] (-2214.763) * [-2201.478] (-2205.920) (-2222.026) (-2216.867) -- 0:00:34
887000 -- (-2212.389) (-2205.088) [-2215.841] (-2207.659) * (-2210.670) [-2212.391] (-2217.379) (-2218.795) -- 0:00:34
887500 -- [-2208.411] (-2210.289) (-2204.205) (-2204.012) * (-2209.304) (-2222.136) (-2211.253) [-2205.665] -- 0:00:34
888000 -- (-2210.462) (-2211.250) (-2228.783) [-2214.051] * (-2212.221) (-2210.806) [-2213.795] (-2211.307) -- 0:00:34
888500 -- (-2216.956) (-2208.899) (-2219.673) [-2206.022] * (-2209.840) (-2204.888) (-2217.039) [-2221.623] -- 0:00:34
889000 -- (-2211.189) (-2216.026) (-2212.959) [-2204.393] * (-2215.570) (-2220.277) (-2214.885) [-2210.384] -- 0:00:34
889500 -- (-2219.091) (-2207.546) (-2206.629) [-2210.465] * [-2212.555] (-2203.386) (-2214.637) (-2219.574) -- 0:00:33
890000 -- (-2207.021) [-2203.241] (-2205.356) (-2204.244) * [-2201.007] (-2227.118) (-2225.359) (-2212.969) -- 0:00:33
Average standard deviation of split frequencies: 0.005575
890500 -- [-2216.748] (-2218.085) (-2210.671) (-2211.150) * (-2210.460) (-2213.776) [-2199.801] (-2214.157) -- 0:00:33
891000 -- (-2215.092) (-2211.415) [-2201.147] (-2232.734) * [-2206.010] (-2216.082) (-2215.080) (-2222.581) -- 0:00:33
891500 -- (-2220.869) (-2207.412) [-2209.682] (-2227.034) * (-2222.983) [-2205.223] (-2209.078) (-2217.181) -- 0:00:33
892000 -- (-2215.467) (-2207.793) [-2216.803] (-2221.081) * [-2207.007] (-2208.524) (-2210.814) (-2218.962) -- 0:00:33
892500 -- (-2220.903) (-2210.057) [-2209.297] (-2212.779) * (-2215.432) (-2212.330) [-2209.708] (-2209.754) -- 0:00:33
893000 -- (-2205.323) (-2208.343) [-2198.389] (-2218.129) * (-2208.728) (-2211.809) [-2198.276] (-2213.142) -- 0:00:32
893500 -- (-2201.266) [-2205.833] (-2204.585) (-2208.059) * (-2205.957) (-2216.484) [-2207.249] (-2223.998) -- 0:00:32
894000 -- (-2216.806) (-2206.639) (-2212.479) [-2213.072] * [-2201.604] (-2210.559) (-2205.057) (-2227.112) -- 0:00:32
894500 -- [-2204.774] (-2212.066) (-2217.321) (-2212.771) * [-2211.651] (-2208.997) (-2211.081) (-2208.336) -- 0:00:32
895000 -- (-2212.658) (-2207.493) [-2212.700] (-2217.336) * (-2209.543) (-2219.345) [-2215.195] (-2215.015) -- 0:00:32
Average standard deviation of split frequencies: 0.005051
895500 -- (-2223.874) (-2210.878) [-2206.205] (-2214.422) * (-2210.545) [-2213.940] (-2218.452) (-2210.383) -- 0:00:32
896000 -- [-2212.163] (-2211.325) (-2220.969) (-2209.210) * (-2215.777) (-2218.134) [-2210.235] (-2209.693) -- 0:00:31
896500 -- (-2200.063) (-2221.255) (-2214.049) [-2201.235] * (-2219.356) (-2199.311) (-2210.694) [-2214.935] -- 0:00:31
897000 -- (-2212.081) (-2211.956) (-2210.496) [-2208.068] * [-2210.109] (-2211.331) (-2203.363) (-2225.157) -- 0:00:31
897500 -- [-2208.669] (-2211.004) (-2207.456) (-2206.759) * (-2209.882) (-2225.167) [-2203.454] (-2238.828) -- 0:00:31
898000 -- (-2217.012) [-2210.466] (-2211.513) (-2211.894) * (-2221.686) (-2205.601) (-2213.425) [-2218.418] -- 0:00:31
898500 -- (-2217.481) (-2208.664) (-2217.594) [-2209.916] * (-2229.730) (-2213.810) [-2209.719] (-2221.589) -- 0:00:31
899000 -- (-2220.133) (-2207.897) [-2207.625] (-2211.103) * (-2211.926) [-2215.876] (-2210.910) (-2222.428) -- 0:00:31
899500 -- (-2213.053) (-2224.575) (-2212.043) [-2205.489] * (-2216.392) (-2217.418) (-2206.958) [-2207.481] -- 0:00:30
900000 -- (-2209.464) (-2209.678) (-2219.194) [-2206.294] * (-2225.031) (-2210.483) [-2210.112] (-2207.545) -- 0:00:30
Average standard deviation of split frequencies: 0.004641
900500 -- (-2214.312) (-2227.356) (-2216.118) [-2199.566] * (-2227.684) (-2207.266) [-2210.714] (-2206.674) -- 0:00:30
901000 -- (-2212.479) (-2213.195) (-2217.845) [-2203.824] * (-2225.218) (-2204.695) [-2216.689] (-2208.881) -- 0:00:30
901500 -- (-2217.997) [-2203.192] (-2216.747) (-2211.693) * (-2212.141) [-2206.240] (-2212.118) (-2214.153) -- 0:00:30
902000 -- [-2209.533] (-2202.639) (-2221.155) (-2214.154) * [-2202.824] (-2210.152) (-2216.668) (-2211.585) -- 0:00:30
902500 -- (-2211.485) [-2201.612] (-2220.461) (-2222.750) * (-2213.202) (-2215.308) (-2207.315) [-2208.810] -- 0:00:29
903000 -- [-2212.890] (-2211.598) (-2211.841) (-2222.794) * [-2204.862] (-2212.065) (-2213.934) (-2202.325) -- 0:00:29
903500 -- (-2207.564) [-2209.106] (-2210.815) (-2216.557) * (-2223.387) (-2208.788) (-2210.355) [-2210.196] -- 0:00:29
904000 -- [-2214.520] (-2205.030) (-2216.454) (-2216.052) * [-2211.220] (-2206.651) (-2210.861) (-2210.002) -- 0:00:29
904500 -- (-2211.403) (-2200.293) [-2215.601] (-2220.408) * (-2219.921) (-2213.615) [-2211.260] (-2221.132) -- 0:00:29
905000 -- (-2208.944) (-2213.334) [-2208.848] (-2229.749) * (-2215.680) (-2206.615) [-2201.878] (-2225.843) -- 0:00:29
Average standard deviation of split frequencies: 0.004683
905500 -- (-2223.040) [-2203.496] (-2212.827) (-2221.691) * (-2210.018) [-2217.033] (-2207.861) (-2218.120) -- 0:00:29
906000 -- (-2217.313) (-2211.854) [-2201.771] (-2219.013) * [-2202.887] (-2212.808) (-2205.551) (-2216.653) -- 0:00:28
906500 -- (-2222.283) (-2209.835) [-2211.623] (-2226.265) * (-2210.014) (-2222.116) [-2203.834] (-2219.885) -- 0:00:28
907000 -- (-2222.155) (-2207.039) (-2225.074) [-2214.237] * (-2206.817) (-2215.148) [-2209.100] (-2208.470) -- 0:00:28
907500 -- (-2215.044) [-2207.514] (-2219.575) (-2228.557) * (-2214.282) (-2209.213) (-2203.084) [-2214.059] -- 0:00:28
908000 -- (-2214.080) (-2209.971) [-2212.758] (-2235.489) * [-2207.512] (-2206.045) (-2212.132) (-2236.884) -- 0:00:28
908500 -- (-2212.262) [-2202.141] (-2213.673) (-2212.807) * (-2214.705) [-2209.476] (-2214.563) (-2208.800) -- 0:00:28
909000 -- (-2217.244) (-2207.769) [-2206.895] (-2207.783) * [-2214.528] (-2204.361) (-2209.204) (-2212.809) -- 0:00:27
909500 -- [-2204.444] (-2219.854) (-2207.358) (-2207.318) * (-2210.228) (-2210.333) [-2207.005] (-2221.818) -- 0:00:27
910000 -- [-2206.796] (-2219.138) (-2211.982) (-2201.982) * [-2201.707] (-2210.388) (-2208.201) (-2209.055) -- 0:00:27
Average standard deviation of split frequencies: 0.004831
910500 -- (-2221.184) (-2211.346) (-2227.723) [-2205.239] * (-2209.924) (-2207.646) [-2211.460] (-2215.153) -- 0:00:27
911000 -- (-2222.796) [-2201.622] (-2209.954) (-2211.717) * (-2209.069) [-2207.486] (-2207.297) (-2211.291) -- 0:00:27
911500 -- (-2213.222) (-2211.034) [-2207.646] (-2211.252) * [-2210.445] (-2211.609) (-2212.183) (-2222.800) -- 0:00:27
912000 -- (-2205.076) [-2210.809] (-2211.373) (-2212.152) * (-2210.663) [-2215.565] (-2218.449) (-2203.713) -- 0:00:27
912500 -- (-2216.675) [-2205.706] (-2213.809) (-2210.529) * (-2203.625) (-2214.000) (-2206.117) [-2213.605] -- 0:00:26
913000 -- (-2212.246) (-2207.295) (-2210.563) [-2212.951] * (-2220.470) (-2213.534) [-2205.624] (-2212.456) -- 0:00:26
913500 -- (-2232.042) (-2215.740) [-2211.585] (-2218.400) * (-2215.113) [-2210.076] (-2209.822) (-2222.194) -- 0:00:26
914000 -- (-2218.870) [-2213.270] (-2223.979) (-2207.692) * (-2214.252) (-2209.565) (-2212.723) [-2216.389] -- 0:00:26
914500 -- (-2212.024) [-2212.865] (-2208.021) (-2215.989) * (-2219.256) (-2214.408) [-2212.206] (-2200.931) -- 0:00:26
915000 -- (-2210.099) [-2207.703] (-2215.783) (-2214.924) * (-2219.534) [-2209.135] (-2207.656) (-2216.507) -- 0:00:26
Average standard deviation of split frequencies: 0.004357
915500 -- [-2207.734] (-2213.438) (-2219.467) (-2213.460) * (-2225.587) (-2223.134) [-2206.035] (-2207.843) -- 0:00:25
916000 -- [-2211.641] (-2215.257) (-2217.672) (-2220.111) * [-2202.724] (-2220.844) (-2213.627) (-2214.680) -- 0:00:25
916500 -- [-2206.767] (-2209.309) (-2219.531) (-2233.283) * [-2204.853] (-2217.481) (-2208.333) (-2230.506) -- 0:00:25
917000 -- [-2213.618] (-2201.247) (-2218.355) (-2244.476) * (-2216.097) (-2210.963) (-2222.768) [-2214.474] -- 0:00:25
917500 -- (-2218.571) (-2209.071) [-2215.882] (-2222.125) * [-2205.949] (-2213.200) (-2213.859) (-2227.028) -- 0:00:25
918000 -- (-2227.818) [-2211.329] (-2209.025) (-2212.585) * (-2208.201) (-2206.374) (-2209.937) [-2210.850] -- 0:00:25
918500 -- (-2210.904) (-2213.169) [-2211.235] (-2213.445) * (-2202.069) (-2213.707) (-2205.325) [-2209.263] -- 0:00:25
919000 -- [-2208.813] (-2212.319) (-2212.157) (-2217.630) * (-2209.909) (-2209.613) [-2210.999] (-2210.393) -- 0:00:24
919500 -- (-2200.545) (-2219.727) [-2207.653] (-2219.989) * [-2207.531] (-2215.875) (-2217.767) (-2221.178) -- 0:00:24
920000 -- (-2212.972) (-2217.261) [-2207.693] (-2209.006) * (-2210.596) [-2212.375] (-2220.307) (-2207.289) -- 0:00:24
Average standard deviation of split frequencies: 0.004472
920500 -- (-2211.376) (-2215.397) [-2204.205] (-2205.381) * (-2211.728) [-2211.680] (-2223.027) (-2215.258) -- 0:00:24
921000 -- (-2211.548) [-2212.992] (-2211.772) (-2208.497) * (-2221.652) (-2218.197) (-2201.001) [-2211.054] -- 0:00:24
921500 -- (-2201.272) (-2210.027) [-2205.242] (-2218.915) * (-2217.633) (-2207.057) (-2211.599) [-2214.411] -- 0:00:24
922000 -- (-2219.365) (-2206.312) [-2204.827] (-2221.191) * (-2213.541) [-2203.691] (-2221.922) (-2219.110) -- 0:00:23
922500 -- (-2213.573) [-2208.139] (-2209.865) (-2201.678) * [-2206.453] (-2206.204) (-2210.342) (-2207.416) -- 0:00:23
923000 -- (-2204.866) [-2200.811] (-2213.028) (-2203.252) * (-2212.961) (-2207.513) (-2231.888) [-2206.067] -- 0:00:23
923500 -- (-2210.543) (-2225.273) (-2210.486) [-2203.215] * (-2216.172) (-2214.051) [-2209.736] (-2211.157) -- 0:00:23
924000 -- (-2222.779) (-2217.677) [-2204.517] (-2206.410) * (-2200.304) [-2208.528] (-2214.134) (-2220.297) -- 0:00:23
924500 -- (-2219.297) (-2213.357) (-2215.266) [-2207.994] * [-2214.575] (-2220.822) (-2207.626) (-2224.324) -- 0:00:23
925000 -- (-2205.316) (-2200.527) (-2225.102) [-2213.392] * (-2211.764) [-2210.756] (-2213.991) (-2213.003) -- 0:00:23
Average standard deviation of split frequencies: 0.004310
925500 -- (-2213.126) (-2218.139) [-2206.591] (-2221.688) * (-2213.079) [-2213.223] (-2205.313) (-2206.013) -- 0:00:22
926000 -- (-2215.938) [-2215.592] (-2208.149) (-2216.332) * (-2226.938) (-2220.287) [-2212.976] (-2207.944) -- 0:00:22
926500 -- (-2213.701) (-2207.875) [-2208.462] (-2216.874) * (-2201.999) [-2213.656] (-2232.048) (-2204.645) -- 0:00:22
927000 -- (-2224.126) (-2208.652) (-2215.646) [-2207.719] * (-2206.963) (-2207.757) [-2215.859] (-2214.948) -- 0:00:22
927500 -- (-2211.061) (-2203.779) (-2210.178) [-2206.720] * [-2208.581] (-2211.187) (-2208.084) (-2212.341) -- 0:00:22
928000 -- (-2215.899) (-2208.939) (-2215.132) [-2208.246] * (-2207.032) [-2203.936] (-2232.264) (-2209.354) -- 0:00:22
928500 -- (-2211.015) (-2210.543) (-2207.638) [-2209.075] * (-2211.679) [-2200.365] (-2213.398) (-2215.901) -- 0:00:21
929000 -- (-2217.283) (-2214.623) [-2206.144] (-2224.214) * (-2210.649) (-2212.933) (-2217.577) [-2206.973] -- 0:00:21
929500 -- (-2212.712) [-2214.148] (-2203.090) (-2202.973) * (-2210.642) (-2222.443) (-2209.303) [-2206.245] -- 0:00:21
930000 -- (-2216.648) (-2219.456) (-2218.729) [-2211.607] * (-2225.158) (-2217.448) (-2210.112) [-2211.284] -- 0:00:21
Average standard deviation of split frequencies: 0.004390
930500 -- (-2206.847) (-2216.218) [-2202.677] (-2212.901) * (-2209.750) (-2228.775) (-2213.153) [-2202.087] -- 0:00:21
931000 -- (-2210.804) (-2213.154) [-2209.134] (-2218.397) * (-2216.958) [-2212.400] (-2215.604) (-2218.728) -- 0:00:21
931500 -- (-2225.245) (-2218.367) (-2206.667) [-2204.339] * (-2209.986) (-2216.469) [-2201.188] (-2210.129) -- 0:00:21
932000 -- [-2199.642] (-2212.969) (-2208.175) (-2216.056) * (-2210.247) (-2218.717) (-2207.244) [-2209.584] -- 0:00:20
932500 -- (-2211.760) (-2232.804) [-2207.849] (-2211.985) * [-2206.350] (-2226.896) (-2224.263) (-2211.501) -- 0:00:20
933000 -- [-2206.587] (-2212.633) (-2212.191) (-2215.239) * (-2210.430) [-2212.016] (-2216.116) (-2211.673) -- 0:00:20
933500 -- (-2199.253) [-2207.507] (-2204.162) (-2214.268) * (-2207.374) [-2206.475] (-2212.794) (-2204.821) -- 0:00:20
934000 -- (-2211.985) [-2210.119] (-2212.245) (-2207.213) * (-2215.024) [-2206.960] (-2206.419) (-2205.840) -- 0:00:20
934500 -- [-2211.272] (-2207.913) (-2213.682) (-2219.159) * [-2205.260] (-2229.397) (-2213.599) (-2209.707) -- 0:00:20
935000 -- (-2227.041) (-2211.051) [-2207.477] (-2227.681) * (-2226.716) (-2215.259) (-2210.596) [-2205.874] -- 0:00:19
Average standard deviation of split frequencies: 0.004365
935500 -- (-2230.162) (-2225.707) [-2208.023] (-2213.791) * [-2202.531] (-2212.042) (-2212.025) (-2222.670) -- 0:00:19
936000 -- [-2219.853] (-2221.022) (-2215.594) (-2224.287) * (-2202.942) (-2210.466) (-2216.865) [-2202.032] -- 0:00:19
936500 -- (-2216.287) (-2214.252) (-2221.088) [-2213.247] * (-2206.954) (-2210.811) [-2212.097] (-2202.243) -- 0:00:19
937000 -- (-2210.233) [-2212.533] (-2220.596) (-2211.028) * (-2216.774) (-2210.390) [-2203.347] (-2216.283) -- 0:00:19
937500 -- (-2211.740) (-2214.396) (-2212.477) [-2218.630] * (-2206.699) [-2211.296] (-2217.771) (-2214.985) -- 0:00:19
938000 -- (-2213.885) (-2210.968) (-2222.895) [-2216.941] * [-2208.089] (-2219.592) (-2203.519) (-2208.336) -- 0:00:19
938500 -- (-2209.013) (-2211.743) [-2207.660] (-2219.393) * (-2205.324) (-2205.653) (-2221.877) [-2205.747] -- 0:00:18
939000 -- (-2208.018) (-2212.048) (-2222.706) [-2203.628] * [-2217.895] (-2212.015) (-2208.733) (-2211.126) -- 0:00:18
939500 -- (-2216.254) (-2208.433) [-2208.368] (-2207.565) * [-2210.363] (-2211.465) (-2211.264) (-2214.952) -- 0:00:18
940000 -- (-2205.882) (-2211.241) [-2208.966] (-2208.221) * (-2219.184) [-2213.581] (-2218.799) (-2201.623) -- 0:00:18
Average standard deviation of split frequencies: 0.003976
940500 -- (-2214.616) (-2211.213) [-2203.328] (-2204.210) * (-2207.239) (-2206.496) (-2225.693) [-2200.449] -- 0:00:18
941000 -- (-2204.251) (-2213.553) (-2216.569) [-2214.810] * (-2216.808) (-2216.168) (-2218.385) [-2207.042] -- 0:00:18
941500 -- [-2203.281] (-2215.053) (-2205.314) (-2208.226) * (-2217.966) (-2215.095) (-2225.553) [-2202.621] -- 0:00:17
942000 -- (-2208.743) (-2212.093) [-2213.415] (-2216.173) * [-2212.465] (-2209.580) (-2213.415) (-2206.396) -- 0:00:17
942500 -- (-2214.574) (-2209.957) [-2209.874] (-2219.027) * (-2208.089) [-2204.215] (-2219.233) (-2212.230) -- 0:00:17
943000 -- [-2210.007] (-2216.491) (-2210.286) (-2222.216) * (-2212.720) [-2205.185] (-2223.687) (-2214.797) -- 0:00:17
943500 -- (-2224.829) (-2228.839) [-2209.121] (-2212.062) * (-2219.227) [-2204.263] (-2206.959) (-2213.849) -- 0:00:17
944000 -- (-2218.103) [-2219.137] (-2217.302) (-2213.558) * (-2208.405) [-2201.197] (-2233.596) (-2216.330) -- 0:00:17
944500 -- (-2205.990) (-2215.029) (-2215.712) [-2203.659] * [-2205.133] (-2205.250) (-2218.938) (-2210.210) -- 0:00:17
945000 -- [-2206.890] (-2206.984) (-2209.672) (-2211.039) * (-2207.869) (-2213.849) [-2215.177] (-2204.096) -- 0:00:16
Average standard deviation of split frequencies: 0.004119
945500 -- (-2208.662) (-2206.673) (-2209.695) [-2207.298] * [-2206.251] (-2222.742) (-2214.968) (-2211.181) -- 0:00:16
946000 -- (-2210.194) [-2221.354] (-2208.218) (-2207.065) * (-2209.356) (-2224.421) [-2213.699] (-2211.541) -- 0:00:16
946500 -- (-2220.388) [-2207.950] (-2216.856) (-2209.975) * (-2208.887) (-2202.932) (-2210.979) [-2212.180] -- 0:00:16
947000 -- (-2214.034) (-2214.967) (-2208.806) [-2213.540] * [-2212.127] (-2207.302) (-2214.873) (-2210.038) -- 0:00:16
947500 -- (-2206.095) (-2227.570) (-2217.851) [-2214.077] * (-2215.446) (-2228.512) [-2207.602] (-2208.243) -- 0:00:16
948000 -- (-2212.020) (-2214.321) (-2222.049) [-2208.883] * [-2218.982] (-2212.926) (-2209.524) (-2209.961) -- 0:00:16
948500 -- [-2208.593] (-2212.527) (-2208.593) (-2209.575) * [-2209.911] (-2210.624) (-2210.026) (-2214.068) -- 0:00:15
949000 -- (-2215.312) (-2214.550) [-2210.992] (-2215.020) * (-2214.488) [-2210.097] (-2212.217) (-2217.744) -- 0:00:15
949500 -- (-2211.312) (-2212.195) (-2211.739) [-2215.744] * [-2208.245] (-2229.258) (-2204.897) (-2222.409) -- 0:00:15
950000 -- [-2204.951] (-2213.958) (-2223.344) (-2231.738) * (-2211.325) (-2219.925) [-2210.550] (-2229.413) -- 0:00:15
Average standard deviation of split frequencies: 0.004000
950500 -- (-2216.696) [-2215.332] (-2219.752) (-2214.046) * (-2208.385) (-2215.139) [-2208.935] (-2222.393) -- 0:00:15
951000 -- (-2221.546) (-2207.475) [-2205.288] (-2205.135) * (-2210.976) [-2207.238] (-2216.667) (-2217.808) -- 0:00:15
951500 -- [-2211.371] (-2214.311) (-2206.763) (-2218.870) * (-2217.662) (-2208.077) (-2216.297) [-2206.450] -- 0:00:14
952000 -- (-2211.641) (-2217.014) (-2208.522) [-2210.013] * [-2220.262] (-2207.356) (-2219.267) (-2205.387) -- 0:00:14
952500 -- (-2225.586) (-2211.304) (-2210.719) [-2209.181] * (-2217.367) (-2215.784) (-2213.597) [-2207.973] -- 0:00:14
953000 -- (-2213.914) (-2217.212) [-2214.794] (-2211.554) * (-2209.831) [-2206.431] (-2216.015) (-2212.606) -- 0:00:14
953500 -- (-2208.270) (-2213.227) (-2222.700) [-2213.822] * (-2206.662) [-2201.203] (-2227.506) (-2217.212) -- 0:00:14
954000 -- (-2208.716) (-2213.823) [-2205.353] (-2206.958) * (-2216.402) (-2214.052) [-2214.634] (-2203.485) -- 0:00:14
954500 -- (-2209.874) (-2209.757) [-2211.721] (-2218.479) * (-2218.814) (-2213.654) (-2210.615) [-2221.987] -- 0:00:14
955000 -- (-2210.692) (-2212.384) [-2208.061] (-2218.100) * (-2218.207) [-2204.418] (-2221.442) (-2216.410) -- 0:00:13
Average standard deviation of split frequencies: 0.004076
955500 -- (-2212.256) (-2205.986) [-2211.906] (-2214.008) * (-2213.630) (-2209.796) (-2205.730) [-2210.294] -- 0:00:13
956000 -- (-2211.046) (-2208.797) [-2208.468] (-2211.638) * (-2215.641) [-2209.674] (-2215.594) (-2211.561) -- 0:00:13
956500 -- (-2220.773) [-2210.603] (-2205.766) (-2208.888) * (-2214.421) [-2207.004] (-2214.786) (-2217.861) -- 0:00:13
957000 -- [-2205.319] (-2210.594) (-2214.766) (-2216.412) * (-2218.909) [-2206.988] (-2212.204) (-2218.647) -- 0:00:13
957500 -- [-2206.932] (-2219.267) (-2221.967) (-2215.887) * (-2211.251) (-2210.995) [-2205.546] (-2212.419) -- 0:00:13
958000 -- (-2218.854) [-2211.159] (-2214.216) (-2212.830) * (-2213.896) (-2209.481) [-2213.208] (-2214.571) -- 0:00:12
958500 -- (-2227.314) (-2212.459) (-2226.121) [-2209.768] * (-2208.825) (-2203.667) [-2210.876] (-2212.446) -- 0:00:12
959000 -- (-2212.862) (-2213.565) [-2218.737] (-2217.398) * (-2210.794) (-2209.782) [-2211.864] (-2211.946) -- 0:00:12
959500 -- (-2211.724) (-2213.580) (-2235.596) [-2207.354] * (-2228.053) (-2206.051) [-2209.240] (-2210.792) -- 0:00:12
960000 -- (-2204.144) (-2233.594) (-2232.841) [-2209.619] * (-2224.118) (-2208.432) [-2207.001] (-2210.468) -- 0:00:12
Average standard deviation of split frequencies: 0.004089
960500 -- (-2222.567) [-2206.980] (-2221.186) (-2213.956) * (-2216.016) [-2209.461] (-2210.157) (-2205.882) -- 0:00:12
961000 -- (-2204.746) (-2214.248) (-2209.226) [-2210.615] * (-2212.177) (-2210.846) [-2209.466] (-2219.179) -- 0:00:12
961500 -- (-2205.665) (-2214.101) (-2215.026) [-2215.900] * (-2211.151) [-2215.663] (-2215.424) (-2213.856) -- 0:00:11
962000 -- [-2211.221] (-2216.559) (-2212.875) (-2216.655) * [-2202.373] (-2222.025) (-2203.093) (-2203.502) -- 0:00:11
962500 -- (-2201.783) [-2211.663] (-2211.897) (-2212.223) * (-2205.727) [-2212.091] (-2217.849) (-2209.136) -- 0:00:11
963000 -- [-2204.163] (-2216.610) (-2213.281) (-2215.571) * (-2200.206) (-2217.193) (-2204.078) [-2199.023] -- 0:00:11
963500 -- [-2206.982] (-2226.286) (-2204.800) (-2208.872) * (-2211.210) [-2221.068] (-2213.375) (-2214.758) -- 0:00:11
964000 -- (-2205.240) (-2217.255) (-2208.491) [-2210.568] * [-2208.577] (-2210.376) (-2200.281) (-2217.143) -- 0:00:11
964500 -- [-2203.456] (-2202.457) (-2213.333) (-2205.568) * [-2205.567] (-2211.405) (-2207.543) (-2214.507) -- 0:00:10
965000 -- [-2208.186] (-2206.290) (-2216.438) (-2202.260) * [-2217.775] (-2218.086) (-2211.346) (-2223.700) -- 0:00:10
Average standard deviation of split frequencies: 0.003969
965500 -- (-2220.745) [-2215.230] (-2220.194) (-2214.158) * (-2216.708) (-2198.627) [-2205.728] (-2215.648) -- 0:00:10
966000 -- (-2213.996) (-2216.287) [-2208.214] (-2228.387) * (-2203.573) [-2210.227] (-2224.172) (-2211.843) -- 0:00:10
966500 -- [-2212.902] (-2211.337) (-2217.042) (-2211.083) * [-2203.767] (-2213.242) (-2207.427) (-2218.803) -- 0:00:10
967000 -- (-2211.599) [-2205.984] (-2210.040) (-2217.330) * (-2209.424) [-2198.873] (-2218.567) (-2217.434) -- 0:00:10
967500 -- (-2221.124) (-2209.258) [-2214.179] (-2218.251) * (-2203.828) (-2211.325) (-2217.780) [-2206.012] -- 0:00:10
968000 -- (-2209.854) (-2208.669) (-2214.250) [-2209.036] * [-2209.735] (-2212.472) (-2236.546) (-2222.475) -- 0:00:09
968500 -- (-2216.082) (-2214.889) [-2205.474] (-2210.951) * (-2210.708) (-2218.810) [-2215.731] (-2212.312) -- 0:00:09
969000 -- (-2217.352) [-2199.153] (-2216.715) (-2215.848) * (-2211.825) (-2223.588) [-2206.818] (-2206.301) -- 0:00:09
969500 -- (-2222.629) (-2210.243) (-2203.458) [-2207.151] * (-2213.960) (-2217.373) [-2208.902] (-2211.307) -- 0:00:09
970000 -- (-2216.776) (-2220.485) (-2211.778) [-2204.541] * (-2207.991) (-2204.101) (-2213.522) [-2212.272] -- 0:00:09
Average standard deviation of split frequencies: 0.004436
970500 -- (-2226.953) [-2211.803] (-2214.252) (-2220.395) * (-2230.550) (-2234.728) [-2215.572] (-2209.865) -- 0:00:09
971000 -- (-2216.803) (-2212.556) [-2211.272] (-2204.898) * (-2221.487) (-2205.833) (-2221.013) [-2208.051] -- 0:00:08
971500 -- (-2218.986) (-2213.890) [-2218.509] (-2214.149) * [-2206.678] (-2209.432) (-2217.189) (-2217.984) -- 0:00:08
972000 -- (-2212.729) [-2211.932] (-2204.435) (-2224.361) * (-2219.955) [-2203.075] (-2222.756) (-2214.447) -- 0:00:08
972500 -- [-2207.759] (-2210.412) (-2228.206) (-2201.245) * [-2214.471] (-2208.558) (-2221.250) (-2227.969) -- 0:00:08
973000 -- (-2211.621) (-2206.923) [-2203.613] (-2225.961) * (-2209.287) (-2209.495) (-2216.611) [-2217.406] -- 0:00:08
973500 -- (-2208.268) (-2200.819) [-2202.877] (-2219.132) * (-2211.416) [-2208.235] (-2212.668) (-2217.487) -- 0:00:08
974000 -- (-2207.943) [-2202.703] (-2209.782) (-2212.224) * (-2217.432) [-2206.951] (-2208.321) (-2207.467) -- 0:00:08
974500 -- [-2212.067] (-2209.879) (-2213.721) (-2213.973) * [-2211.867] (-2227.281) (-2207.010) (-2212.691) -- 0:00:07
975000 -- (-2205.681) (-2213.337) (-2218.814) [-2202.109] * [-2208.089] (-2223.765) (-2219.836) (-2218.204) -- 0:00:07
Average standard deviation of split frequencies: 0.004315
975500 -- (-2211.210) (-2215.994) (-2216.895) [-2206.975] * (-2218.062) [-2206.593] (-2215.681) (-2224.985) -- 0:00:07
976000 -- [-2209.437] (-2207.176) (-2210.294) (-2208.844) * (-2208.638) [-2211.634] (-2219.435) (-2226.817) -- 0:00:07
976500 -- (-2216.058) (-2206.659) (-2207.692) [-2211.622] * (-2217.588) (-2206.321) [-2207.384] (-2221.300) -- 0:00:07
977000 -- (-2211.665) (-2210.423) (-2211.179) [-2208.910] * [-2203.845] (-2208.500) (-2208.888) (-2213.594) -- 0:00:07
977500 -- [-2206.585] (-2204.694) (-2209.680) (-2231.672) * (-2221.268) [-2210.036] (-2210.143) (-2208.622) -- 0:00:06
978000 -- [-2212.873] (-2205.490) (-2222.273) (-2236.796) * (-2215.249) [-2215.277] (-2218.656) (-2219.490) -- 0:00:06
978500 -- (-2213.295) [-2210.817] (-2223.942) (-2220.435) * (-2210.376) (-2222.245) (-2216.509) [-2224.146] -- 0:00:06
979000 -- (-2228.432) [-2218.360] (-2216.075) (-2209.109) * (-2211.045) (-2208.232) (-2215.059) [-2207.308] -- 0:00:06
979500 -- (-2212.671) (-2227.611) [-2212.645] (-2215.870) * [-2215.318] (-2214.976) (-2223.596) (-2210.887) -- 0:00:06
980000 -- (-2221.588) (-2203.259) (-2206.364) [-2203.815] * [-2211.763] (-2217.060) (-2206.364) (-2204.178) -- 0:00:06
Average standard deviation of split frequencies: 0.004198
980500 -- (-2227.570) (-2207.225) (-2218.492) [-2204.504] * (-2218.258) (-2215.713) (-2209.565) [-2200.577] -- 0:00:06
981000 -- [-2219.160] (-2213.052) (-2209.185) (-2218.359) * (-2207.802) (-2221.025) (-2216.762) [-2206.758] -- 0:00:05
981500 -- [-2207.485] (-2208.262) (-2207.532) (-2219.659) * (-2208.508) [-2215.933] (-2208.429) (-2202.193) -- 0:00:05
982000 -- (-2219.428) (-2207.113) [-2205.002] (-2205.485) * (-2211.569) (-2216.117) (-2217.006) [-2199.974] -- 0:00:05
982500 -- (-2212.284) (-2216.649) (-2213.888) [-2211.500] * [-2212.411] (-2214.752) (-2212.842) (-2212.781) -- 0:00:05
983000 -- (-2213.642) (-2206.354) (-2216.961) [-2204.465] * (-2212.409) (-2210.667) (-2217.758) [-2211.940] -- 0:00:05
983500 -- (-2204.390) (-2207.850) [-2219.945] (-2206.786) * (-2219.570) (-2211.474) [-2209.625] (-2203.443) -- 0:00:05
984000 -- (-2206.828) (-2215.743) [-2211.763] (-2209.555) * (-2227.132) [-2210.663] (-2204.923) (-2211.021) -- 0:00:04
984500 -- (-2212.967) [-2216.484] (-2210.974) (-2216.780) * (-2216.779) [-2205.960] (-2209.250) (-2213.532) -- 0:00:04
985000 -- (-2213.352) [-2214.062] (-2207.941) (-2214.899) * [-2208.675] (-2210.639) (-2204.244) (-2206.841) -- 0:00:04
Average standard deviation of split frequencies: 0.004717
985500 -- (-2219.996) [-2211.056] (-2232.566) (-2212.313) * (-2210.512) (-2203.111) (-2219.739) [-2211.765] -- 0:00:04
986000 -- (-2214.398) [-2214.270] (-2211.644) (-2220.316) * (-2210.944) [-2217.012] (-2219.072) (-2211.296) -- 0:00:04
986500 -- (-2206.191) (-2211.044) (-2210.128) [-2211.375] * [-2210.020] (-2223.772) (-2209.687) (-2208.444) -- 0:00:04
987000 -- (-2219.702) [-2210.614] (-2220.812) (-2216.085) * [-2206.449] (-2213.198) (-2218.266) (-2210.570) -- 0:00:04
987500 -- [-2215.719] (-2216.523) (-2216.985) (-2226.138) * [-2207.811] (-2219.232) (-2212.050) (-2220.056) -- 0:00:03
988000 -- [-2205.965] (-2216.279) (-2219.154) (-2219.108) * (-2224.372) [-2220.806] (-2208.343) (-2214.982) -- 0:00:03
988500 -- (-2209.604) [-2213.464] (-2216.234) (-2203.946) * (-2228.324) (-2209.546) [-2219.307] (-2208.824) -- 0:00:03
989000 -- [-2211.601] (-2197.866) (-2222.784) (-2202.315) * (-2221.908) (-2205.325) (-2222.784) [-2211.934] -- 0:00:03
989500 -- (-2206.257) (-2204.971) [-2200.988] (-2209.895) * (-2223.428) (-2222.804) (-2211.707) [-2215.928] -- 0:00:03
990000 -- (-2212.391) [-2214.678] (-2219.332) (-2225.074) * (-2227.140) (-2211.111) (-2210.345) [-2206.645] -- 0:00:03
Average standard deviation of split frequencies: 0.004981
990500 -- [-2204.282] (-2206.881) (-2228.574) (-2210.102) * (-2218.799) (-2217.989) (-2217.728) [-2207.243] -- 0:00:02
991000 -- (-2206.019) (-2209.954) (-2222.618) [-2208.025] * (-2216.438) (-2224.766) [-2204.296] (-2214.716) -- 0:00:02
991500 -- (-2214.189) (-2212.790) (-2214.439) [-2200.291] * (-2222.674) (-2221.168) [-2207.820] (-2213.040) -- 0:00:02
992000 -- (-2217.557) (-2215.256) [-2201.579] (-2204.724) * (-2217.112) (-2212.831) [-2210.891] (-2216.499) -- 0:00:02
992500 -- [-2209.171] (-2222.690) (-2212.511) (-2202.517) * [-2210.650] (-2220.029) (-2210.135) (-2218.560) -- 0:00:02
993000 -- (-2229.096) (-2228.144) (-2221.273) [-2207.584] * [-2211.640] (-2218.684) (-2211.714) (-2223.624) -- 0:00:02
993500 -- (-2221.082) (-2208.889) (-2213.854) [-2207.251] * (-2215.120) [-2211.189] (-2209.644) (-2219.739) -- 0:00:02
994000 -- [-2206.131] (-2210.269) (-2213.071) (-2215.846) * (-2219.727) (-2208.501) [-2216.553] (-2211.344) -- 0:00:01
994500 -- (-2205.767) (-2211.434) (-2219.323) [-2209.291] * (-2217.666) [-2206.632] (-2207.115) (-2213.075) -- 0:00:01
995000 -- [-2210.066] (-2209.322) (-2206.924) (-2218.219) * (-2212.801) (-2208.895) (-2219.096) [-2203.574] -- 0:00:01
Average standard deviation of split frequencies: 0.004796
995500 -- (-2204.673) (-2222.508) [-2208.959] (-2206.274) * (-2209.514) (-2219.918) (-2212.652) [-2214.720] -- 0:00:01
996000 -- (-2216.540) (-2216.710) (-2206.135) [-2208.437] * [-2210.060] (-2206.167) (-2210.173) (-2215.450) -- 0:00:01
996500 -- (-2212.757) (-2221.972) (-2213.279) [-2217.015] * (-2219.737) [-2204.764] (-2215.930) (-2210.636) -- 0:00:01
997000 -- (-2206.728) [-2218.092] (-2213.985) (-2226.220) * (-2212.186) (-2215.095) [-2205.953] (-2216.795) -- 0:00:00
997500 -- (-2216.752) (-2216.877) (-2211.650) [-2204.074] * (-2228.958) (-2219.685) (-2208.646) [-2207.225] -- 0:00:00
998000 -- (-2230.458) (-2213.054) (-2210.742) [-2204.444] * (-2220.026) [-2207.061] (-2216.377) (-2209.701) -- 0:00:00
998500 -- (-2204.346) [-2202.883] (-2216.623) (-2226.949) * [-2216.919] (-2230.019) (-2220.534) (-2223.084) -- 0:00:00
999000 -- [-2203.320] (-2217.803) (-2209.688) (-2222.061) * (-2217.330) (-2222.174) [-2208.939] (-2213.060) -- 0:00:00
999500 -- (-2205.647) [-2210.751] (-2211.863) (-2220.327) * (-2225.143) [-2212.044] (-2202.385) (-2207.406) -- 0:00:00
1000000 -- (-2213.729) (-2207.471) (-2206.260) [-2211.921] * (-2218.941) [-2207.874] (-2219.073) (-2212.060) -- 0:00:00
Average standard deviation of split frequencies: 0.004899
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2213.728828 -- 26.505315
Chain 1 -- -2213.728842 -- 26.505315
Chain 2 -- -2207.471269 -- 22.582703
Chain 2 -- -2207.471273 -- 22.582703
Chain 3 -- -2206.260332 -- 25.410505
Chain 3 -- -2206.260329 -- 25.410505
Chain 4 -- -2211.920918 -- 27.862938
Chain 4 -- -2211.920912 -- 27.862938
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2218.941324 -- 28.171260
Chain 1 -- -2218.941324 -- 28.171260
Chain 2 -- -2207.873613 -- 24.602496
Chain 2 -- -2207.873614 -- 24.602496
Chain 3 -- -2219.072962 -- 25.721052
Chain 3 -- -2219.072962 -- 25.721052
Chain 4 -- -2212.059833 -- 25.780545
Chain 4 -- -2212.059824 -- 25.780545
Analysis completed in 5 mins 7 seconds
Analysis used 307.05 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2193.44
Likelihood of best state for "cold" chain of run 2 was -2193.63
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
49.4 % ( 43 %) Dirichlet(Revmat{all})
64.8 % ( 52 %) Slider(Revmat{all})
24.7 % ( 29 %) Dirichlet(Pi{all})
26.8 % ( 26 %) Slider(Pi{all})
54.8 % ( 30 %) Multiplier(Alpha{1,2})
44.4 % ( 24 %) Multiplier(Alpha{3})
34.3 % ( 23 %) Slider(Pinvar{all})
14.3 % ( 12 %) ExtSPR(Tau{all},V{all})
4.3 % ( 4 %) ExtTBR(Tau{all},V{all})
20.0 % ( 20 %) NNI(Tau{all},V{all})
18.2 % ( 18 %) ParsSPR(Tau{all},V{all})
26.8 % ( 28 %) Multiplier(V{all})
44.5 % ( 44 %) Nodeslider(V{all})
25.7 % ( 21 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
48.9 % ( 33 %) Dirichlet(Revmat{all})
65.0 % ( 57 %) Slider(Revmat{all})
24.5 % ( 26 %) Dirichlet(Pi{all})
26.8 % ( 24 %) Slider(Pi{all})
54.2 % ( 33 %) Multiplier(Alpha{1,2})
44.7 % ( 29 %) Multiplier(Alpha{3})
34.3 % ( 19 %) Slider(Pinvar{all})
14.3 % ( 17 %) ExtSPR(Tau{all},V{all})
4.3 % ( 5 %) ExtTBR(Tau{all},V{all})
20.5 % ( 28 %) NNI(Tau{all},V{all})
17.9 % ( 21 %) ParsSPR(Tau{all},V{all})
26.8 % ( 30 %) Multiplier(V{all})
44.4 % ( 39 %) Nodeslider(V{all})
25.6 % ( 24 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.51 0.34
2 | 167170 0.75 0.54
3 | 167005 166811 0.77
4 | 166073 166476 166465
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.51 0.34
2 | 167023 0.75 0.54
3 | 166580 166224 0.77
4 | 167119 166606 166448
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2206.61
| 1 1 2 |
| 2 1 |
| 1 2 2 2 2 2 |
|1 11 1 2 2 2 1 2 1 21 21 |
| 1 2 2 * 1 111 1 2 * 1 1 1|
|2 2 * 2 1* * 21 212 1 1 1 2 |
| 2 1 1 1 22 2* 1 2 21 2 1 11 22 1 2 |
| 2 2 11 2 2 11 * 2 2 2 2 |
| 2 *1 2 2 1 12 2 1 1 1 2 |
| 1 12|
| 2 1 1 1 2 |
| |
| 2 2 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2212.72
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2202.33 -2226.49
2 -2202.26 -2222.74
--------------------------------------
TOTAL -2202.30 -2225.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.398948 0.003586 0.291985 0.522766 0.394293 1187.85 1344.42 1.000
r(A<->C){all} 0.116702 0.001314 0.047389 0.185891 0.113409 539.30 694.28 1.000
r(A<->G){all} 0.240539 0.003111 0.140886 0.356073 0.235726 607.17 636.80 1.002
r(A<->T){all} 0.128960 0.001939 0.051691 0.215578 0.123400 858.59 864.40 1.000
r(C<->G){all} 0.061557 0.000391 0.025350 0.100529 0.059699 776.74 869.03 1.000
r(C<->T){all} 0.440501 0.004222 0.319848 0.571056 0.441155 552.44 611.49 1.001
r(G<->T){all} 0.011741 0.000119 0.000001 0.035259 0.008666 919.40 1037.66 1.001
pi(A){all} 0.238666 0.000159 0.213234 0.263546 0.238715 1112.06 1220.97 1.000
pi(C){all} 0.308803 0.000172 0.281245 0.333079 0.308930 1286.69 1343.28 1.000
pi(G){all} 0.272981 0.000175 0.246631 0.297647 0.272874 1129.15 1155.12 1.000
pi(T){all} 0.179549 0.000118 0.157869 0.199807 0.179360 1135.79 1182.40 1.000
alpha{1,2} 0.048430 0.000662 0.000106 0.087386 0.051533 1196.38 1264.40 1.000
alpha{3} 2.346881 0.620205 1.033658 3.967005 2.224011 1321.58 1411.29 1.000
pinvar{all} 0.753122 0.000680 0.702684 0.803493 0.754077 1335.67 1338.28 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- ....*******
13 -- ...********
14 -- .........**
15 -- .....**....
16 -- ..*********
17 -- .....**.***
18 -- ........***
19 -- ....*..*...
20 -- .....**..**
21 -- .....******
22 -- ....****.**
23 -- ....***.***
24 -- .....***.**
25 -- .**........
26 -- .*.********
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2997 0.998334 0.001413 0.997335 0.999334 2
13 2985 0.994337 0.000471 0.994004 0.994670 2
14 2977 0.991672 0.003298 0.989340 0.994004 2
15 2400 0.799467 0.006595 0.794803 0.804131 2
16 2326 0.774817 0.007537 0.769487 0.780147 2
17 2230 0.742838 0.001884 0.741506 0.744171 2
18 1778 0.592272 0.005653 0.588274 0.596269 2
19 1155 0.384744 0.009893 0.377748 0.391739 2
20 980 0.326449 0.000942 0.325783 0.327115 2
21 866 0.288474 0.003769 0.285809 0.291139 2
22 670 0.223185 0.003769 0.220520 0.225849 2
23 524 0.174550 0.005653 0.170553 0.178548 2
24 358 0.119254 0.016017 0.107928 0.130580 2
25 345 0.114923 0.002355 0.113258 0.116589 2
26 323 0.107595 0.004240 0.104597 0.110593 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.018506 0.000044 0.007533 0.031997 0.017598 1.000 2
length{all}[2] 0.003964 0.000009 0.000007 0.009949 0.003264 1.000 2
length{all}[3] 0.002108 0.000004 0.000001 0.006215 0.001496 1.000 2
length{all}[4] 0.005475 0.000015 0.000004 0.013120 0.004780 1.000 2
length{all}[5] 0.026531 0.000102 0.007707 0.045841 0.025405 1.000 2
length{all}[6] 0.020714 0.000061 0.007587 0.036809 0.019868 1.000 2
length{all}[7] 0.006992 0.000018 0.000363 0.015196 0.006173 1.000 2
length{all}[8] 0.079876 0.000444 0.042604 0.121433 0.077303 1.000 2
length{all}[9] 0.104104 0.000793 0.056311 0.163140 0.100287 1.000 2
length{all}[10] 0.009355 0.000030 0.000192 0.019337 0.008484 1.000 2
length{all}[11] 0.017966 0.000060 0.005331 0.032820 0.016788 1.000 2
length{all}[12] 0.033457 0.000181 0.008521 0.060238 0.032599 1.000 2
length{all}[13] 0.008771 0.000023 0.001406 0.018668 0.007858 1.000 2
length{all}[14] 0.020565 0.000101 0.003911 0.040118 0.019100 1.000 2
length{all}[15] 0.006746 0.000023 0.000002 0.015637 0.005840 1.000 2
length{all}[16] 0.003682 0.000008 0.000002 0.009328 0.003084 1.000 2
length{all}[17] 0.013281 0.000049 0.001957 0.026474 0.012258 1.000 2
length{all}[18] 0.011705 0.000061 0.000053 0.026249 0.010338 0.999 2
length{all}[19] 0.006023 0.000030 0.000004 0.015874 0.004552 0.999 2
length{all}[20] 0.010971 0.000052 0.000091 0.023320 0.009805 1.001 2
length{all}[21] 0.006550 0.000035 0.000024 0.018428 0.004869 1.000 2
length{all}[22] 0.017996 0.000108 0.000702 0.036488 0.016402 1.001 2
length{all}[23] 0.005424 0.000029 0.000009 0.016148 0.003967 0.998 2
length{all}[24] 0.007366 0.000035 0.000014 0.018663 0.006238 0.997 2
length{all}[25] 0.002378 0.000006 0.000005 0.007191 0.001652 0.998 2
length{all}[26] 0.001955 0.000004 0.000000 0.005631 0.001215 0.997 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004899
Maximum standard deviation of split frequencies = 0.016017
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
+ /------------------------------------------------------------ C3 (3)
| |
| | /-------------------------------------------------- C4 (4)
\----77---+ |
| | /---------------------------------------- C5 (5)
| | |
\----99---+ | /---------- C6 (6)
| | /---------80--------+
| | | \---------- C7 (7)
| | |
\---100---+----74---+ /-------------------- C9 (9)
| | |
| \----59---+ /---------- C10 (10)
| \----99---+
| \---------- C11 (11)
|
\---------------------------------------- C8 (8)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
|- C2 (2)
|
+/- C3 (3)
||
|| /-- C4 (4)
\+ |
| | /----------- C5 (5)
| | |
\---+ | /-------- C6 (6)
| | /--+
| | | \-- C7 (7)
| | |
\-------------+----+ /------------------------------------------- C9 (9)
| | |
| \----+ /---- C10 (10)
| \-------+
| \------- C11 (11)
|
\--------------------------------- C8 (8)
|-------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (212 trees sampled):
50 % credible set contains 6 trees
90 % credible set contains 56 trees
95 % credible set contains 96 trees
99 % credible set contains 182 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 1071
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sequences read..
Counting site patterns.. 0:00
137 patterns at 357 / 357 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
133712 bytes for conP
18632 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
534848 bytes for conP, adjusted
0.021083 0.004745 0.001828 0.000988 0.007568 0.006240 0.036676 0.034309 0.007546 0.006354 0.021343 0.010396 0.003145 0.078212 0.022995 0.013227 0.018516 0.077636 0.300000 1.300000
ntime & nrate & np: 18 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 20
lnL0 = -2439.027070
Iterating by ming2
Initial: fx= 2439.027070
x= 0.02108 0.00475 0.00183 0.00099 0.00757 0.00624 0.03668 0.03431 0.00755 0.00635 0.02134 0.01040 0.00314 0.07821 0.02299 0.01323 0.01852 0.07764 0.30000 1.30000
1 h-m-p 0.0000 0.0000 823.4513 ++ 2437.466398 m 0.0000 25 | 1/20
2 h-m-p 0.0000 0.0000 491.9692 +YYCCCC 2435.265672 5 0.0000 57 | 1/20
3 h-m-p 0.0000 0.0000 1642.1179 YCCCC 2434.146959 4 0.0000 87 | 1/20
4 h-m-p 0.0000 0.0000 1377.1631 YCCCC 2432.894547 4 0.0000 117 | 1/20
5 h-m-p 0.0000 0.0000 1892.7410 YCYCCC 2429.359799 5 0.0000 148 | 1/20
6 h-m-p 0.0000 0.0001 1106.8372 +CYYYYYY 2410.145896 6 0.0001 179 | 1/20
7 h-m-p 0.0000 0.0000 9489.0925 +CYCCC 2392.961081 4 0.0000 210 | 1/20
8 h-m-p 0.0000 0.0000 25146.2842 +YYCCC 2385.762461 4 0.0000 240 | 1/20
9 h-m-p 0.0000 0.0001 1853.2495 ++ 2370.106221 m 0.0001 263 | 1/20
10 h-m-p 0.0000 0.0000 1572.1626 +YYYYYYC 2365.145299 6 0.0000 293 | 1/20
11 h-m-p 0.0000 0.0000 3566.7053 +YCYCCC 2358.874796 5 0.0000 325 | 1/20
12 h-m-p 0.0000 0.0002 790.9894 YCYCCC 2352.505971 5 0.0001 356 | 1/20
13 h-m-p 0.0001 0.0003 735.1397 YCYCCC 2343.674569 5 0.0001 387 | 1/20
14 h-m-p 0.0000 0.0002 302.0761 YCYCCC 2341.800044 5 0.0001 418 | 1/20
15 h-m-p 0.0000 0.0006 776.0830 ++YYCYCCC 2296.390231 6 0.0006 452 | 1/20
16 h-m-p 0.0000 0.0000 122727.5876 +CYCCC 2285.684683 4 0.0000 483 | 1/20
17 h-m-p 0.0000 0.0000 18307.8466 CCCCC 2285.150385 4 0.0000 514 | 1/20
18 h-m-p 0.0000 0.0003 211.8348 +CCC 2283.799134 2 0.0002 542 | 1/20
19 h-m-p 0.0001 0.0006 170.5338 CCCC 2282.763293 3 0.0002 571 | 1/20
20 h-m-p 0.0034 0.0170 4.4110 ++ 2270.181502 m 0.0170 594 | 1/20
21 h-m-p 0.0000 0.0000 357.4059
h-m-p: 4.68809244e-21 2.34404622e-20 3.57405853e+02 2270.181502
.. | 1/20
22 h-m-p 0.0000 0.0000 26779.4790 YYCCCCC 2231.977051 6 0.0000 648 | 1/20
23 h-m-p 0.0000 0.0000 1176.2441 +YYCYYCC 2207.193172 6 0.0000 681 | 1/20
24 h-m-p 0.0000 0.0000 3011.0640 +YCCC 2201.429980 3 0.0000 710 | 1/20
25 h-m-p 0.0000 0.0001 726.6844 +YYYYC 2191.976990 4 0.0001 738 | 1/20
26 h-m-p 0.0000 0.0000 1502.0322 +YYCYCC 2181.615507 5 0.0000 769 | 1/20
27 h-m-p 0.0000 0.0001 1251.8340 +YCYCCC 2160.359943 5 0.0001 802 | 1/20
28 h-m-p 0.0000 0.0000 25147.6203 ++ 2150.755318 m 0.0000 825 | 1/20
29 h-m-p 0.0000 0.0000 87044.4503
h-m-p: 2.89090988e-23 1.44545494e-22 8.70444503e+04 2150.755318
.. | 1/20
30 h-m-p 0.0000 0.0000 8579.1069 CYCYCCCC 2136.201821 7 0.0000 880 | 1/20
31 h-m-p 0.0000 0.0000 740.3354 ++ 2120.817607 m 0.0000 903 | 2/20
32 h-m-p 0.0000 0.0000 2449.8080 +YYYCCCCC 2117.200706 7 0.0000 938 | 2/20
33 h-m-p 0.0000 0.0000 613.1132 +YYCCC 2113.473452 4 0.0000 968 | 2/20
34 h-m-p 0.0000 0.0000 237.8167 CYCCC 2113.115610 4 0.0000 998 | 2/20
35 h-m-p 0.0001 0.0006 81.7886 YCCC 2112.835131 3 0.0001 1026 | 2/20
36 h-m-p 0.0001 0.0003 89.0283 C 2112.705608 0 0.0001 1049 | 2/20
37 h-m-p 0.0000 0.0004 131.4584 CC 2112.574528 1 0.0001 1074 | 2/20
38 h-m-p 0.0001 0.0006 68.4999 YCC 2112.513224 2 0.0001 1100 | 2/20
39 h-m-p 0.0001 0.0018 50.2115 YC 2112.423667 1 0.0002 1124 | 2/20
40 h-m-p 0.0002 0.0030 50.1411 CCC 2112.332775 2 0.0002 1151 | 2/20
41 h-m-p 0.0001 0.0032 141.5519 +YCCC 2111.544854 3 0.0006 1180 | 2/20
42 h-m-p 0.0001 0.0005 679.3922 CCCC 2110.736515 3 0.0001 1209 | 2/20
43 h-m-p 0.0001 0.0008 1035.6404 CCCC 2110.029484 3 0.0001 1238 | 2/20
44 h-m-p 0.0001 0.0010 1075.6498 +YCC 2107.840269 2 0.0003 1265 | 2/20
45 h-m-p 0.0004 0.0037 698.2346 CYC 2107.387936 2 0.0001 1291 | 2/20
46 h-m-p 0.0004 0.0022 26.6342 C 2107.370730 0 0.0001 1314 | 2/20
47 h-m-p 0.0002 0.0045 13.9030 CC 2107.366498 1 0.0001 1339 | 2/20
48 h-m-p 0.0093 4.6547 0.1260 ++++YCCC 2106.814672 3 1.6045 1371 | 2/20
49 h-m-p 1.6000 8.0000 0.0709 CCC 2106.706606 2 1.3336 1416 | 2/20
50 h-m-p 1.6000 8.0000 0.0279 CC 2106.677232 1 1.9251 1459 | 2/20
51 h-m-p 1.6000 8.0000 0.0110 C 2106.652884 0 1.6000 1500 | 2/20
52 h-m-p 1.6000 8.0000 0.0069 YCCC 2106.577639 3 2.9478 1546 | 2/20
53 h-m-p 0.7830 8.0000 0.0261 CC 2106.560347 1 1.2248 1589 | 2/20
54 h-m-p 1.6000 8.0000 0.0007 YC 2106.559596 1 1.0463 1631 | 2/20
55 h-m-p 1.4271 8.0000 0.0005 Y 2106.559577 0 1.0446 1672 | 2/20
56 h-m-p 1.6000 8.0000 0.0000 Y 2106.559576 0 1.1081 1713 | 2/20
57 h-m-p 1.1410 8.0000 0.0000 C 2106.559576 0 1.1162 1754 | 2/20
58 h-m-p 1.6000 8.0000 0.0000 Y 2106.559576 0 0.8350 1795 | 2/20
59 h-m-p 1.6000 8.0000 0.0000 Y 2106.559576 0 0.8555 1836 | 2/20
60 h-m-p 1.6000 8.0000 0.0000 +Y 2106.559576 0 4.4096 1878 | 2/20
61 h-m-p 1.2557 8.0000 0.0000 ---------------Y 2106.559576 0 0.0000 1934
Out..
lnL = -2106.559576
1935 lfun, 1935 eigenQcodon, 34830 P(t)
Time used: 0:11
Model 1: NearlyNeutral
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
0.021083 0.004745 0.001828 0.000988 0.007568 0.006240 0.036676 0.034309 0.007546 0.006354 0.021343 0.010396 0.003145 0.078212 0.022995 0.013227 0.018516 0.077636 2.090272 0.652999 0.498354
ntime & nrate & np: 18 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.028302
np = 21
lnL0 = -2274.329875
Iterating by ming2
Initial: fx= 2274.329875
x= 0.02108 0.00475 0.00183 0.00099 0.00757 0.00624 0.03668 0.03431 0.00755 0.00635 0.02134 0.01040 0.00314 0.07821 0.02299 0.01323 0.01852 0.07764 2.09027 0.65300 0.49835
1 h-m-p 0.0000 0.0000 773.7654 ++ 2272.908609 m 0.0000 26 | 1/21
2 h-m-p 0.0000 0.0000 377.9905 +YCYCCC 2271.860788 5 0.0000 59 | 1/21
3 h-m-p 0.0000 0.0000 887.3916 CCCC 2271.352728 3 0.0000 89 | 1/21
4 h-m-p 0.0000 0.0000 454.1884 CCC 2270.813742 2 0.0000 117 | 1/21
5 h-m-p 0.0000 0.0001 425.3065 +YYCCC 2269.115895 4 0.0000 148 | 1/21
6 h-m-p 0.0000 0.0002 563.6070 +YYYCCCCC 2261.905098 7 0.0002 184 | 1/21
7 h-m-p 0.0000 0.0000 6212.2920 +YYYYCCCCC 2253.092890 8 0.0000 221 | 1/21
8 h-m-p 0.0000 0.0000 26689.7191 ++ 2199.704304 m 0.0000 245 | 1/21
9 h-m-p -0.0000 -0.0000 16449108.9648
h-m-p: -2.88204829e-25 -1.44102415e-24 1.64491090e+07 2199.704304
.. | 1/21
10 h-m-p 0.0000 0.0001 12244.2314 YCYYCCC 2185.538890 6 0.0000 299 | 1/21
11 h-m-p 0.0000 0.0001 681.7496 +YCYCCC 2162.988008 5 0.0001 332 | 1/21
12 h-m-p 0.0000 0.0000 4493.3574 +YYCCC 2150.332206 4 0.0000 363 | 1/21
13 h-m-p 0.0000 0.0000 1948.6589 ++ 2139.167936 m 0.0000 387 | 2/21
14 h-m-p 0.0000 0.0001 941.5795 YCYCCC 2134.544035 5 0.0000 419 | 2/21
15 h-m-p 0.0000 0.0000 674.3484 ++ 2130.802428 m 0.0000 443 | 3/21
16 h-m-p 0.0001 0.0003 237.0559 CCCC 2129.597715 3 0.0001 473 | 3/21
17 h-m-p 0.0000 0.0000 351.3610 +YYYCCC 2127.986192 5 0.0000 505 | 3/21
18 h-m-p 0.0000 0.0000 913.8954 +YYCCCC 2126.222492 5 0.0000 538 | 3/21
19 h-m-p 0.0000 0.0000 1273.3439 +YYYCCC 2123.828893 5 0.0000 570 | 3/21
20 h-m-p 0.0000 0.0001 1259.5480 YCCC 2120.877482 3 0.0000 599 | 3/21
21 h-m-p 0.0001 0.0004 172.0610 +YYCCC 2115.718645 4 0.0003 630 | 3/21
22 h-m-p 0.0000 0.0001 264.0053 +YYCCC 2113.432295 4 0.0001 661 | 3/21
23 h-m-p 0.0001 0.0011 138.4317 YCCC 2111.768860 3 0.0002 690 | 3/21
24 h-m-p 0.0010 0.0054 28.9492 -YCC 2111.723722 2 0.0001 718 | 3/21
25 h-m-p 0.0010 0.0200 2.7867 +YCC 2111.485352 2 0.0027 746 | 3/21
26 h-m-p 0.0003 0.0025 25.8946 CCCC 2110.968154 3 0.0004 776 | 3/21
27 h-m-p 0.0005 0.0025 19.6227 CCC 2110.945099 2 0.0001 804 | 3/21
28 h-m-p 0.0007 0.0871 3.0805 CC 2110.940404 1 0.0006 830 | 3/21
29 h-m-p 0.0042 0.5349 0.4237 +++CYYCCC 2108.056204 5 0.3705 865 | 3/21
30 h-m-p 0.1829 3.0690 0.8585 YCCC 2107.575308 3 0.3949 912 | 3/21
31 h-m-p 0.4142 2.0711 0.4012 CYC 2107.042585 2 0.4051 957 | 3/21
32 h-m-p 0.9897 4.9485 0.0857 CYC 2106.818651 2 0.9462 1002 | 3/21
33 h-m-p 1.6000 8.0000 0.0319 YC 2106.782717 1 1.1939 1045 | 3/21
34 h-m-p 1.6000 8.0000 0.0020 YC 2106.722666 1 2.6414 1088 | 3/21
35 h-m-p 0.4465 8.0000 0.0120 +YC 2106.682003 1 1.2268 1132 | 3/21
36 h-m-p 0.8849 8.0000 0.0166 YC 2106.638946 1 1.6548 1175 | 3/21
37 h-m-p 1.6000 8.0000 0.0078 CCC 2106.577935 2 2.4402 1221 | 3/21
38 h-m-p 1.2207 8.0000 0.0155 CC 2106.536539 1 1.4987 1265 | 3/21
39 h-m-p 1.6000 8.0000 0.0112 YC 2106.520831 1 1.1510 1308 | 3/21
40 h-m-p 1.6000 8.0000 0.0033 CC 2106.515648 1 2.1899 1352 | 3/21
41 h-m-p 1.4303 8.0000 0.0051 C 2106.514192 0 1.2744 1394 | 3/21
42 h-m-p 1.6000 8.0000 0.0004 C 2106.513866 0 1.6472 1436 | 3/21
43 h-m-p 0.8941 8.0000 0.0007 C 2106.513827 0 1.1848 1478 | 3/21
44 h-m-p 1.6000 8.0000 0.0001 C 2106.513824 0 1.2996 1520 | 3/21
45 h-m-p 1.6000 8.0000 0.0000 Y 2106.513824 0 1.0425 1562 | 3/21
46 h-m-p 1.1885 8.0000 0.0000 Y 2106.513824 0 0.8237 1604 | 3/21
47 h-m-p 1.6000 8.0000 0.0000 --C 2106.513824 0 0.0250 1648 | 3/21
48 h-m-p 0.0282 8.0000 0.0000 +C 2106.513824 0 0.1129 1691 | 3/21
49 h-m-p 0.1378 8.0000 0.0000 Y 2106.513824 0 0.0345 1733 | 3/21
50 h-m-p 0.0341 8.0000 0.0000 C 2106.513824 0 0.0341 1775 | 3/21
51 h-m-p 0.0393 8.0000 0.0000 -Y 2106.513824 0 0.0025 1818
Out..
lnL = -2106.513824
1819 lfun, 5457 eigenQcodon, 65484 P(t)
Time used: 0:31
Model 2: PositiveSelection
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
initial w for M2:NSpselection reset.
0.021083 0.004745 0.001828 0.000988 0.007568 0.006240 0.036676 0.034309 0.007546 0.006354 0.021343 0.010396 0.003145 0.078212 0.022995 0.013227 0.018516 0.077636 2.089657 1.001601 0.301958 0.109127 2.014820
ntime & nrate & np: 18 3 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.741904
np = 23
lnL0 = -2269.717452
Iterating by ming2
Initial: fx= 2269.717452
x= 0.02108 0.00475 0.00183 0.00099 0.00757 0.00624 0.03668 0.03431 0.00755 0.00635 0.02134 0.01040 0.00314 0.07821 0.02299 0.01323 0.01852 0.07764 2.08966 1.00160 0.30196 0.10913 2.01482
1 h-m-p 0.0000 0.0000 859.1151 ++ 2267.709154 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0000 467.9729 +YYCYC 2265.818812 4 0.0000 60 | 1/23
3 h-m-p 0.0000 0.0000 1624.8211 YCCC 2264.584458 3 0.0000 91 | 1/23
4 h-m-p 0.0000 0.0003 414.8794 +CCYC 2261.407571 3 0.0001 123 | 1/23
5 h-m-p 0.0000 0.0002 476.1328 +YYCYCC 2255.101539 5 0.0001 157 | 1/23
6 h-m-p 0.0000 0.0000 1074.3830 ++ 2248.056060 m 0.0000 183 | 2/23
7 h-m-p 0.0000 0.0003 698.9639 CYCC 2246.994187 3 0.0001 214 | 2/23
8 h-m-p 0.0001 0.0004 313.3639 YCCC 2245.415480 3 0.0002 245 | 2/23
9 h-m-p 0.0000 0.0001 788.7178 YCYCCC 2244.190289 5 0.0000 279 | 2/23
10 h-m-p 0.0000 0.0001 641.5572 +YYCCC 2241.912075 4 0.0001 312 | 2/23
11 h-m-p 0.0001 0.0006 708.3583 +CYC 2231.833857 2 0.0004 342 | 2/23
12 h-m-p 0.0001 0.0003 3088.2281 CCCC 2225.120811 3 0.0001 374 | 2/23
13 h-m-p 0.0001 0.0007 735.7547 +YCCC 2215.362898 3 0.0005 406 | 2/23
14 h-m-p 0.0001 0.0003 239.0416 +CYCCC 2213.087903 4 0.0002 440 | 2/23
15 h-m-p 0.0002 0.0012 289.2828 +YYYC 2204.747817 3 0.0007 470 | 2/23
16 h-m-p 0.0003 0.0016 229.1081 +YYYCCC 2185.298855 5 0.0012 504 | 2/23
17 h-m-p 0.0000 0.0002 537.9728 CYCCC 2183.182297 4 0.0001 537 | 2/23
18 h-m-p 0.0001 0.0005 174.4862 YYC 2182.594224 2 0.0001 565 | 2/23
19 h-m-p 0.0003 0.0052 46.2457 +CCCC 2181.159245 3 0.0015 598 | 2/23
20 h-m-p 0.0125 0.1671 5.4964 +YCCYCCC 2168.654355 6 0.1397 636 | 2/23
21 h-m-p 0.0504 0.2520 8.1765 YCC 2159.957920 2 0.0829 665 | 2/23
22 h-m-p 0.0533 0.2666 2.8610 CCCC 2154.899592 3 0.0770 697 | 2/23
23 h-m-p 0.0335 0.1674 5.2225 CYCCC 2149.520442 4 0.0655 730 | 2/23
24 h-m-p 0.0778 0.3892 2.4097 +YYYYC 2130.782776 4 0.3048 761 | 2/23
25 h-m-p 0.1024 0.5121 2.3720 YCYCCC 2124.059856 5 0.2388 795 | 2/23
26 h-m-p 0.1104 0.5518 1.8565 +YYCCC 2119.798430 4 0.3647 828 | 2/23
27 h-m-p 0.4173 2.0867 1.3276 CCCCC 2115.855744 4 0.7683 862 | 2/23
28 h-m-p 0.4783 2.3913 1.0055 CCCC 2114.165095 3 0.7573 894 | 2/23
29 h-m-p 0.4824 5.2076 1.5782 YCCC 2113.376344 3 0.3001 925 | 2/23
30 h-m-p 0.3299 1.6493 0.5104 +YCYCC 2112.038147 4 0.9759 958 | 2/23
31 h-m-p 0.6188 4.5915 0.8051 YCCCC 2109.564570 4 1.2860 1012 | 2/23
32 h-m-p 0.5126 2.5628 1.1785 CCC 2108.621471 2 0.5744 1063 | 2/23
33 h-m-p 0.2662 1.3308 2.3051 CCCC 2107.669644 3 0.3416 1095 | 2/23
34 h-m-p 1.3927 6.9637 0.2555 CYC 2107.202810 2 1.3247 1124 | 2/23
35 h-m-p 1.6000 8.0000 0.2082 YCC 2107.063064 2 1.0788 1174 | 2/23
36 h-m-p 1.6000 8.0000 0.0801 CYC 2106.953308 2 1.7113 1224 | 2/23
37 h-m-p 0.7583 8.0000 0.1807 +CCC 2106.838530 2 2.7656 1276 | 2/23
38 h-m-p 1.6000 8.0000 0.2521 CCC 2106.746696 2 1.4607 1327 | 2/23
39 h-m-p 1.5538 8.0000 0.2370 CC 2106.673897 1 1.8376 1376 | 2/23
40 h-m-p 1.6000 8.0000 0.2212 CC 2106.629211 1 2.3405 1425 | 2/23
41 h-m-p 1.6000 8.0000 0.2104 YCC 2106.592220 2 3.0096 1475 | 2/23
42 h-m-p 1.6000 8.0000 0.3076 YCC 2106.557389 2 2.7929 1525 | 2/23
43 h-m-p 1.6000 8.0000 0.4570 CY 2106.534505 1 1.6300 1574 | 2/23
44 h-m-p 1.5172 8.0000 0.4909 C 2106.523868 0 1.5172 1621 | 2/23
45 h-m-p 1.6000 8.0000 0.4037 YC 2106.514812 1 3.9930 1669 | 2/23
46 h-m-p 1.6000 8.0000 0.4349 C 2106.512433 0 1.5361 1716 | 2/23
47 h-m-p 1.6000 8.0000 0.2269 C 2106.512202 0 1.5345 1763 | 2/23
48 h-m-p 1.6000 8.0000 0.0940 C 2106.512122 0 2.5242 1810 | 2/23
49 h-m-p 1.6000 8.0000 0.0768 YC 2106.512005 1 3.8140 1858 | 2/23
50 h-m-p 1.6000 8.0000 0.0502 Y 2106.511929 0 3.1665 1905 | 2/23
51 h-m-p 1.6000 8.0000 0.0880 ++ 2106.511622 m 8.0000 1952 | 2/23
52 h-m-p 1.4304 8.0000 0.4921 C 2106.511432 0 2.2881 1999 | 2/23
53 h-m-p 1.6000 8.0000 0.2459 Y 2106.511368 0 2.5954 2046 | 2/23
54 h-m-p 1.6000 8.0000 0.3934 +Y 2106.511302 0 4.0215 2094 | 2/23
55 h-m-p 1.6000 8.0000 0.4379 C 2106.511282 0 1.8794 2141 | 2/23
56 h-m-p 1.6000 8.0000 0.3055 C 2106.511278 0 1.9873 2188 | 2/23
57 h-m-p 1.6000 8.0000 0.1417 +Y 2106.511276 0 4.5213 2236 | 2/23
58 h-m-p 1.6000 8.0000 0.2759 Y 2106.511273 0 3.5873 2283 | 2/23
59 h-m-p 1.6000 8.0000 0.3507 Y 2106.511272 0 2.8829 2330 | 2/23
60 h-m-p 1.6000 8.0000 0.4034 C 2106.511272 0 2.2712 2377 | 2/23
61 h-m-p 1.6000 8.0000 0.4200 Y 2106.511272 0 3.6740 2424 | 2/23
62 h-m-p 1.6000 8.0000 0.3734 C 2106.511272 0 1.8305 2471 | 2/23
63 h-m-p 1.6000 8.0000 0.4130 +Y 2106.511272 0 4.5795 2519 | 2/23
64 h-m-p 1.6000 8.0000 0.3533 C 2106.511272 0 1.4530 2566 | 2/23
65 h-m-p 1.0799 8.0000 0.4753 Y 2106.511272 0 2.5255 2613 | 2/23
66 h-m-p 1.6000 8.0000 0.7324 +Y 2106.511272 0 4.4900 2661 | 2/23
67 h-m-p 1.6000 8.0000 1.0904 Y 2106.511272 0 0.7218 2708 | 2/23
68 h-m-p 0.0310 3.4746 25.4262 +Y 2106.511272 0 0.0921 2735 | 2/23
69 h-m-p 0.5373 8.0000 4.3594 +C 2106.511272 0 2.5657 2762 | 2/23
70 h-m-p 0.4351 2.9106 25.7054 C 2106.511272 0 0.6240 2788 | 2/23
71 h-m-p 0.3533 1.7663 33.2782 C 2106.511272 0 0.2855 2814 | 2/23
72 h-m-p 0.3504 1.8176 27.1121 Y 2106.511272 0 0.1421 2840 | 2/23
73 h-m-p 0.1690 1.9935 22.7867 C 2106.511272 0 0.0423 2866 | 2/23
74 h-m-p 0.0416 1.9218 23.1365 --------------.. | 2/23
75 h-m-p 0.0002 0.1115 0.0342 ---------- | 2/23
76 h-m-p 0.0160 8.0000 0.0661 ------Y 2106.511272 0 0.0000 2991 | 2/23
77 h-m-p 0.0019 0.9342 0.0184 --Y 2106.511272 0 0.0000 3040 | 2/23
78 h-m-p 0.0059 2.9422 0.0066 --Y 2106.511272 0 0.0000 3089 | 2/23
79 h-m-p 0.0047 2.3617 0.0049 -----C 2106.511272 0 0.0000 3141 | 2/23
80 h-m-p 0.0090 4.5173 0.0055 ---C 2106.511272 0 0.0001 3191 | 2/23
81 h-m-p 0.0160 8.0000 0.0023 ---Y 2106.511272 0 0.0001 3241 | 2/23
82 h-m-p 0.0160 8.0000 0.0018 ----C 2106.511272 0 0.0000 3292 | 2/23
83 h-m-p 0.0160 8.0000 0.0013 ---Y 2106.511272 0 0.0001 3342 | 2/23
84 h-m-p 0.0160 8.0000 0.0010 ---C 2106.511272 0 0.0001 3392 | 2/23
85 h-m-p 0.0160 8.0000 0.0006 ---------C 2106.511272 0 0.0000 3448
Out..
lnL = -2106.511272
3449 lfun, 13796 eigenQcodon, 186246 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2157.902427 S = -2130.889039 -18.617041
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 137 patterns 1:29
did 20 / 137 patterns 1:29
did 30 / 137 patterns 1:30
did 40 / 137 patterns 1:30
did 50 / 137 patterns 1:30
did 60 / 137 patterns 1:30
did 70 / 137 patterns 1:30
did 80 / 137 patterns 1:30
did 90 / 137 patterns 1:30
did 100 / 137 patterns 1:30
did 110 / 137 patterns 1:30
did 120 / 137 patterns 1:30
did 130 / 137 patterns 1:30
did 137 / 137 patterns 1:30
Time used: 1:30
Model 3: discrete
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
0.021083 0.004745 0.001828 0.000988 0.007568 0.006240 0.036676 0.034309 0.007546 0.006354 0.021343 0.010396 0.003145 0.078212 0.022995 0.013227 0.018516 0.077636 2.089641 0.898262 0.025525 0.000050 0.000113 0.000175
ntime & nrate & np: 18 4 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.729032
np = 24
lnL0 = -2111.137208
Iterating by ming2
Initial: fx= 2111.137208
x= 0.02108 0.00475 0.00183 0.00099 0.00757 0.00624 0.03668 0.03431 0.00755 0.00635 0.02134 0.01040 0.00314 0.07821 0.02299 0.01323 0.01852 0.07764 2.08964 0.89826 0.02553 0.00005 0.00011 0.00017
1 h-m-p 0.0000 0.0000 755.9796 ++ 2111.031244 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0000 898.0748 ++ 2110.838834 m 0.0000 104 | 2/24
3 h-m-p 0.0000 0.0000 2148.0863 ++ 2110.733156 m 0.0000 154 | 3/24
4 h-m-p 0.0000 0.0000 1979.0191 ++ 2110.557668 m 0.0000 203 | 4/24
5 h-m-p 0.0000 0.0003 117.9054 +CCC 2110.310716 2 0.0001 256 | 4/24
6 h-m-p 0.0001 0.0008 103.7627 CCC 2110.179176 2 0.0000 307 | 4/24
7 h-m-p 0.0000 0.0002 74.7703 YYYC 2110.111596 3 0.0000 357 | 4/24
8 h-m-p 0.0001 0.0028 34.4578 YCC 2110.081722 2 0.0001 407 | 4/24
9 h-m-p 0.0001 0.0007 34.6278 YC 2110.065082 1 0.0000 455 | 4/24
10 h-m-p 0.0003 0.0036 6.3631 YC 2110.051325 1 0.0002 503 | 4/24
11 h-m-p 0.0001 0.0015 12.4038 CC 2110.015853 1 0.0001 552 | 4/24
12 h-m-p 0.0001 0.0021 16.5594 +CCC 2109.572027 2 0.0005 604 | 4/24
13 h-m-p 0.0001 0.0005 45.6076 YCCC 2108.701591 3 0.0002 656 | 4/24
14 h-m-p 0.0001 0.0004 60.7969 YCY 2108.588725 2 0.0001 706 | 4/24
15 h-m-p 0.0002 0.0022 16.5084 CC 2108.578154 1 0.0001 755 | 4/24
16 h-m-p 0.0001 0.0159 10.4684 CC 2108.570593 1 0.0002 804 | 4/24
17 h-m-p 0.0006 0.0184 3.1208 C 2108.569599 0 0.0002 851 | 4/24
18 h-m-p 0.0003 0.0291 1.8118 CC 2108.568650 1 0.0002 900 | 4/24
19 h-m-p 0.0012 0.3310 0.3311 +++YCYCCC 2107.176502 5 0.1645 958 | 4/24
20 h-m-p 0.2289 1.9523 0.2379 YCCC 2106.687856 3 0.4729 1010 | 4/24
21 h-m-p 0.2220 3.1956 0.5068 CC 2106.638528 1 0.2199 1059 | 4/24
22 h-m-p 1.0319 5.1597 0.0446 CCC 2106.533341 2 1.1500 1110 | 4/24
23 h-m-p 1.6000 8.0000 0.0190 CYC 2106.520546 2 0.4809 1160 | 4/24
24 h-m-p 0.9229 8.0000 0.0099 CC 2106.514007 1 1.2289 1209 | 4/24
25 h-m-p 1.4043 8.0000 0.0087 CC 2106.511829 1 1.7305 1258 | 4/24
26 h-m-p 1.6000 8.0000 0.0032 C 2106.511355 0 1.3380 1305 | 4/24
27 h-m-p 1.6000 8.0000 0.0016 C 2106.511284 0 1.6810 1352 | 4/24
28 h-m-p 1.6000 8.0000 0.0005 C 2106.511272 0 1.5068 1399 | 4/24
29 h-m-p 1.6000 8.0000 0.0000 Y 2106.511272 0 1.1470 1446 | 4/24
30 h-m-p 1.1513 8.0000 0.0000 Y 2106.511272 0 0.8180 1493 | 4/24
31 h-m-p 1.6000 8.0000 0.0000 C 2106.511272 0 0.4351 1540 | 4/24
32 h-m-p 0.8754 8.0000 0.0000 C 2106.511272 0 0.2189 1587 | 4/24
33 h-m-p 0.3009 8.0000 0.0000 C 2106.511272 0 0.0834 1634 | 4/24
34 h-m-p 0.0936 8.0000 0.0000 C 2106.511272 0 0.0234 1681 | 4/24
35 h-m-p 0.0230 8.0000 0.0000 --------Y 2106.511272 0 0.0000 1736
Out..
lnL = -2106.511272
1737 lfun, 6948 eigenQcodon, 93798 P(t)
Time used: 1:58
Model 7: beta
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
0.021083 0.004745 0.001828 0.000988 0.007568 0.006240 0.036676 0.034309 0.007546 0.006354 0.021343 0.010396 0.003145 0.078212 0.022995 0.013227 0.018516 0.077636 2.089643 0.649633 1.679063
ntime & nrate & np: 18 1 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 10.030074
np = 21
lnL0 = -2199.076779
Iterating by ming2
Initial: fx= 2199.076779
x= 0.02108 0.00475 0.00183 0.00099 0.00757 0.00624 0.03668 0.03431 0.00755 0.00635 0.02134 0.01040 0.00314 0.07821 0.02299 0.01323 0.01852 0.07764 2.08964 0.64963 1.67906
1 h-m-p 0.0000 0.0000 758.0108 ++ 2197.624830 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 379.4561 +YCYCCC 2196.740681 5 0.0000 101 | 1/21
3 h-m-p 0.0000 0.0000 812.4669 CCCC 2196.122302 3 0.0000 151 | 1/21
4 h-m-p 0.0000 0.0001 312.7260 CCCC 2195.587300 3 0.0000 201 | 1/21
5 h-m-p 0.0000 0.0002 326.7653 YCCC 2194.388054 3 0.0001 250 | 1/21
6 h-m-p 0.0000 0.0002 260.7721 YCCCC 2192.877748 4 0.0001 301 | 1/21
7 h-m-p 0.0000 0.0003 728.1441 +CCCC 2188.763122 3 0.0001 352 | 1/21
8 h-m-p 0.0000 0.0001 890.7863 +YYYCCC 2184.815584 5 0.0001 404 | 1/21
9 h-m-p 0.0000 0.0001 3151.9581 +YCCYCCC 2159.720966 6 0.0001 460 | 1/21
10 h-m-p 0.0000 0.0000 37778.2453 ++ 2147.222374 m 0.0000 504 | 2/21
11 h-m-p 0.0000 0.0001 646.6601 CC 2146.594242 1 0.0000 550 | 2/21
12 h-m-p 0.0000 0.0001 123.3567 CCCC 2146.433926 3 0.0000 599 | 2/21
13 h-m-p 0.0001 0.0014 36.0963 CCC 2146.329208 2 0.0002 646 | 2/21
14 h-m-p 0.0001 0.0031 105.7965 +CCCC 2145.876765 3 0.0003 696 | 2/21
15 h-m-p 0.0001 0.0013 500.5359 +
QuantileBeta(0.15, 0.00500, 2.45010) = 1.044445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.20228) = 1.192554e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.20662) = 1.189605e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.32836) = 1.112357e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21831) = 1.181732e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.27333) = 1.146007e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21902) = 1.181255e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.24618) = 1.163367e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
C 2141.785505 4 0.0006 747
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.181129e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21921) = 1.222362e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21933) = 1.181047e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.21909) = 1.181211e-160 2000 rounds
| 2/21
16 h-m-p 0.0000 0.0002 2112.3937
QuantileBeta(0.15, 0.00500, 2.31206) = 1.122121e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.59059) = 9.756184e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.68344) = 9.348700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.45474) = 1.042017e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.46257) = 1.037949e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.52658) = 1.005827e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47615) = 1.030965e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.47677) = 1.030648e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.50168) = 1.018088e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47739) = 1.030330e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.48953) = 1.024173e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
C 2138.016349 5 0.0001 799
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.030314e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47742) = 1.066282e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47755) = 1.030249e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47729) = 1.030380e-160 2000 rounds
| 2/21
17 h-m-p 0.0000 0.0002 1440.3408
QuantileBeta(0.15, 0.00500, 2.54753) = 9.957376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.75786) = 9.045693e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.62650) = 9.594511e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.63307) = 9.565490e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.69546) = 9.298387e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.64909) = 9.495455e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.65000) = 9.491520e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.67273) = 9.393968e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65116) = 9.486466e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.66195) = 9.439992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
C 2135.353214 5 0.0001 850
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.486109e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65125) = 9.817266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65138) = 9.485532e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65111) = 9.486686e-161 2000 rounds
| 2/21
18 h-m-p 0.0002 0.0008 772.5660
QuantileBeta(0.15, 0.00500, 2.76417) = 9.020915e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10292) = 7.862681e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.21584) = 7.539664e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94213) = 8.373191e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.95657) = 8.324671e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.02975) = 8.087122e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96781) = 8.287280e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.99878) = 8.185985e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96871) = 8.284317e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.98374) = 8.234859e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
C 2131.134763 4 0.0004 901
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.283706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96889) = 8.572887e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96903) = 8.283240e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96875) = 8.284172e-161 2000 rounds
| 2/21
19 h-m-p 0.0001 0.0005 833.5490
QuantileBeta(0.15, 0.00500, 3.04315) = 8.045052e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.26594) = 7.404661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04112) = 8.051407e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.15455) = 7.711655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04429) = 8.041498e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.09942) = 7.873142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
C 2130.144334 2 0.0001 948
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.041444e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04431) = 8.322168e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04445) = 8.041000e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04417) = 8.041889e-161 2000 rounds
| 2/21
20 h-m-p 0.0629 1.6792 1.2631
QuantileBeta(0.15, 0.00500, 3.07420) = 7.949299e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16385) = 7.685047e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.52247) = 6.782462e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.32655) = 7.247622e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.33012) = 7.238567e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.42630) = 7.003129e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.34911) = 7.190851e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.38770) = 7.095754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35051) = 7.187365e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.36911) = 7.141267e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35099) = 7.186156e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.36005) = 7.163642e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
C 2121.679558 5 0.6457 1001
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.186096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35102) = 7.436960e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35117) = 7.185722e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35087) = 7.186469e-161 2000 rounds
| 2/21
21 h-m-p 0.1434 0.7170 3.6690
QuantileBeta(0.15, 0.00500, 3.30299) = 7.307870e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15891) = 7.699144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30544) = 7.301559e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.23095) = 7.498432e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30072) = 7.313717e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.26584) = 7.404928e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
C 2119.266615 2 0.1506 1048
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.314081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30058) = 7.569413e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30073) = 7.313697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30043) = 7.314465e-161 2000 rounds
| 2/21
22 h-m-p 0.6447 3.2236 0.2280
QuantileBeta(0.15, 0.00500, 3.20104) = 7.580494e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.90241) = 8.509619e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.20755) = 7.562481e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.05173) = 8.018384e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18818) = 7.616325e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.11995) = 7.812213e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18634) = 7.621468e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.15315) = 7.715668e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18588) = 7.622761e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.16952) = 7.668935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
C 2116.596512 4 0.7431 1099
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.622860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18585) = 7.888971e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18599) = 7.622451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18570) = 7.623269e-161 2000 rounds
| 2/21
23 h-m-p 0.9482 5.8754 0.1786
QuantileBeta(0.15, 0.00500, 3.31428) = 7.278865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.69959) = 6.410336e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36180) = 7.159312e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.53069) = 6.764241e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37347) = 7.130545e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.45208) = 6.942586e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37519) = 7.126318e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.41363) = 7.033257e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
C 2114.617592 3 1.3992 1148
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.125875e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37537) = 7.374637e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37552) = 7.125507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37522) = 7.126244e-161 2000 rounds
| 2/21
24 h-m-p 0.7643 4.5658 0.3271
QuantileBeta(0.15, 0.00500, 3.62042) = 6.571528e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35556) = 5.326963e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89110) = 6.051194e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.89391) = 6.046227e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.12474) = 5.663919e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90305) = 6.030110e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.01389) = 5.841299e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
C 2112.569180 3 1.6466 1196
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.029640e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90332) = 6.240133e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90348) = 6.029355e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.90316) = 6.029925e-161 2000 rounds
| 2/21
25 h-m-p 1.5855 8.0000 0.3397
QuantileBeta(0.15, 0.00500, 4.42745) = 5.230035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.99985) = 3.740317e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.78720) = 4.793459e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.75686) = 4.827456e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.59215) = 5.020707e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74859) = 4.836802e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.67037) = 4.927043e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
C 2110.647341 3 2.5562 1244
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 4.837091e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74833) = 5.005953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74852) = 4.836887e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.74815) = 4.837296e-161 2000 rounds
| 2/21
26 h-m-p 0.9256 4.6281 0.6366
QuantileBeta(0.15, 0.00500, 5.33751) = 4.250476e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.10503) = 3.116008e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.61471) = 4.020972e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.35987) = 3.511184e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67092) = 3.977414e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.01540) = 3.729805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67804) = 3.971968e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 5.84672) = 3.847085e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
C 2109.368958 3 1.4616 1293
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 3.971490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67866) = 4.110134e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67886) = 3.971338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.67846) = 3.971643e-161 2000 rounds
| 2/21
27 h-m-p 0.5896 2.9480 0.9509
QuantileBeta(0.15, 0.00500, 6.23808) = 3.585488e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.91634) = 2.775790e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82999) = 3.251074e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 6.81335) = 3.259622e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 6.52572) = 3.414807e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82025) = 3.256071e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
C 2108.255628 3 1.2032 1340
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.256082e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82023) = 3.369750e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82045) = 3.255968e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.82001) = 3.256196e-161 2000 rounds
| 2/21
28 h-m-p 1.6000 8.0000 0.6671
QuantileBeta(0.15, 0.00500, 7.88599) = 2.787175e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.08329) = 1.946104e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.11223) = 2.704486e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 9.59776) = 2.263490e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07639) = 2.717257e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 7.98119) = 2.751772e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
C 2107.446808 2 1.8814 1387
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.718312e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07345) = 2.813208e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07369) = 2.718224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 8.07320) = 2.718400e-161 2000 rounds
| 2/21
29 h-m-p 1.6000 8.0000 0.5999
QuantileBeta(0.15, 0.00500, 9.03169) = 2.413462e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.90642) = 1.805790e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.19173) = 2.369084e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 10.54908) = 2.049451e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.26407) = 2.349556e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 9.90657) = 2.189272e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
C 2106.978130 2 1.9980 1434
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.347951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27007) = 2.429917e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.27034) = 2.347880e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.26981) = 2.348022e-161 2000 rounds
| 2/21
30 h-m-p 1.6000 8.0000 0.3482
QuantileBeta(0.15, 0.00500, 9.82702) = 2.207921e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.49788) = 1.872809e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.27472) = 2.106912e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 10.28017) = 2.105738e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 10.88903) = 1.982457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
C 2106.699749 2 2.9183 1480
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.104502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28592) = 2.177969e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28621) = 2.104441e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.28564) = 2.104563e-161 2000 rounds
| 2/21
31 h-m-p 1.6000 8.0000 0.1831
QuantileBeta(0.15, 0.00500, 10.57673) = 2.043833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 11.44915) = 1.881137e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.55950) = 2.047329e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 11.01294) = 1.959114e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58560) = 2.042036e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 10.79927) = 1.999716e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
C 2106.568594 2 1.6551 1527
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.041805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58675) = 2.113084e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58704) = 2.041747e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.58646) = 2.041864e-161 2000 rounds
| 2/21
32 h-m-p 1.6000 8.0000 0.0899
QuantileBeta(0.15, 0.00500, 10.44405) = 2.071074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.01595) = 2.164137e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.49156) = 2.061236e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 10.48693) = 2.062191e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 10.46549) = 2.066623e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
C 2106.526161 2 1.1254 1573
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.062306e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48637) = 2.134300e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48666) = 2.062246e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.48608) = 2.062365e-161 2000 rounds
| 2/21
33 h-m-p 0.5865 8.0000 0.1726
QuantileBeta(0.15, 0.00500, 10.38520) = 2.083389e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.08169) = 2.149308e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24058) = 2.114287e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
C 2106.512724 1 1.4245 1617
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.114275e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24063) = 2.188084e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24092) = 2.114214e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.24035) = 2.114337e-161 2000 rounds
| 2/21
34 h-m-p 1.6000 8.0000 0.0164
QuantileBeta(0.15, 0.00500, 10.26679) = 2.108620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.34524) = 2.091835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26067) = 2.109940e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
C 2106.511339 1 1.2272 1661
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.109935e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26069) = 2.183593e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26098) = 2.109874e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.26041) = 2.109996e-161 2000 rounds
| 2/21
35 h-m-p 1.3573 8.0000 0.0148
QuantileBeta(0.15, 0.00500, 10.28075) = 2.105614e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.34092) = 2.092754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103561e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 10.31561) = 2.098144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
C 2106.510920 1 2.0033 1706
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.103563e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29030) = 2.176998e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29058) = 2.103502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29001) = 2.103624e-161 2000 rounds
| 2/21
36 h-m-p 1.6000 8.0000 0.0061
QuantileBeta(0.15, 0.00500, 10.30008) = 2.101465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.32944) = 2.095195e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
C 2106.510887 0 1.3174 1749
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29835) = 2.175209e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29864) = 2.101774e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29807) = 2.101896e-161 2000 rounds
| 2/21
37 h-m-p 1.6000 8.0000 0.0006
QuantileBeta(0.15, 0.00500, 10.29737) = 2.102045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29444) = 2.102674e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
C 2106.510883 0 1.2984 1792
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.102005e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29756) = 2.175386e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29784) = 2.101944e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29727) = 2.102066e-161 2000 rounds
| 2/21
38 h-m-p 1.1807 8.0000 0.0007
QuantileBeta(0.15, 0.00500, 10.29835) = 2.101835e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.30073) = 2.101325e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
C 2106.510882 0 1.7206 1835
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.101757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29871) = 2.175129e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29900) = 2.101697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29843) = 2.101818e-161 2000 rounds
| 2/21
39 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 10.29912) = 2.101670e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.30034) = 2.101409e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
C 2106.510882 0 1.4055 1878
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.101681e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29907) = 2.175050e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29936) = 2.101620e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29879) = 2.101742e-161 2000 rounds
| 2/21
40 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 10.29888) = 2.101722e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29830) = 2.101845e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
C 2106.510882 0 2.4398 1921
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.175115e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29906) = 2.101683e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29850) = 2.101804e-161 2000 rounds
| 2/21
41 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 10.29879) = 2.101740e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101743e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101743e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
Y 2106.510882 0 0.0016 1968
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
Out..
lnL = -2106.510882
1969 lfun, 21659 eigenQcodon, 354420 P(t)
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.29878) = 2.101744e-161 2000 rounds
Time used: 4:09
Model 8: beta&w>1
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
initial w for M8:NSbetaw>1 reset.
0.021083 0.004745 0.001828 0.000988 0.007568 0.006240 0.036676 0.034309 0.007546 0.006354 0.021343 0.010396 0.003145 0.078212 0.022995 0.013227 0.018516 0.077636 2.089650 0.900000 0.578325 1.546757 2.928793
ntime & nrate & np: 18 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.990992
np = 23
lnL0 = -2235.653751
Iterating by ming2
Initial: fx= 2235.653751
x= 0.02108 0.00475 0.00183 0.00099 0.00757 0.00624 0.03668 0.03431 0.00755 0.00635 0.02134 0.01040 0.00314 0.07821 0.02299 0.01323 0.01852 0.07764 2.08965 0.90000 0.57833 1.54676 2.92879
1 h-m-p 0.0000 0.0000 973.9191 ++ 2232.747233 m 0.0000 51 | 1/23
2 h-m-p 0.0000 0.0000 849.5155 +YCYYCCC 2227.095808 6 0.0000 110 | 1/23
3 h-m-p 0.0000 0.0000 7147.4795 +CCCC 2220.348500 3 0.0000 165 | 1/23
4 h-m-p 0.0000 0.0001 1256.5728 ++ 2198.898567 m 0.0001 213 | 2/23
5 h-m-p 0.0000 0.0002 227.3435 YCYCCC 2197.228286 5 0.0001 269 | 2/23
6 h-m-p 0.0000 0.0001 354.4208 YCYCCC 2196.141659 5 0.0000 324 | 2/23
7 h-m-p 0.0000 0.0002 681.8372 +YYYC 2192.670345 3 0.0001 375 | 2/23
8 h-m-p 0.0000 0.0002 1032.9876 CCCCC 2189.143859 4 0.0001 430 | 2/23
9 h-m-p 0.0001 0.0003 946.8038 +YYCYCCC 2177.742493 6 0.0002 487 | 2/23
10 h-m-p 0.0000 0.0000 6728.6885 ++ 2150.672787 m 0.0000 534 | 3/23
11 h-m-p 0.0001 0.0003 371.9372 YCCCC 2146.743033 4 0.0001 588 | 2/23
12 h-m-p 0.0000 0.0001 1058.0646 YCCCC 2141.042357 4 0.0001 641 | 2/23
13 h-m-p 0.0000 0.0001 565.5185 CYCCC 2138.340791 4 0.0000 695 | 2/23
14 h-m-p 0.0000 0.0002 265.4657 +YCCC 2136.675321 3 0.0001 748 | 2/23
15 h-m-p 0.0000 0.0001 130.4539 CCCC 2136.355584 3 0.0000 801 | 2/23
16 h-m-p 0.0001 0.0005 57.9028 ++ 2135.060399 m 0.0005 848 | 2/23
17 h-m-p 0.0000 0.0003 637.8719 +CYCCC 2131.062528 4 0.0002 903 | 2/23
18 h-m-p 0.0000 0.0000 2197.8357 YCCCC 2130.206804 4 0.0000 957 | 2/23
19 h-m-p 0.0000 0.0000 561.5121 ++ 2128.770013 m 0.0000 1004 | 3/23
20 h-m-p 0.0006 0.0060 43.5117 +CCCC 2126.895438 3 0.0024 1058 | 3/23
21 h-m-p 0.0008 0.0040 32.9797 +YYCCC 2124.941084 4 0.0028 1111 | 3/23
22 h-m-p 0.0068 0.0340 10.7082 +YYCYC 2119.707162 4 0.0233 1163 | 3/23
23 h-m-p 0.0670 0.3351 2.0163
QuantileBeta(0.15, 0.00500, 2.16632) = 1.217568e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.18913) = 1.201584e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14432) = 1.233391e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.14848) = 1.230370e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.15740) = 1.223936e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14991) = 1.229329e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.15366) = 1.226627e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
C 2113.729163 3 0.2201 1215
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15013) = 1.229171e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.14989) = 1.229345e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.15001) = 1.229258e-160 2000 rounds
| 3/23
24 h-m-p 0.0883 0.4417 3.6526
QuantileBeta(0.15, 0.00500, 2.29020) = 1.135483e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71076) = 9.235166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28433) = 1.139125e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.21717) = 1.182496e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28546) = 1.138423e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.28783) = 1.136951e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
C 2110.362650 2 0.0853 1265
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.178239e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28547) = 1.138417e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28522) = 1.138571e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.28534) = 1.138494e-160 2000 rounds
| 3/23
25 h-m-p 0.2362 3.3782 1.3189
QuantileBeta(0.15, 0.00500, 2.26008) = 1.154418e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.18429) = 1.204944e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24064) = 1.166973e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.24430) = 1.164588e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.25219) = 1.159481e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24547) = 1.163828e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.24883) = 1.161650e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
C 2109.287378 3 0.3722 1316
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.204417e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24565) = 1.163710e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24540) = 1.163870e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.24553) = 1.163790e-160 2000 rounds
| 3/23
26 h-m-p 0.8836 4.4178 0.5475
QuantileBeta(0.15, 0.00500, 2.37513) = 1.085258e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.76393) = 9.021832e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32288) = 1.115623e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.32490) = 1.114416e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.28420) = 1.139203e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32378) = 1.115085e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
C 2108.042409 3 0.5335 1366
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.154014e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32390) = 1.115012e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32365) = 1.115162e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.32377) = 1.115087e-160 2000 rounds
| 3/23
27 h-m-p 1.0811 5.4054 0.0853
QuantileBeta(0.15, 0.00500, 2.35383) = 1.097437e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.44398) = 1.047659e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.35803) = 1.095013e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.40101) = 1.070818e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36302) = 1.092146e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.38201) = 1.081378e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36361) = 1.091812e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.37281) = 1.086570e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
C 2107.034013 3 1.4379 1418
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.129844e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36387) = 1.091660e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36362) = 1.091804e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36375) = 1.091732e-160 2000 rounds
| 3/23
28 h-m-p 0.3212 4.2341 0.3819
QuantileBeta(0.15, 0.00500, 2.38273) = 1.080976e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43968) = 1.049931e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37981) = 1.082616e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.37178) = 1.087155e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38075) = 1.082087e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
C 2106.866265 2 0.2878 1467
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.119857e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38089) = 1.082011e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38063) = 1.082153e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38076) = 1.082082e-160 2000 rounds
| 3/23
29 h-m-p 1.6000 8.0000 0.0411
QuantileBeta(0.15, 0.00500, 2.37274) = 1.086608e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.34869) = 1.100415e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37539) = 1.085112e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.37563) = 1.084972e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.37820) = 1.083525e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37574) = 1.084911e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.37697) = 1.084218e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
C 2106.688208 3 1.0002 1518
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.122781e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37587) = 1.084836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37562) = 1.084979e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37575) = 1.084907e-160 2000 rounds
| 3/23
30 h-m-p 1.4921 8.0000 0.0275
QuantileBeta(0.15, 0.00500, 2.38354) = 1.080521e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40692) = 1.067572e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38241) = 1.081155e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.37908) = 1.083028e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38280) = 1.080935e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
C 2106.627114 2 1.3513 1567
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.118669e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38293) = 1.080863e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38268) = 1.081005e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.38281) = 1.080934e-160 2000 rounds
| 3/23
31 h-m-p 0.8401 8.0000 0.0443
QuantileBeta(0.15, 0.00500, 2.38627) = 1.078995e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39665) = 1.073220e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39038) = 1.076700e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
C 2106.558655 1 1.8315 1614
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.114304e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39048) = 1.076646e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39023) = 1.076787e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39035) = 1.076716e-160 2000 rounds
| 3/23
32 h-m-p 1.6000 8.0000 0.0169
QuantileBeta(0.15, 0.00500, 2.39305) = 1.075216e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.40115) = 1.070739e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39329) = 1.075086e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.39722) = 1.072908e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
C 2106.539406 1 1.7455 1662
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.112610e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39342) = 1.075009e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39317) = 1.075150e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39330) = 1.075079e-160 2000 rounds
| 3/23
33 h-m-p 1.6000 8.0000 0.0111
QuantileBeta(0.15, 0.00500, 2.38659) = 1.078813e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36648) = 1.090169e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37829) = 1.083473e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
C 2106.527850 1 3.5724 1709
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.121274e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37846) = 1.083380e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37820) = 1.083522e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37833) = 1.083451e-160 2000 rounds
| 3/23
34 h-m-p 1.6000 8.0000 0.0138
QuantileBeta(0.15, 0.00500, 2.37111) = 1.087533e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.34946) = 1.099966e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36439) = 1.091365e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
C 2106.517632 1 3.0938 1756
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.129472e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36450) = 1.091300e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36425) = 1.091445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36437) = 1.091372e-160 2000 rounds
| 3/23
35 h-m-p 1.6000 8.0000 0.0050
QuantileBeta(0.15, 0.00500, 2.36638) = 1.090226e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37241) = 1.086799e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
C 2106.515260 0 1.7200 1802
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.128196e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36666) = 1.090068e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36641) = 1.090212e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36653) = 1.090140e-160 2000 rounds
| 3/23
36 h-m-p 1.6000 8.0000 0.0018
QuantileBeta(0.15, 0.00500, 2.36845) = 1.089049e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37419) = 1.085789e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
C 2106.514987 0 2.0182 1848
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.126772e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36907) = 1.088692e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36882) = 1.088836e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36895) = 1.088764e-160 2000 rounds
| 3/23
37 h-m-p 1.6000 8.0000 0.0011
QuantileBeta(0.15, 0.00500, 2.36964) = 1.088369e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37173) = 1.087185e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088018e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
C 2106.514803 1 3.0247 1895
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.126000e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087946e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
| 3/23
38 h-m-p 1.5575 8.0000 0.0021
QuantileBeta(0.15, 0.00500, 2.37020) = 1.088050e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37003) = 1.088146e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
Y 2106.514747 0 2.6419 1941
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.126056e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37029) = 1.088000e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37004) = 1.088144e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088072e-160 2000 rounds
| 3/23
39 h-m-p 1.6000 8.0000 0.0008
QuantileBeta(0.15, 0.00500, 2.36982) = 1.088268e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36878) = 1.088857e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
C 2106.514729 0 1.8205 1987
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.126287e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36990) = 1.088224e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36965) = 1.088367e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36977) = 1.088295e-160 2000 rounds
| 3/23
40 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 2.36979) = 1.088284e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36985) = 1.088252e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
Y 2106.514723 0 3.6376 2033
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.126262e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36994) = 1.088199e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36969) = 1.088342e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.36981) = 1.088271e-160 2000 rounds
| 3/23
41 h-m-p 1.3844 8.0000 0.0008
QuantileBeta(0.15, 0.00500, 2.37006) = 1.088131e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37080) = 1.087711e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
C 2106.514719 0 1.7931 2079
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.126074e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088018e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37001) = 1.088161e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37013) = 1.088089e-160 2000 rounds
| 3/23
42 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088080e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37020) = 1.088050e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
Y 2106.514719 0 1.2019 2125
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.126067e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37027) = 1.088010e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37002) = 1.088154e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37015) = 1.088082e-160 2000 rounds
| 3/23
43 h-m-p 1.1249 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 2.37016) = 1.088073e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088047e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.37025) = 1.088021e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
C 2106.514719 0 4.3882 2172
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.126032e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37033) = 1.087977e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37008) = 1.088120e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37021) = 1.088048e-160 2000 rounds
| 3/23
44 h-m-p 0.6843 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37043) = 1.087921e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.37086) = 1.087676e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
Y 2106.514719 0 2.2269 2219
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.125925e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37051) = 1.087873e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37026) = 1.088017e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37039) = 1.087945e-160 2000 rounds
| 3/23
45 h-m-p 1.3455 8.0000 0.0005
QuantileBeta(0.15, 0.00500, 2.37056) = 1.087845e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37109) = 1.087548e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
C 2106.514719 0 1.8068 2265
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.125787e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37075) = 1.087740e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37050) = 1.087883e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37062) = 1.087811e-160 2000 rounds
| 3/23
46 h-m-p 1.6000 8.0000 0.0005
QuantileBeta(0.15, 0.00500, 2.37082) = 1.087698e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37142) = 1.087358e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
+ 2106.514719 m 8.0000 2311
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.125199e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37175) = 1.087172e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37150) = 1.087316e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37162) = 1.087244e-160 2000 rounds
| 3/23
47 h-m-p 1.5068 8.0000 0.0025
QuantileBeta(0.15, 0.00500, 2.37266) = 1.086653e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37579) = 1.084883e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
+ 2106.514715 m 8.0000 2357
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.121958e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37728) = 1.084040e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37703) = 1.084183e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.37716) = 1.084112e-160 2000 rounds
| 3/23
48 h-m-p 0.1585 8.0000 0.1282
QuantileBeta(0.15, 0.00500, 2.38269) = 1.081000e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.39928) = 1.071770e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.46564) = 1.036361e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
Y 2106.514699 0 1.5278 2404
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.091654e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43060) = 1.054762e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43035) = 1.054898e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.43048) = 1.054830e-160 2000 rounds
| 3/23
49 h-m-p 1.6000 8.0000 0.0452
QuantileBeta(0.15, 0.00500, 2.45002) = 1.044483e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.50867) = 1.014614e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
+ 2106.514647 m 8.0000 2450
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.040116e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52835) = 1.004967e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52809) = 1.005094e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
| 3/23
50 h-m-p 0.2753 1.3765 1.1026
QuantileBeta(0.15, 0.00500, 2.61024) = 9.667036e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.85631) = 8.673593e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
+ 2106.514129 m 1.3765 2496
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.678801e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93847) = 8.385572e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93819) = 8.386522e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93833) = 8.386047e-161 2000 rounds
| 4/23
51 h-m-p 0.8611 6.1593 0.4762
QuantileBeta(0.15, 0.00500, 2.52822) = 1.005030e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
C 2106.513838 0 0.9634 2542
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.065166e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47967) = 1.029170e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47941) = 1.029301e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.47954) = 1.029236e-160 2000 rounds
| 4/23
52 h-m-p 1.6000 8.0000 0.0031
QuantileBeta(0.15, 0.00500, 2.48445) = 1.026743e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49917) = 1.019336e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.50408) = 1.016890e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
Y 2106.513817 0 4.2243 2588
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.058381e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49263) = 1.022615e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49237) = 1.022745e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.49250) = 1.022680e-160 2000 rounds
| 4/23
53 h-m-p 0.1078 8.0000 0.1203
QuantileBeta(0.15, 0.00500, 2.50546) = 1.016206e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.54434) = 9.972633e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.69985) = 9.280153e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.32192) = 7.259390e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
+ 2106.513661 m 8.0000 2635
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 7.179028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45469) = 6.936511e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45439) = 6.937218e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.45454) = 6.936865e-161 2000 rounds
| 4/23
54 h-m-p 1.1629 8.0000 0.8273
QuantileBeta(0.15, 0.00500, 4.41658) = 5.244468e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.30270) = 3.025663e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
+ 2106.513467 m 8.0000 2680
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.226410e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07304) = 2.151246e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07248) = 2.151372e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.07276) = 2.151309e-161 2000 rounds
| 4/23
55 h-m-p 1.6000 8.0000 0.6161
QuantileBeta(0.15, 0.00500, 11.05859) = 1.950651e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.01608) = 1.524125e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
Y 2106.513430 0 1.2645 2725
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 2.059021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85216) = 1.989509e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85158) = 1.989622e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.85187) = 1.989566e-161 2000 rounds
| 4/23
56 h-m-p 1.1665 8.0000 0.6679
QuantileBeta(0.15, 0.00500, 11.63098) = 1.850435e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.96830) = 1.529529e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
+ 2106.513401 m 8.0000 2770
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.358479e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19524) = 1.312623e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19449) = 1.312686e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.19486) = 1.312654e-161 2000 rounds
| 4/23
57 h-m-p 1.6000 8.0000 3.3302
QuantileBeta(0.15, 0.00500, 21.52326) = 9.800716e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 37.50846) = 4.485926e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
Y 2106.513375 0 3.7068 2815
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.605354e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.54014) = 7.348668e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53906) = 7.348951e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 28.53960) = 7.348810e-162 2000 rounds
| 4/23
58 h-m-p 1.6000 8.0000 3.0783
QuantileBeta(0.15, 0.00500, 33.46488) = 5.036102e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.24073) = 2.080916e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
C 2106.513364 0 2.5489 2860
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.784455e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38637) = 4.626172e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38511) = 4.626335e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 36.38574) = 4.626254e-162 2000 rounds
| 4/23
59 h-m-p 1.6000 8.0000 4.6314
QuantileBeta(0.15, 0.00500, 43.79595) = 3.834543e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
Y 2106.513355 0 4.5274 2906
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 1.808506e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35466) = 7.387331e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35296) = 7.387553e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 57.35381) = 7.387442e-163 2000 rounds
| 4/23
60 h-m-p 0.9709 4.8546 8.5787 +Y 2106.513349 0 2.6129 2952 | 4/23
61 h-m-p 0.3465 1.7324 11.1007 ++ 2106.513346 m 1.7324 2997 | 5/23
62 h-m-p 1.6000 8.0000 0.0000 C 2106.513346 0 0.6167 3042 | 5/23
63 h-m-p 1.3868 8.0000 0.0000 -Y 2106.513346 0 0.0463 3087
Out..
lnL = -2106.513346
3088 lfun, 37056 eigenQcodon, 611424 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2168.281628 S = -2130.888948 -28.737321
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 137 patterns 7:59
did 20 / 137 patterns 7:59
did 30 / 137 patterns 7:59
did 40 / 137 patterns 7:59
did 50 / 137 patterns 7:59
did 60 / 137 patterns 7:59
did 70 / 137 patterns 8:00
did 80 / 137 patterns 8:00
did 90 / 137 patterns 8:00
did 100 / 137 patterns 8:00
did 110 / 137 patterns 8:00
did 120 / 137 patterns 8:00
did 130 / 137 patterns 8:01
did 137 / 137 patterns 8:01
Time used: 8:01
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=357
D_melanogaster_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_sechellia_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_simulans_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_erecta_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_takahashii_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_biarmipes_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_suzukii_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_eugracilis_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_ficusphila_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_rhopaloa_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_elegans_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
**************************************************
D_melanogaster_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_sechellia_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_simulans_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_erecta_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_takahashii_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_biarmipes_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_suzukii_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_eugracilis_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_ficusphila_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_rhopaloa_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_elegans_acj6-PH DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
**************************************************
D_melanogaster_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_sechellia_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_simulans_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_erecta_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_takahashii_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_biarmipes_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_suzukii_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_eugracilis_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_ficusphila_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_rhopaloa_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
D_elegans_acj6-PH QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH
**************************************************
D_melanogaster_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_sechellia_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_simulans_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_erecta_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_takahashii_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_biarmipes_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_suzukii_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_eugracilis_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_ficusphila_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_rhopaloa_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
D_elegans_acj6-PH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF
**************************************************
D_melanogaster_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_sechellia_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_simulans_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_erecta_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_takahashii_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_biarmipes_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_suzukii_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_eugracilis_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_ficusphila_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_rhopaloa_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
D_elegans_acj6-PH KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL
**************************************************
D_melanogaster_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_sechellia_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_simulans_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_erecta_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_takahashii_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_biarmipes_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_suzukii_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_eugracilis_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_ficusphila_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_rhopaloa_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
D_elegans_acj6-PH KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF
**************************************************
D_melanogaster_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_sechellia_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_simulans_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_erecta_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_takahashii_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_biarmipes_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_suzukii_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_eugracilis_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_ficusphila_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_rhopaloa_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
D_elegans_acj6-PH AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH
**************************************************
D_melanogaster_acj6-PH GSAGFGY
D_sechellia_acj6-PH GSAGFGY
D_simulans_acj6-PH GSAGFGY
D_erecta_acj6-PH GSAGFGY
D_takahashii_acj6-PH GSAGFGY
D_biarmipes_acj6-PH GSAGFGY
D_suzukii_acj6-PH GSAGFGY
D_eugracilis_acj6-PH GSAGFGY
D_ficusphila_acj6-PH GSAGFGY
D_rhopaloa_acj6-PH GSAGFGY
D_elegans_acj6-PH GSAGFGY
*******
>D_melanogaster_acj6-PH ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTAACGCCCACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCATACGGGGGGACATCATGGACACTCGGC GGTACATCATCCTGTTATCACGGCGGCAGTGGCTGCCGCTGGCCTGCATC CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGATTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTT AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTC GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_sechellia_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAATATGATCGCCCTC AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTC GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_simulans_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTC AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_erecta_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTC GATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGC GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA TCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTG AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_takahashii_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC GATGACCACGCTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC GGTACATCATCCTGTTATCACGGCGGCGGTAGCTGCCGCTGGCCTGCATC CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAGAGCACGA TCTGTCGCTTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCCGAAAAGCGTTCTTTGGAAGCCTACTTT GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_biarmipes_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC GATGACCACGCTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCGGC GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC CCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA TCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGGCGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGCTCCCTGGAAGCCTACTTC GCCGTCCAGCCGAGGCCGTCCGGTGAGAAAATCGCTGCCATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_suzukii_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTC GATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCAGC GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC CCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGA TCTGTCGATTCGAGAGCCTGACCCTGTCGCACAACAACATGATCGCCCTG AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGGCGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_eugracilis_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTC AATGACCACGTTGGCGCCCATATCGGAGTCGCCTCTAACGCCAACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGCCACCATGGACACTCAGC GGTACATCATCCTGTTATCACAGCGGCAGTGGCAGCCGCTGGCCTGCATC CCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC AAGCAGCGGCGCATCAAGCTGGGCGTTACGCAGGCGGACGTGGGCAAAGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCACAGAGCACGA TCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGGCGAAAAA CAAGAGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC GCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCAC GGTTCAGCGGGATTTGGATAC >D_ficusphila_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTC GATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACC AACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC GGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATC CCGACACAGACACCGATCCCCGCGAGCTGGAGGCCTTCGCGGAGCGGTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC CCTGGCCAATCTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGA TCTGCAGGTTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGGCGCGACCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC GCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_rhopaloa_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTC GATGACCACGTTGGCGCCCATTTCGGAGTCCCCACTGACGCCCACACACC AGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC CCGACACCGACACCGATCCCCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGA TCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGACGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTC GCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC >D_elegans_acj6-PH ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTC GATGACCACGTTGGCGCCCATCTCGGAGTCCCCTCTGACGCCCACACACC AGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCACCAC CATCCGGGCACGCTAAGTGGCCACACGGGGGGACACCATGGACACTCAGC GGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATC CCGACACCGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTC AAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGC CCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCACTGTCGCAGAGCACGA TCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTG AAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAA CAAGCGACGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGA AAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTT GCCGTGCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAA GCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTC AAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCAC GGTTCGGCGGGATTTGGATAC
>D_melanogaster_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_sechellia_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_simulans_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_erecta_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_takahashii_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_biarmipes_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_suzukii_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_eugracilis_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_ficusphila_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_rhopaloa_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY >D_elegans_acj6-PH MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSMNHMMSHH HPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPRELEAFAERF KQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLSHNNMIAL KPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEKRSLEAYF AVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSVTPSMTGH GSAGFGY
#NEXUS
[ID: 4801351831]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_acj6-PH
D_sechellia_acj6-PH
D_simulans_acj6-PH
D_erecta_acj6-PH
D_takahashii_acj6-PH
D_biarmipes_acj6-PH
D_suzukii_acj6-PH
D_eugracilis_acj6-PH
D_ficusphila_acj6-PH
D_rhopaloa_acj6-PH
D_elegans_acj6-PH
;
end;
begin trees;
translate
1 D_melanogaster_acj6-PH,
2 D_sechellia_acj6-PH,
3 D_simulans_acj6-PH,
4 D_erecta_acj6-PH,
5 D_takahashii_acj6-PH,
6 D_biarmipes_acj6-PH,
7 D_suzukii_acj6-PH,
8 D_eugracilis_acj6-PH,
9 D_ficusphila_acj6-PH,
10 D_rhopaloa_acj6-PH,
11 D_elegans_acj6-PH
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01759791,2:0.003263538,(3:0.001495811,(4:0.004780089,(5:0.02540522,((6:0.0198678,7:0.006172915)0.799:0.005839858,(9:0.1002872,(10:0.008484053,11:0.01678842)0.992:0.01909993)0.592:0.01033803)0.743:0.01225818,8:0.07730305)0.998:0.03259909)0.994:0.007858299)0.775:0.003083523);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01759791,2:0.003263538,(3:0.001495811,(4:0.004780089,(5:0.02540522,((6:0.0198678,7:0.006172915):0.005839858,(9:0.1002872,(10:0.008484053,11:0.01678842):0.01909993):0.01033803):0.01225818,8:0.07730305):0.03259909):0.007858299):0.003083523);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2202.33 -2226.49
2 -2202.26 -2222.74
--------------------------------------
TOTAL -2202.30 -2225.82
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PH/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.398948 0.003586 0.291985 0.522766 0.394293 1187.85 1344.42 1.000
r(A<->C){all} 0.116702 0.001314 0.047389 0.185891 0.113409 539.30 694.28 1.000
r(A<->G){all} 0.240539 0.003111 0.140886 0.356073 0.235726 607.17 636.80 1.002
r(A<->T){all} 0.128960 0.001939 0.051691 0.215578 0.123400 858.59 864.40 1.000
r(C<->G){all} 0.061557 0.000391 0.025350 0.100529 0.059699 776.74 869.03 1.000
r(C<->T){all} 0.440501 0.004222 0.319848 0.571056 0.441155 552.44 611.49 1.001
r(G<->T){all} 0.011741 0.000119 0.000001 0.035259 0.008666 919.40 1037.66 1.001
pi(A){all} 0.238666 0.000159 0.213234 0.263546 0.238715 1112.06 1220.97 1.000
pi(C){all} 0.308803 0.000172 0.281245 0.333079 0.308930 1286.69 1343.28 1.000
pi(G){all} 0.272981 0.000175 0.246631 0.297647 0.272874 1129.15 1155.12 1.000
pi(T){all} 0.179549 0.000118 0.157869 0.199807 0.179360 1135.79 1182.40 1.000
alpha{1,2} 0.048430 0.000662 0.000106 0.087386 0.051533 1196.38 1264.40 1.000
alpha{3} 2.346881 0.620205 1.033658 3.967005 2.224011 1321.58 1411.29 1.000
pinvar{all} 0.753122 0.000680 0.702684 0.803493 0.754077 1335.67 1338.28 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/acj6-PH/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 357
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 3 3 4 3 | Ser TCT 2 2 1 1 2 1 | Tyr TAT 3 2 2 3 2 2 | Cys TGT 2 2 2 2 2 2
TTC 5 5 5 5 4 5 | TCC 7 7 8 8 6 7 | TAC 4 5 5 4 5 5 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 3 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 1 | TCG 10 10 10 10 10 11 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 0 0 0 | Pro CCT 5 5 5 5 3 5 | His CAT 11 9 9 9 9 9 | Arg CGT 5 5 5 5 4 3
CTC 3 4 4 3 3 3 | CCC 9 9 9 10 12 10 | CAC 15 17 17 17 17 17 | CGC 6 7 7 7 8 8
CTA 1 0 0 0 0 0 | CCA 5 5 5 5 5 3 | Gln CAA 9 9 9 8 9 9 | CGA 3 2 2 2 2 3
CTG 16 17 17 18 18 19 | CCG 7 7 7 6 6 8 | CAG 10 10 10 11 10 10 | CGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 2 2 3 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 4 5 4 4 4 4 | Ser AGT 8 8 8 8 8 8
ATC 11 12 12 12 11 12 | ACC 3 3 3 3 2 2 | AAC 5 4 5 5 5 5 | AGC 6 6 6 6 6 6
ATA 1 1 1 1 1 1 | ACA 5 5 5 5 4 4 | Lys AAA 9 9 9 9 9 9 | Arg AGA 1 1 1 1 1 1
Met ATG 19 19 19 19 19 19 | ACG 9 9 9 9 11 11 | AAG 11 11 11 11 11 11 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 9 9 9 9 7 4 | Gly GGT 5 5 5 5 6 6
GTC 7 7 7 7 7 7 | GCC 12 12 12 12 12 13 | GAC 6 6 6 6 8 11 | GGC 9 9 9 9 10 10
GTA 3 3 3 3 4 3 | GCA 3 2 2 2 2 2 | Glu GAA 4 4 4 4 4 4 | GGA 7 7 7 7 5 5
GTG 4 4 4 4 3 4 | GCG 18 19 19 19 19 18 | GAG 11 11 11 11 11 11 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 3 3 2 3 4 | Ser TCT 1 1 0 1 1 | Tyr TAT 2 2 1 2 2 | Cys TGT 2 3 1 2 2
TTC 5 5 6 5 4 | TCC 7 7 7 8 8 | TAC 5 5 6 5 5 | TGC 2 1 3 2 2
Leu TTA 2 2 2 2 1 | TCA 3 6 3 3 3 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 4 3 3 3 | TCG 10 7 11 9 9 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 | Pro CCT 4 5 4 3 5 | His CAT 9 10 5 9 9 | Arg CGT 4 5 4 5 5
CTC 3 3 2 3 3 | CCC 10 9 12 11 10 | CAC 17 16 21 17 17 | CGC 7 6 7 6 6
CTA 0 1 1 0 1 | CCA 5 8 3 6 5 | Gln CAA 9 8 6 9 8 | CGA 3 1 1 2 3
CTG 18 15 17 17 17 | CCG 7 4 7 6 6 | CAG 10 11 13 10 11 | CGG 2 2 3 2 2
----------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 3 3 2 | Thr ACT 2 2 2 2 2 | Asn AAT 4 4 4 4 4 | Ser AGT 8 8 8 8 8
ATC 11 10 11 11 12 | ACC 3 2 2 3 3 | AAC 5 5 5 5 5 | AGC 6 6 6 6 6
ATA 1 3 1 1 1 | ACA 4 5 4 3 3 | Lys AAA 9 9 8 8 8 | Arg AGA 1 2 1 2 1
Met ATG 19 19 19 19 19 | ACG 10 10 11 11 11 | AAG 11 11 12 12 12 | AGG 2 3 3 2 2
----------------------------------------------------------------------------------------------------------------------
Val GTT 2 3 2 2 2 | Ala GCT 2 2 3 2 2 | Asp GAT 7 10 6 6 6 | Gly GGT 6 4 5 5 5
GTC 7 5 7 7 6 | GCC 13 11 13 13 13 | GAC 8 5 9 9 9 | GGC 9 12 10 11 11
GTA 3 4 3 3 3 | GCA 2 4 2 2 3 | Glu GAA 4 4 4 4 4 | GGA 5 5 6 5 5
GTG 4 4 4 4 5 | GCG 18 18 17 18 17 | GAG 11 11 11 11 11 | GGG 3 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_acj6-PH
position 1: T:0.12885 C:0.30252 A:0.27731 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.18768 C:0.30812 A:0.15406 G:0.35014
Average T:0.18301 C:0.29785 A:0.24743 G:0.27171
#2: D_sechellia_acj6-PH
position 1: T:0.12885 C:0.30252 A:0.27731 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.17647 C:0.32213 A:0.14566 G:0.35574
Average T:0.17927 C:0.30252 A:0.24463 G:0.27358
#3: D_simulans_acj6-PH
position 1: T:0.12885 C:0.30252 A:0.27731 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.17087 C:0.32773 A:0.14566 G:0.35574
Average T:0.17740 C:0.30439 A:0.24463 G:0.27358
#4: D_erecta_acj6-PH
position 1: T:0.12885 C:0.30252 A:0.27731 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.17367 C:0.32493 A:0.14286 G:0.35854
Average T:0.17834 C:0.30345 A:0.24370 G:0.27451
#5: D_takahashii_acj6-PH
position 1: T:0.12885 C:0.30252 A:0.27731 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.16807 C:0.33053 A:0.14286 G:0.35854
Average T:0.17647 C:0.30532 A:0.24370 G:0.27451
#6: D_biarmipes_acj6-PH
position 1: T:0.12605 C:0.30532 A:0.27731 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.15406 C:0.34454 A:0.13445 G:0.36695
Average T:0.17087 C:0.31092 A:0.24090 G:0.27731
#7: D_suzukii_acj6-PH
position 1: T:0.12885 C:0.30252 A:0.27731 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.16527 C:0.33053 A:0.14286 G:0.36134
Average T:0.17554 C:0.30532 A:0.24370 G:0.27544
#8: D_eugracilis_acj6-PH
position 1: T:0.13445 C:0.29132 A:0.28291 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.17927 C:0.30252 A:0.17367 G:0.34454
Average T:0.18207 C:0.29225 A:0.25584 G:0.26984
#9: D_ficusphila_acj6-PH
position 1: T:0.13165 C:0.29692 A:0.28011 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.14006 C:0.35574 A:0.12605 G:0.37815
Average T:0.16807 C:0.31186 A:0.23903 G:0.28105
#10: D_rhopaloa_acj6-PH
position 1: T:0.13165 C:0.29692 A:0.28011 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.15966 C:0.34174 A:0.14006 G:0.35854
Average T:0.17460 C:0.30719 A:0.24370 G:0.27451
#11: D_elegans_acj6-PH
position 1: T:0.12885 C:0.30252 A:0.27731 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.16527 C:0.33613 A:0.13725 G:0.36134
Average T:0.17554 C:0.30719 A:0.24183 G:0.27544
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 34 | Ser S TCT 13 | Tyr Y TAT 23 | Cys C TGT 22
TTC 54 | TCC 80 | TAC 54 | TGC 22
Leu L TTA 21 | TCA 31 | *** * TAA 0 | *** * TGA 0
TTG 26 | TCG 107 | TAG 0 | Trp W TGG 22
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 49 | His H CAT 98 | Arg R CGT 50
CTC 34 | CCC 111 | CAC 188 | CGC 75
CTA 4 | CCA 55 | Gln Q CAA 93 | CGA 24
CTG 189 | CCG 71 | CAG 116 | CGG 23
------------------------------------------------------------------------------
Ile I ATT 27 | Thr T ACT 22 | Asn N AAT 45 | Ser S AGT 88
ATC 125 | ACC 29 | AAC 54 | AGC 66
ATA 13 | ACA 47 | Lys K AAA 96 | Arg R AGA 13
Met M ATG 209 | ACG 111 | AAG 124 | AGG 24
------------------------------------------------------------------------------
Val V GTT 23 | Ala A GCT 23 | Asp D GAT 82 | Gly G GGT 57
GTC 74 | GCC 136 | GAC 83 | GGC 109
GTA 35 | GCA 26 | Glu E GAA 44 | GGA 64
GTG 44 | GCG 200 | GAG 121 | GGG 23
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.12962 C:0.30074 A:0.27833 G:0.29132
position 2: T:0.23249 C:0.28291 A:0.31092 G:0.17367
position 3: T:0.16730 C:0.32951 A:0.14413 G:0.35905
Average T:0.17647 C:0.30439 A:0.24446 G:0.27468
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_acj6-PH
D_sechellia_acj6-PH -1.0000 (0.0000 0.0365)
D_simulans_acj6-PH -1.0000 (0.0000 0.0365)-1.0000 (0.0000 0.0080)
D_erecta_acj6-PH -1.0000 (0.0000 0.0532)-1.0000 (0.0000 0.0282)-1.0000 (0.0000 0.0200)
D_takahashii_acj6-PH -1.0000 (0.0000 0.1433)-1.0000 (0.0000 0.1152)-1.0000 (0.0000 0.1152)-1.0000 (0.0000 0.1105)
D_biarmipes_acj6-PH -1.0000 (0.0000 0.1477)-1.0000 (0.0000 0.1196)-1.0000 (0.0000 0.1104)-1.0000 (0.0000 0.1057)-1.0000 (0.0000 0.0834)
D_suzukii_acj6-PH -1.0000 (0.0000 0.1336)-1.0000 (0.0000 0.1059)-1.0000 (0.0000 0.0969)-1.0000 (0.0000 0.0923)-1.0000 (0.0000 0.0791)-1.0000 (0.0000 0.0447)
D_eugracilis_acj6-PH -1.0000 (0.0000 0.1834)-1.0000 (0.0000 0.1886)-1.0000 (0.0000 0.1785)-1.0000 (0.0000 0.1733) 0.0075 (0.0012 0.1634)-1.0000 (0.0000 0.1780)-1.0000 (0.0000 0.1486)
D_ficusphila_acj6-PH -1.0000 (0.0000 0.2137)-1.0000 (0.0000 0.1880)-1.0000 (0.0000 0.1779)-1.0000 (0.0000 0.1728) 0.0069 (0.0012 0.1778)-1.0000 (0.0000 0.1674)-1.0000 (0.0000 0.1529)-1.0000 (0.0000 0.2416)
D_rhopaloa_acj6-PH -1.0000 (0.0000 0.1679)-1.0000 (0.0000 0.1437)-1.0000 (0.0000 0.1342)-1.0000 (0.0000 0.1388) 0.0110 (0.0012 0.1107)-1.0000 (0.0000 0.0924)-1.0000 (0.0000 0.0705)-1.0000 (0.0000 0.1637)-1.0000 (0.0000 0.1583)
D_elegans_acj6-PH -1.0000 (0.0000 0.1774)-1.0000 (0.0000 0.1529)-1.0000 (0.0000 0.1433)-1.0000 (0.0000 0.1384)-1.0000 (0.0000 0.1243)-1.0000 (0.0000 0.0922)-1.0000 (0.0000 0.0790)-1.0000 (0.0000 0.1682)-1.0000 (0.0000 0.1727)-1.0000 (0.0000 0.0448)
Model 0: one-ratio
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
lnL(ntime: 18 np: 20): -2106.559576 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.024036 0.002902 0.003037 0.000004 0.009220 0.005780 0.042919 0.040042 0.014261 0.008728 0.027586 0.006037 0.009416 0.101356 0.016211 0.013357 0.021474 0.084720 2.090272 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43108
(1: 0.024036, 2: 0.002902, (3: 0.000004, (4: 0.005780, (5: 0.040042, ((6: 0.027586, 7: 0.006037): 0.008728, (9: 0.101356, (10: 0.013357, 11: 0.021474): 0.016211): 0.009416): 0.014261, 8: 0.084720): 0.042919): 0.009220): 0.003037);
(D_melanogaster_acj6-PH: 0.024036, D_sechellia_acj6-PH: 0.002902, (D_simulans_acj6-PH: 0.000004, (D_erecta_acj6-PH: 0.005780, (D_takahashii_acj6-PH: 0.040042, ((D_biarmipes_acj6-PH: 0.027586, D_suzukii_acj6-PH: 0.006037): 0.008728, (D_ficusphila_acj6-PH: 0.101356, (D_rhopaloa_acj6-PH: 0.013357, D_elegans_acj6-PH: 0.021474): 0.016211): 0.009416): 0.014261, D_eugracilis_acj6-PH: 0.084720): 0.042919): 0.009220): 0.003037);
Detailed output identifying parameters
kappa (ts/tv) = 2.09027
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 811.9 259.1 0.0001 0.0000 0.0331 0.0 8.6
12..2 0.003 811.9 259.1 0.0001 0.0000 0.0040 0.0 1.0
12..13 0.003 811.9 259.1 0.0001 0.0000 0.0042 0.0 1.1
13..3 0.000 811.9 259.1 0.0001 0.0000 0.0000 0.0 0.0
13..14 0.009 811.9 259.1 0.0001 0.0000 0.0127 0.0 3.3
14..4 0.006 811.9 259.1 0.0001 0.0000 0.0080 0.0 2.1
14..15 0.043 811.9 259.1 0.0001 0.0000 0.0591 0.0 15.3
15..5 0.040 811.9 259.1 0.0001 0.0000 0.0552 0.0 14.3
15..16 0.014 811.9 259.1 0.0001 0.0000 0.0196 0.0 5.1
16..17 0.009 811.9 259.1 0.0001 0.0000 0.0120 0.0 3.1
17..6 0.028 811.9 259.1 0.0001 0.0000 0.0380 0.0 9.8
17..7 0.006 811.9 259.1 0.0001 0.0000 0.0083 0.0 2.2
16..18 0.009 811.9 259.1 0.0001 0.0000 0.0130 0.0 3.4
18..9 0.101 811.9 259.1 0.0001 0.0000 0.1396 0.0 36.2
18..19 0.016 811.9 259.1 0.0001 0.0000 0.0223 0.0 5.8
19..10 0.013 811.9 259.1 0.0001 0.0000 0.0184 0.0 4.8
19..11 0.021 811.9 259.1 0.0001 0.0000 0.0296 0.0 7.7
15..8 0.085 811.9 259.1 0.0001 0.0000 0.1167 0.0 30.2
tree length for dN: 0.0001
tree length for dS: 0.5938
Time used: 0:11
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
lnL(ntime: 18 np: 21): -2106.513824 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.024038 0.002902 0.003037 0.000004 0.009220 0.005780 0.042922 0.040046 0.014262 0.008729 0.027588 0.006037 0.009417 0.101368 0.016212 0.013358 0.021475 0.084727 2.089657 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43112
(1: 0.024038, 2: 0.002902, (3: 0.000004, (4: 0.005780, (5: 0.040046, ((6: 0.027588, 7: 0.006037): 0.008729, (9: 0.101368, (10: 0.013358, 11: 0.021475): 0.016212): 0.009417): 0.014262, 8: 0.084727): 0.042922): 0.009220): 0.003037);
(D_melanogaster_acj6-PH: 0.024038, D_sechellia_acj6-PH: 0.002902, (D_simulans_acj6-PH: 0.000004, (D_erecta_acj6-PH: 0.005780, (D_takahashii_acj6-PH: 0.040046, ((D_biarmipes_acj6-PH: 0.027588, D_suzukii_acj6-PH: 0.006037): 0.008729, (D_ficusphila_acj6-PH: 0.101368, (D_rhopaloa_acj6-PH: 0.013358, D_elegans_acj6-PH: 0.021475): 0.016212): 0.009417): 0.014262, D_eugracilis_acj6-PH: 0.084727): 0.042922): 0.009220): 0.003037);
Detailed output identifying parameters
kappa (ts/tv) = 2.08966
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 811.9 259.1 0.0000 0.0000 0.0331 0.0 8.6
12..2 0.003 811.9 259.1 0.0000 0.0000 0.0040 0.0 1.0
12..13 0.003 811.9 259.1 0.0000 0.0000 0.0042 0.0 1.1
13..3 0.000 811.9 259.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 811.9 259.1 0.0000 0.0000 0.0127 0.0 3.3
14..4 0.006 811.9 259.1 0.0000 0.0000 0.0080 0.0 2.1
14..15 0.043 811.9 259.1 0.0000 0.0000 0.0591 0.0 15.3
15..5 0.040 811.9 259.1 0.0000 0.0000 0.0552 0.0 14.3
15..16 0.014 811.9 259.1 0.0000 0.0000 0.0197 0.0 5.1
16..17 0.009 811.9 259.1 0.0000 0.0000 0.0120 0.0 3.1
17..6 0.028 811.9 259.1 0.0000 0.0000 0.0380 0.0 9.8
17..7 0.006 811.9 259.1 0.0000 0.0000 0.0083 0.0 2.2
16..18 0.009 811.9 259.1 0.0000 0.0000 0.0130 0.0 3.4
18..9 0.101 811.9 259.1 0.0000 0.0000 0.1397 0.0 36.2
18..19 0.016 811.9 259.1 0.0000 0.0000 0.0223 0.0 5.8
19..10 0.013 811.9 259.1 0.0000 0.0000 0.0184 0.0 4.8
19..11 0.021 811.9 259.1 0.0000 0.0000 0.0296 0.0 7.7
15..8 0.085 811.9 259.1 0.0000 0.0000 0.1167 0.0 30.2
Time used: 0:31
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
lnL(ntime: 18 np: 23): -2106.511272 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.024037 0.002902 0.003037 0.000004 0.009220 0.005780 0.042922 0.040044 0.014261 0.008728 0.027588 0.006037 0.009416 0.101366 0.016212 0.013358 0.021475 0.084725 2.089641 1.000000 0.000000 0.000001 48.332503
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43111
(1: 0.024037, 2: 0.002902, (3: 0.000004, (4: 0.005780, (5: 0.040044, ((6: 0.027588, 7: 0.006037): 0.008728, (9: 0.101366, (10: 0.013358, 11: 0.021475): 0.016212): 0.009416): 0.014261, 8: 0.084725): 0.042922): 0.009220): 0.003037);
(D_melanogaster_acj6-PH: 0.024037, D_sechellia_acj6-PH: 0.002902, (D_simulans_acj6-PH: 0.000004, (D_erecta_acj6-PH: 0.005780, (D_takahashii_acj6-PH: 0.040044, ((D_biarmipes_acj6-PH: 0.027588, D_suzukii_acj6-PH: 0.006037): 0.008728, (D_ficusphila_acj6-PH: 0.101366, (D_rhopaloa_acj6-PH: 0.013358, D_elegans_acj6-PH: 0.021475): 0.016212): 0.009416): 0.014261, D_eugracilis_acj6-PH: 0.084725): 0.042922): 0.009220): 0.003037);
Detailed output identifying parameters
kappa (ts/tv) = 2.08964
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 48.33250
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 811.9 259.1 0.0000 0.0000 0.0331 0.0 8.6
12..2 0.003 811.9 259.1 0.0000 0.0000 0.0040 0.0 1.0
12..13 0.003 811.9 259.1 0.0000 0.0000 0.0042 0.0 1.1
13..3 0.000 811.9 259.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 811.9 259.1 0.0000 0.0000 0.0127 0.0 3.3
14..4 0.006 811.9 259.1 0.0000 0.0000 0.0080 0.0 2.1
14..15 0.043 811.9 259.1 0.0000 0.0000 0.0591 0.0 15.3
15..5 0.040 811.9 259.1 0.0000 0.0000 0.0552 0.0 14.3
15..16 0.014 811.9 259.1 0.0000 0.0000 0.0197 0.0 5.1
16..17 0.009 811.9 259.1 0.0000 0.0000 0.0120 0.0 3.1
17..6 0.028 811.9 259.1 0.0000 0.0000 0.0380 0.0 9.8
17..7 0.006 811.9 259.1 0.0000 0.0000 0.0083 0.0 2.2
16..18 0.009 811.9 259.1 0.0000 0.0000 0.0130 0.0 3.4
18..9 0.101 811.9 259.1 0.0000 0.0000 0.1397 0.0 36.2
18..19 0.016 811.9 259.1 0.0000 0.0000 0.0223 0.0 5.8
19..10 0.013 811.9 259.1 0.0000 0.0000 0.0184 0.0 4.8
19..11 0.021 811.9 259.1 0.0000 0.0000 0.0296 0.0 7.7
15..8 0.085 811.9 259.1 0.0000 0.0000 0.1167 0.0 30.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_acj6-PH)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.443 0.114 0.072 0.060 0.055 0.053 0.052 0.051 0.051 0.051
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:30
Model 3: discrete (3 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
lnL(ntime: 18 np: 24): -2106.511272 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.024037 0.002902 0.003037 0.000004 0.009220 0.005780 0.042921 0.040044 0.014261 0.008728 0.027588 0.006037 0.009416 0.101366 0.016212 0.013358 0.021475 0.084725 2.089643 0.555532 0.232476 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43111
(1: 0.024037, 2: 0.002902, (3: 0.000004, (4: 0.005780, (5: 0.040044, ((6: 0.027588, 7: 0.006037): 0.008728, (9: 0.101366, (10: 0.013358, 11: 0.021475): 0.016212): 0.009416): 0.014261, 8: 0.084725): 0.042921): 0.009220): 0.003037);
(D_melanogaster_acj6-PH: 0.024037, D_sechellia_acj6-PH: 0.002902, (D_simulans_acj6-PH: 0.000004, (D_erecta_acj6-PH: 0.005780, (D_takahashii_acj6-PH: 0.040044, ((D_biarmipes_acj6-PH: 0.027588, D_suzukii_acj6-PH: 0.006037): 0.008728, (D_ficusphila_acj6-PH: 0.101366, (D_rhopaloa_acj6-PH: 0.013358, D_elegans_acj6-PH: 0.021475): 0.016212): 0.009416): 0.014261, D_eugracilis_acj6-PH: 0.084725): 0.042921): 0.009220): 0.003037);
Detailed output identifying parameters
kappa (ts/tv) = 2.08964
dN/dS (w) for site classes (K=3)
p: 0.55553 0.23248 0.21199
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 811.9 259.1 0.0000 0.0000 0.0331 0.0 8.6
12..2 0.003 811.9 259.1 0.0000 0.0000 0.0040 0.0 1.0
12..13 0.003 811.9 259.1 0.0000 0.0000 0.0042 0.0 1.1
13..3 0.000 811.9 259.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 811.9 259.1 0.0000 0.0000 0.0127 0.0 3.3
14..4 0.006 811.9 259.1 0.0000 0.0000 0.0080 0.0 2.1
14..15 0.043 811.9 259.1 0.0000 0.0000 0.0591 0.0 15.3
15..5 0.040 811.9 259.1 0.0000 0.0000 0.0552 0.0 14.3
15..16 0.014 811.9 259.1 0.0000 0.0000 0.0197 0.0 5.1
16..17 0.009 811.9 259.1 0.0000 0.0000 0.0120 0.0 3.1
17..6 0.028 811.9 259.1 0.0000 0.0000 0.0380 0.0 9.8
17..7 0.006 811.9 259.1 0.0000 0.0000 0.0083 0.0 2.2
16..18 0.009 811.9 259.1 0.0000 0.0000 0.0130 0.0 3.4
18..9 0.101 811.9 259.1 0.0000 0.0000 0.1397 0.0 36.2
18..19 0.016 811.9 259.1 0.0000 0.0000 0.0223 0.0 5.8
19..10 0.013 811.9 259.1 0.0000 0.0000 0.0184 0.0 4.8
19..11 0.021 811.9 259.1 0.0000 0.0000 0.0296 0.0 7.7
15..8 0.085 811.9 259.1 0.0000 0.0000 0.1167 0.0 30.2
Naive Empirical Bayes (NEB) analysis
Time used: 1:58
Model 7: beta (10 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
lnL(ntime: 18 np: 21): -2106.510882 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.024037 0.002902 0.003037 0.000004 0.009220 0.005780 0.042922 0.040044 0.014261 0.008729 0.027588 0.006037 0.009416 0.101365 0.016212 0.013358 0.021475 0.084726 2.089650 0.005000 10.298779
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43111
(1: 0.024037, 2: 0.002902, (3: 0.000004, (4: 0.005780, (5: 0.040044, ((6: 0.027588, 7: 0.006037): 0.008729, (9: 0.101365, (10: 0.013358, 11: 0.021475): 0.016212): 0.009416): 0.014261, 8: 0.084726): 0.042922): 0.009220): 0.003037);
(D_melanogaster_acj6-PH: 0.024037, D_sechellia_acj6-PH: 0.002902, (D_simulans_acj6-PH: 0.000004, (D_erecta_acj6-PH: 0.005780, (D_takahashii_acj6-PH: 0.040044, ((D_biarmipes_acj6-PH: 0.027588, D_suzukii_acj6-PH: 0.006037): 0.008729, (D_ficusphila_acj6-PH: 0.101365, (D_rhopaloa_acj6-PH: 0.013358, D_elegans_acj6-PH: 0.021475): 0.016212): 0.009416): 0.014261, D_eugracilis_acj6-PH: 0.084726): 0.042922): 0.009220): 0.003037);
Detailed output identifying parameters
kappa (ts/tv) = 2.08965
Parameters in M7 (beta):
p = 0.00500 q = 10.29878
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 811.9 259.1 0.0000 0.0000 0.0331 0.0 8.6
12..2 0.003 811.9 259.1 0.0000 0.0000 0.0040 0.0 1.0
12..13 0.003 811.9 259.1 0.0000 0.0000 0.0042 0.0 1.1
13..3 0.000 811.9 259.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 811.9 259.1 0.0000 0.0000 0.0127 0.0 3.3
14..4 0.006 811.9 259.1 0.0000 0.0000 0.0080 0.0 2.1
14..15 0.043 811.9 259.1 0.0000 0.0000 0.0591 0.0 15.3
15..5 0.040 811.9 259.1 0.0000 0.0000 0.0552 0.0 14.3
15..16 0.014 811.9 259.1 0.0000 0.0000 0.0197 0.0 5.1
16..17 0.009 811.9 259.1 0.0000 0.0000 0.0120 0.0 3.1
17..6 0.028 811.9 259.1 0.0000 0.0000 0.0380 0.0 9.8
17..7 0.006 811.9 259.1 0.0000 0.0000 0.0083 0.0 2.2
16..18 0.009 811.9 259.1 0.0000 0.0000 0.0130 0.0 3.4
18..9 0.101 811.9 259.1 0.0000 0.0000 0.1397 0.0 36.2
18..19 0.016 811.9 259.1 0.0000 0.0000 0.0223 0.0 5.8
19..10 0.013 811.9 259.1 0.0000 0.0000 0.0184 0.0 4.8
19..11 0.021 811.9 259.1 0.0000 0.0000 0.0296 0.0 7.7
15..8 0.085 811.9 259.1 0.0000 0.0000 0.1167 0.0 30.2
Time used: 4:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 136
lnL(ntime: 18 np: 23): -2106.513346 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.024038 0.002902 0.003037 0.000004 0.009220 0.005780 0.042923 0.040045 0.014261 0.008729 0.027588 0.006037 0.009417 0.101368 0.016212 0.013358 0.021475 0.084727 2.089651 0.999990 0.005000 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43112
(1: 0.024038, 2: 0.002902, (3: 0.000004, (4: 0.005780, (5: 0.040045, ((6: 0.027588, 7: 0.006037): 0.008729, (9: 0.101368, (10: 0.013358, 11: 0.021475): 0.016212): 0.009417): 0.014261, 8: 0.084727): 0.042923): 0.009220): 0.003037);
(D_melanogaster_acj6-PH: 0.024038, D_sechellia_acj6-PH: 0.002902, (D_simulans_acj6-PH: 0.000004, (D_erecta_acj6-PH: 0.005780, (D_takahashii_acj6-PH: 0.040045, ((D_biarmipes_acj6-PH: 0.027588, D_suzukii_acj6-PH: 0.006037): 0.008729, (D_ficusphila_acj6-PH: 0.101368, (D_rhopaloa_acj6-PH: 0.013358, D_elegans_acj6-PH: 0.021475): 0.016212): 0.009417): 0.014261, D_eugracilis_acj6-PH: 0.084727): 0.042923): 0.009220): 0.003037);
Detailed output identifying parameters
kappa (ts/tv) = 2.08965
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 99.00000
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 811.9 259.1 0.0000 0.0000 0.0331 0.0 8.6
12..2 0.003 811.9 259.1 0.0000 0.0000 0.0040 0.0 1.0
12..13 0.003 811.9 259.1 0.0000 0.0000 0.0042 0.0 1.1
13..3 0.000 811.9 259.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 811.9 259.1 0.0000 0.0000 0.0127 0.0 3.3
14..4 0.006 811.9 259.1 0.0000 0.0000 0.0080 0.0 2.1
14..15 0.043 811.9 259.1 0.0000 0.0000 0.0591 0.0 15.3
15..5 0.040 811.9 259.1 0.0000 0.0000 0.0552 0.0 14.3
15..16 0.014 811.9 259.1 0.0000 0.0000 0.0197 0.0 5.1
16..17 0.009 811.9 259.1 0.0000 0.0000 0.0120 0.0 3.1
17..6 0.028 811.9 259.1 0.0000 0.0000 0.0380 0.0 9.8
17..7 0.006 811.9 259.1 0.0000 0.0000 0.0083 0.0 2.2
16..18 0.009 811.9 259.1 0.0000 0.0000 0.0130 0.0 3.4
18..9 0.101 811.9 259.1 0.0000 0.0000 0.1397 0.0 36.2
18..19 0.016 811.9 259.1 0.0000 0.0000 0.0223 0.0 5.8
19..10 0.013 811.9 259.1 0.0000 0.0000 0.0184 0.0 4.8
19..11 0.021 811.9 259.1 0.0000 0.0000 0.0296 0.0 7.7
15..8 0.085 811.9 259.1 0.0000 0.0000 0.1167 0.0 30.2
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_acj6-PH)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.017 0.148 0.833
ws: 0.690 0.085 0.042 0.031 0.028 0.026 0.025 0.025 0.024 0.024
Time used: 8:01
Model 1: NearlyNeutral -2106.513824 Model 2: PositiveSelection -2106.511272 Model 0: one-ratio -2106.559576 Model 3: discrete -2106.511272 Model 7: beta -2106.510882 Model 8: beta&w>1 -2106.513346 Model 0 vs 1 0.09150399999998626 Model 2 vs 1 0.005103999999846565 Model 8 vs 7 0.004928000000290922
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
