--- EXPERIMENT NOTES --- EXPERIMENT PROPERTIES #Tue Nov 22 08:16:58 WET 2016 codeml.models=0 1 2 3 7 8 mrbayes.mpich= mrbayes.ngen=1000000 tcoffee.alignMethod=CLUSTALW2 tcoffee.params= tcoffee.maxSeqs=0 codeml.bin=codeml mrbayes.tburnin=2500 codeml.dir= input.sequences= mrbayes.pburnin=2500 mrbayes.bin=mb_adops tcoffee.bin=t_coffee_ADOPS mrbayes.dir=/usr/bin/ tcoffee.dir= tcoffee.minScore=3 input.fasta=/opt/ADOPS/3/acj6-PG/input.fasta input.names= mrbayes.params= codeml.params= --- PSRF SUMMARY Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2466.01 -2484.91 2 -2465.92 -2491.75 -------------------------------------- TOTAL -2465.97 -2491.06 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.405539 0.004198 0.287953 0.537082 0.399629 1151.96 1285.41 1.000 r(A<->C){all} 0.135157 0.001324 0.065472 0.205019 0.132245 877.62 912.21 1.003 r(A<->G){all} 0.206237 0.002191 0.117848 0.294669 0.203357 583.12 664.68 1.000 r(A<->T){all} 0.133072 0.001700 0.058529 0.215591 0.130242 669.94 793.30 1.003 r(C<->G){all} 0.055255 0.000306 0.023688 0.089028 0.053444 1026.52 1064.14 1.001 r(C<->T){all} 0.460926 0.003745 0.334927 0.575895 0.460106 605.01 629.37 1.000 r(G<->T){all} 0.009354 0.000077 0.000002 0.027146 0.006739 1150.86 1162.94 1.001 pi(A){all} 0.238435 0.000155 0.214425 0.262464 0.238015 1259.68 1344.98 1.001 pi(C){all} 0.304132 0.000167 0.278019 0.327796 0.303839 1147.97 1263.61 1.000 pi(G){all} 0.266757 0.000166 0.242084 0.292463 0.266671 965.01 1073.51 1.001 pi(T){all} 0.190677 0.000114 0.171532 0.212362 0.190658 1110.73 1157.09 1.000 alpha{1,2} 0.114328 0.000420 0.076541 0.151545 0.112923 1317.52 1381.32 1.000 alpha{3} 2.162042 0.600672 0.844509 3.652757 2.026815 1261.18 1302.66 1.001 pinvar{all} 0.743327 0.000778 0.683516 0.790727 0.744759 1393.53 1412.02 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple --- CODEML SUMMARY Model 1: NearlyNeutral -2366.016141 Model 2: PositiveSelection -2364.894727 Model 0: one-ratio -2386.440429 Model 3: discrete -2364.894727 Model 7: beta -2371.804541 Model 8: beta&w>1 -2364.902852 Model 0 vs 1 40.84857600000032 Model 2 vs 1 2.2428280000003724 Model 8 vs 7 13.803377999999611 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 0.999** 2.319 47 S 0.996** 2.313 48 C 0.994** 2.309 49 D 0.999** 2.318 51 L 1.000** 2.322 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 0.856 1.899 +- 1.059 47 S 0.740 1.670 +- 1.072 48 C 0.680 1.534 +- 1.039 49 D 0.811 1.786 +- 1.019 51 L 0.868 1.894 +- 0.992
>C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIYTHHLPS FQSRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQAQ HVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTTL APISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHP VITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANL KLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRD PDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLK KNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGYo >C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=388 C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIYT-HHLP C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD *******************************************: C1 SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C2 SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C3 SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C4 SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C5 SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C6 SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C7 SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C8 SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C9 SFQSRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C10 SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA C11 SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA *::*********************************************** C1 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C2 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C3 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C4 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C5 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C6 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C7 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C8 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C9 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C10 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT C11 QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT ************************************************** C1 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C2 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C3 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C4 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C5 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C6 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C7 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C8 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C9 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C10 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH C11 LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH ************************************************** C1 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C2 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C3 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C4 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C5 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C6 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C7 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C8 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C9 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C10 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN C11 PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN ************************************************** C1 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C2 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C3 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C4 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C5 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C6 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C7 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C8 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C9 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C10 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR C11 LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR ************************************************** C1 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C2 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C3 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C4 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C5 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C6 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C7 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C8 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C9 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C10 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL C11 DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL ************************************************** C1 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C2 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C3 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C4 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C5 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C6 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C7 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C8 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C9 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGYo C10 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- C11 KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- ************************************* PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) -full_log S [0] -genepred_score S [0] nsd -run_name S [0] -mem_mode S [0] mem -extend D [1] 1 -extend_mode S [0] very_fast_triplet -max_n_pair D [0] 10 -seq_name_for_quadruplet S [0] all -compact S [0] default -clean S [0] no -do_self FL [0] 0 -do_normalise D [0] 1000 -template_file S [0] -setenv S [0] 0 -template_mode S [0] -flip D [0] 0 -remove_template_file D [0] 0 -profile_template_file S [0] -in S [0] -seq S [0] -aln S [0] -method_limits S [0] -method S [0] -lib S [0] -profile S [0] -profile1 S [0] -profile2 S [0] -pdb S [0] -relax_lib D [0] 1 -filter_lib D [0] 0 -shrink_lib D [0] 0 -out_lib W_F [0] no -out_lib_mode S [0] primary -lib_only D [0] 0 -outseqweight W_F [0] no -dpa FL [0] 0 -seq_source S [0] ANY -cosmetic_penalty D [0] 0 -gapopen D [0] 0 -gapext D [0] 0 -fgapopen D [0] 0 -fgapext D [0] 0 -nomatch D [0] 0 -newtree W_F [0] default -tree W_F [0] NO -usetree R_F [0] -tree_mode S [0] nj -distance_matrix_mode S [0] ktup -distance_matrix_sim_mode S [0] idmat_sim1 -quicktree FL [0] 0 -outfile W_F [0] default -maximise FL [1] 1 -output S [1] score_ascii html score_ascii -len D [0] 0 -infile R_F [1] /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -matrix S [0] default -tg_mode D [0] 1 -profile_mode S [0] cw_profile_profile -profile_comparison S [0] profile -dp_mode S [0] linked_pair_wise -ktuple D [0] 1 -ndiag D [0] 0 -diag_threshold D [0] 0 -diag_mode D [0] 0 -sim_matrix S [0] vasiliky -transform S [0] -extend_seq FL [0] 0 -outorder S [0] input -inorder S [0] aligned -seqnos S [0] off -case S [0] keep -cpu D [0] 0 -maxnseq D [0] 1000 -maxlen D [0] -1 -sample_dp D [0] 0 -weight S [0] default -seq_weight S [0] no -align FL [1] 1 -mocca FL [0] 0 -domain FL [0] 0 -start D [0] 0 -len D [0] 0 -scale D [0] 0 -mocca_interactive FL [0] 0 -method_evaluate_mode S [0] default -evaluate_mode S [1] t_coffee_fast -get_type FL [0] 0 -clean_aln D [0] 0 -clean_threshold D [1] 1 -clean_iteration D [1] 1 -clean_evaluate_mode S [0] t_coffee_fast -extend_matrix FL [0] 0 -prot_min_sim D [40] 40 -prot_max_sim D [90] 90 -prot_min_cov D [40] 40 -pdb_type S [0] d -pdb_min_sim D [35] 35 -pdb_max_sim D [100] 100 -pdb_min_cov D [50] 50 -pdb_blast_server W_F [0] EBI -blast W_F [0] -blast_server W_F [0] EBI -pdb_db W_F [0] pdb -protein_db W_F [0] uniprot -method_log W_F [0] no -struc_to_use S [0] -cache W_F [0] use -align_pdb_param_file W_F [0] no -align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble -external_aligner S [0] NO -msa_mode S [0] tree -master S [0] no -blast_nseq D [0] 0 -lalign_n_top D [0] 10 -iterate D [1] 0 -trim D [0] 0 -split D [0] 0 -trimfile S [0] default -split D [0] 0 -split_nseq_thres D [0] 0 -split_score_thres D [0] 0 -check_pdb_status D [0] 0 -clean_seq_name D [0] 0 -seq_to_keep S [0] -dpa_master_aln S [0] -dpa_maxnseq D [0] 0 -dpa_min_score1 D [0] -dpa_min_score2 D [0] -dpa_keep_tmpfile FL [0] 0 -dpa_debug D [0] 0 -multi_core S [0] templates_jobs_relax_msa_evaluate -n_core D [0] 0 -max_n_proc D [0] 0 -lib_list S [0] -prune_lib_mode S [0] 5 -tip S [0] none -rna_lib S [0] -no_warning D [0] 0 -run_local_script D [0] 0 -plugins S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] ns S [0] default -proxy S [0] unset -email S [0] -clean_overaln D [0] 0 -overaln_param S [0] -overaln_mode S [0] -overaln_model S [0] -overaln_threshold D [0] 0 -overaln_target D [0] 0 -overaln_P1 D [0] 0 -overaln_P2 D [0] 0 -overaln_P3 D [0] 0 -overaln_P4 D [0] 0 -exon_boundaries S [0] -dump S [0] no -display D [0] 100 INPUT FILES Input File (S) /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln Input File (M) proba_pair Identify Master Sequences [no]: Master Sequences Identified INPUT SEQUENCES: 11 SEQUENCES [PROTEIN] Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 387 type PROTEIN Struct Unchecked Input File /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 387 type PROTEIN Struct Unchecked Multi Core Mode: 72 processors: --- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln --- Process Method/Library/Aln Mproba_pair xxx Retrieved S/opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln xxx Retrieved Mproba_pair All Methods Retrieved MANUAL PENALTIES: gapopen=0 gapext=0 Library Total Size: [42750] Library Relaxation: Multi_proc [72] Relaxation Summary: [42750]--->[42730] UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1 OUTPUT RESULTS #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii #### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html #### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii # Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/acj6-PG/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE] # T-COFFEE Memory Usage: Current= 29.686 Mb, Max= 31.901 Mb # Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427) # T-COFFEE is available from http://www.tcoffee.org # Register on: https://groups.google.com/group/tcoffee/ >C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIYT-HHLP SFQSRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGYo >C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- FORMAT of file /tmp/tmp3569132950681619460aln Not Supported[FATAL:T-COFFEE] >C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIYT-HHLP SFQSRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGYo >C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- >C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:388 S:99 BS:388 # TC_SIMILARITY_MATRIX_FORMAT_01 # SEQ_INDEX C1 0 # SEQ_INDEX C2 1 # SEQ_INDEX C3 2 # SEQ_INDEX C4 3 # SEQ_INDEX C5 4 # SEQ_INDEX C6 5 # SEQ_INDEX C7 6 # SEQ_INDEX C8 7 # SEQ_INDEX C9 8 # SEQ_INDEX C10 9 # SEQ_INDEX C11 10 # PW_SEQ_DISTANCES BOT 0 1 100.00 C1 C2 100.00 TOP 1 0 100.00 C2 C1 100.00 BOT 0 2 100.00 C1 C3 100.00 TOP 2 0 100.00 C3 C1 100.00 BOT 0 3 100.00 C1 C4 100.00 TOP 3 0 100.00 C4 C1 100.00 BOT 0 4 100.00 C1 C5 100.00 TOP 4 0 100.00 C5 C1 100.00 BOT 0 5 100.00 C1 C6 100.00 TOP 5 0 100.00 C6 C1 100.00 BOT 0 6 100.00 C1 C7 100.00 TOP 6 0 100.00 C7 C1 100.00 BOT 0 7 99.74 C1 C8 99.74 TOP 7 0 99.74 C8 C1 99.74 BOT 0 8 97.93 C1 C9 97.93 TOP 8 0 97.93 C9 C1 97.93 BOT 0 9 99.74 C1 C10 99.74 TOP 9 0 99.74 C10 C1 99.74 BOT 0 10 99.74 C1 C11 99.74 TOP 10 0 99.74 C11 C1 99.74 BOT 1 2 100.00 C2 C3 100.00 TOP 2 1 100.00 C3 C2 100.00 BOT 1 3 100.00 C2 C4 100.00 TOP 3 1 100.00 C4 C2 100.00 BOT 1 4 100.00 C2 C5 100.00 TOP 4 1 100.00 C5 C2 100.00 BOT 1 5 100.00 C2 C6 100.00 TOP 5 1 100.00 C6 C2 100.00 BOT 1 6 100.00 C2 C7 100.00 TOP 6 1 100.00 C7 C2 100.00 BOT 1 7 99.74 C2 C8 99.74 TOP 7 1 99.74 C8 C2 99.74 BOT 1 8 97.93 C2 C9 97.93 TOP 8 1 97.93 C9 C2 97.93 BOT 1 9 99.74 C2 C10 99.74 TOP 9 1 99.74 C10 C2 99.74 BOT 1 10 99.74 C2 C11 99.74 TOP 10 1 99.74 C11 C2 99.74 BOT 2 3 100.00 C3 C4 100.00 TOP 3 2 100.00 C4 C3 100.00 BOT 2 4 100.00 C3 C5 100.00 TOP 4 2 100.00 C5 C3 100.00 BOT 2 5 100.00 C3 C6 100.00 TOP 5 2 100.00 C6 C3 100.00 BOT 2 6 100.00 C3 C7 100.00 TOP 6 2 100.00 C7 C3 100.00 BOT 2 7 99.74 C3 C8 99.74 TOP 7 2 99.74 C8 C3 99.74 BOT 2 8 97.93 C3 C9 97.93 TOP 8 2 97.93 C9 C3 97.93 BOT 2 9 99.74 C3 C10 99.74 TOP 9 2 99.74 C10 C3 99.74 BOT 2 10 99.74 C3 C11 99.74 TOP 10 2 99.74 C11 C3 99.74 BOT 3 4 100.00 C4 C5 100.00 TOP 4 3 100.00 C5 C4 100.00 BOT 3 5 100.00 C4 C6 100.00 TOP 5 3 100.00 C6 C4 100.00 BOT 3 6 100.00 C4 C7 100.00 TOP 6 3 100.00 C7 C4 100.00 BOT 3 7 99.74 C4 C8 99.74 TOP 7 3 99.74 C8 C4 99.74 BOT 3 8 97.93 C4 C9 97.93 TOP 8 3 97.93 C9 C4 97.93 BOT 3 9 99.74 C4 C10 99.74 TOP 9 3 99.74 C10 C4 99.74 BOT 3 10 99.74 C4 C11 99.74 TOP 10 3 99.74 C11 C4 99.74 BOT 4 5 100.00 C5 C6 100.00 TOP 5 4 100.00 C6 C5 100.00 BOT 4 6 100.00 C5 C7 100.00 TOP 6 4 100.00 C7 C5 100.00 BOT 4 7 99.74 C5 C8 99.74 TOP 7 4 99.74 C8 C5 99.74 BOT 4 8 97.93 C5 C9 97.93 TOP 8 4 97.93 C9 C5 97.93 BOT 4 9 99.74 C5 C10 99.74 TOP 9 4 99.74 C10 C5 99.74 BOT 4 10 99.74 C5 C11 99.74 TOP 10 4 99.74 C11 C5 99.74 BOT 5 6 100.00 C6 C7 100.00 TOP 6 5 100.00 C7 C6 100.00 BOT 5 7 99.74 C6 C8 99.74 TOP 7 5 99.74 C8 C6 99.74 BOT 5 8 97.93 C6 C9 97.93 TOP 8 5 97.93 C9 C6 97.93 BOT 5 9 99.74 C6 C10 99.74 TOP 9 5 99.74 C10 C6 99.74 BOT 5 10 99.74 C6 C11 99.74 TOP 10 5 99.74 C11 C6 99.74 BOT 6 7 99.74 C7 C8 99.74 TOP 7 6 99.74 C8 C7 99.74 BOT 6 8 97.93 C7 C9 97.93 TOP 8 6 97.93 C9 C7 97.93 BOT 6 9 99.74 C7 C10 99.74 TOP 9 6 99.74 C10 C7 99.74 BOT 6 10 99.74 C7 C11 99.74 TOP 10 6 99.74 C11 C7 99.74 BOT 7 8 97.93 C8 C9 97.93 TOP 8 7 97.93 C9 C8 97.93 BOT 7 9 100.00 C8 C10 100.00 TOP 9 7 100.00 C10 C8 100.00 BOT 7 10 100.00 C8 C11 100.00 TOP 10 7 100.00 C11 C8 100.00 BOT 8 9 97.93 C9 C10 97.93 TOP 9 8 97.93 C10 C9 97.93 BOT 8 10 97.93 C9 C11 97.93 TOP 10 8 97.93 C11 C9 97.93 BOT 9 10 100.00 C10 C11 100.00 TOP 10 9 100.00 C11 C10 100.00 AVG 0 C1 * 99.72 AVG 1 C2 * 99.72 AVG 2 C3 * 99.72 AVG 3 C4 * 99.72 AVG 4 C5 * 99.72 AVG 5 C6 * 99.72 AVG 6 C7 * 99.72 AVG 7 C8 * 99.61 AVG 8 C9 * 97.93 AVG 9 C10 * 99.61 AVG 10 C11 * 99.61 TOT TOT * 99.52 CLUSTAL W (1.83) multiple sequence alignment C1 ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC C2 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C3 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C4 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C5 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C6 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C7 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C8 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C9 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C10 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC C11 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC ***************** ******************************** C1 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA C2 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA C3 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA C4 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA C5 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA C6 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA C7 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA C8 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA C9 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA C10 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA C11 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA ********************************* **************.* C1 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT C2 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT C3 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT C4 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT C5 TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT C6 TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT C7 TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT C8 TGCGTCGCTGTATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT C9 TGCGCCGCTGCATGCCAAATCCATCTATTTACACA---CATCATCTTCCG C10 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT C11 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT **** ***** ****************** *** . .: . . C1 TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG C2 TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG C3 TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG C4 TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG C5 TCTCTCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG C6 TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG C7 TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG C8 TCAATCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG C9 TCTTTTCAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG C10 TCTATCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG C11 TCTATCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG **: * **********.******************************** C1 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC C2 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC C3 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC C4 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC C5 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC C6 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC C7 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGGATCC C8 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGCATAC C9 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC C10 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC C11 GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGCATCC ****************************************** ** **.* C1 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC C2 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC C3 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC C4 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC C5 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC C6 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC C7 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC C8 TCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAAGCATCAAGCC C9 TCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAAGCACCAAGCC C10 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC C11 TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC ***************** ****.******************** ****** C1 CAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACGACGTCATGTA C2 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA C3 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA C4 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA C5 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA C6 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA C7 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA C8 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGATGTCATGTA C9 CAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACGACGTCATGTA C10 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA C11 CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA ***** **.** *****************.** ******** ******** C1 CCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC C2 CCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC C3 CCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC C4 TCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC C5 CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGATGCACC C6 CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTGCAGATGCACC C7 CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGATGCACC C8 CCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC C9 CCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTGCAGATGCACC C10 CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC C11 CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC ** ** ***************** ** **.***** ************ C1 ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA C2 ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA C3 ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA C4 ACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTCGATGACCACA C5 ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG C6 ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG C7 ACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTCGATGACCACG C8 ACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTCAATGACCACG C9 ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG C10 ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACG C11 ACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTCGATGACCACG *************.************** **.********.********. C1 CTGGCGCCCATCTCGGAGTCGCCGCTAACGCCCACACACCAACACCTGCA C2 CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA C3 CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA C4 CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA C5 CTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA C6 CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA C7 TTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA C8 TTGGCGCCCATATCGGAGTCGCCTCTAACGCCAACACACCAACACCTGCA C9 TTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA C10 TTGGCGCCCATTTCGGAGTCCCCACTGACGCCCACACACCAGCACCTGCA C11 TTGGCGCCCATCTCGGAGTCCCCTCTGACGCCCACACACCAGCACCTGCA ********** ******** ** **.*****.********.******** C1 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C2 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C3 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C4 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C5 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C6 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C7 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C8 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C9 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C10 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA C11 CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA ************************************************** C1 CGTTAAGTGGCCATACGGGGGGACATCATGGACACTCGGCGGTACATCAT C2 CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT C3 CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT C4 CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT C5 CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT C6 CGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCGGCGGTACATCAT C7 CGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCAGCGGTACATCAT C8 CGTTAAGTGGCCACACGGGGGGCCACCATGGACACTCAGCGGTACATCAT C9 CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT C10 CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT C11 CGCTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT ** ********** ******** ** ***********.************ C1 CCTGTTATCACGGCGGCAGTGGCTGCCGCTGGCCTGCATCCCGACACAGA C2 CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA C3 CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA C4 CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA C5 CCTGTTATCACGGCGGCGGTAGCTGCCGCTGGCCTGCATCCCGACACAGA C6 CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACAGA C7 CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACAGA C8 CCTGTTATCACAGCGGCAGTGGCAGCCGCTGGCCTGCATCCCGACACAGA C9 CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA C10 CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACCGA C11 CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACCGA ***********.*****.**.**:***********************.** C1 TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGATTCAAGCAGCGGC C2 TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC C3 TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC C4 TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC C5 TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC C6 CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC C7 CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC C8 TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC C9 CACCGATCCCCGCGAGCTGGAGGCCTTCGCGGAGCGGTTCAAGCAGCGGC C10 CACCGATCCCCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC C11 CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC ******** ************** ** ******** ************* C1 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT C2 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT C3 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT C4 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT C5 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT C6 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT C7 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT C8 GCATCAAGCTGGGCGTTACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT C9 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT C10 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT C11 GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT ************* ** ********************.************ C1 CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT C2 CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT C3 CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT C4 CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT C5 CTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAGAGCACGATCTGTCGCTT C6 CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT C7 CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT C8 CTCAAGTTACCTGGCGTCGGAGCGCTGTCACAGAGCACGATCTGTAGATT C9 CTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGATCTGCAGGTT C10 CTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGATCTGTAGATT C11 CTCAAGTTACCTGGCGTCGGCGCACTGTCGCAGAGCACGATCTGTCGATT **.***************** **.*****.************** .* ** C1 CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTTAAGCCCATCC C2 CGAGAGCCTGACCCTGTCCCACAACAATATGATCGCCCTCAAGCCCATCC C3 CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTCAAGCCCATCC C4 CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTGAAGCCCATCC C5 CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC C6 CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC C7 CGAGAGCCTGACCCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC C8 CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC C9 CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC C10 CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC C11 CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC ************ ***** ******** *********** ********** C1 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC C2 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC C3 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC C4 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC C5 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC C6 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC C7 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC C8 TGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGGCGAAAAACAAGAGGCGC C9 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC C10 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGACGC C11 TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGACGC ********************** *********************.*.*** C1 GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C2 GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C3 GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C4 GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C5 GATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C6 GACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C7 GATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C8 GATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C9 GACCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C10 GATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC C11 GACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC ** ** ** ***************************************** C1 CATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGC C2 CATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGC C3 CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC C4 CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC C5 CATTGCGGCACCCGAAAAGCGTTCTTTGGAAGCCTACTTTGCCGTCCAGC C6 CATTGCGGCACCTGAAAAGCGCTCCCTGGAAGCCTACTTCGCCGTCCAGC C7 CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC C8 CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGC C9 CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGC C10 CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC C11 CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTTGCCGTGCAGC ************ ******** ** ************* ***** **** C1 CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG C2 CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG C3 CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG C4 CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG C5 CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG C6 CGAGGCCGTCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG C7 CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG C8 CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG C9 CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG C10 CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG C11 CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG *******.*****************:** ********************* C1 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C2 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C3 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C4 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C5 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C6 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C7 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C8 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C9 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C10 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA C11 AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ************************************************** C1 ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG C2 ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG C3 ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG C4 ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG C5 ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG C6 ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG C7 ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG C8 ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCAGCGG C9 ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG C10 ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG C11 ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG ************************.********************.**** C1 GATTTGGATAC--- C2 GATTTGGATAC--- C3 GATTTGGATAC--- C4 GATTTGGATAC--- C5 GATTTGGATAC--- C6 GATTTGGATAC--- C7 GATTTGGATAC--- C8 GATTTGGATAC--- C9 GATTTGGATAC--- C10 GATTTGGATAC--- C11 GATTTGGATAC--- *********** >C1 ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACGACGTCATGTA CCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA CTGGCGCCCATCTCGGAGTCGCCGCTAACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCATACGGGGGGACATCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCAGTGGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGATTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTTAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C2 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCCCACAACAATATGATCGCCCTCAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C3 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTCAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C4 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA TCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTCGATGACCACA CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C5 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT TCTCTCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG CTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTAGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAGAGCACGATCTGTCGCTT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCCGAAAAGCGTTCTTTGGAAGCCTACTTTGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C6 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACAGA CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGCTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCGTCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C7 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGGATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTCGATGACCACG TTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACAGA CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C8 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA TGCGTCGCTGTATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT TCAATCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGCATAC TCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGATGTCATGTA CCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTCAATGACCACG TTGGCGCCCATATCGGAGTCGCCTCTAACGCCAACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGCCACCATGGACACTCAGCGGTACATCAT CCTGTTATCACAGCGGCAGTGGCAGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC GCATCAAGCTGGGCGTTACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCACAGAGCACGATCTGTAGATT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGGCGAAAAACAAGAGGCGC GATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCAGCGG GATTTGGATAC--- >C9 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA TGCGCCGCTGCATGCCAAATCCATCTATTTACACA---CATCATCTTCCG TCTTTTCAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAAGCACCAAGCC CAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACGACGTCATGTA CCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG TTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA CACCGATCCCCGCGAGCTGGAGGCCTTCGCGGAGCGGTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT CTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGATCTGCAGGTT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GACCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGC CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C10 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT TCTATCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACG TTGGCGCCCATTTCGGAGTCCCCACTGACGCCCACACACCAGCACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACCGA CACCGATCCCCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGATCTGTAGATT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGACGC GATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C11 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT TCTATCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGCATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTCGATGACCACG TTGGCGCCCATCTCGGAGTCCCCTCTGACGCCCACACACCAGCACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGCTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACCGA CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGCGCACTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGACGC GACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTTGCCGTGCAGC CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIYToHHLP SFQSRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY MrBayes v3.2.2 x64 (Bayesian Analysis of Phylogeny) Distributed under the GNU General Public License Type "help" or "help <command>" for information on the commands that are available. Type "about" for authorship and general information about the program. Executing file "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb" UNIX line termination Longest line length = 63 Parsing file Expecting NEXUS formatted file Reading data block Allocated taxon set Allocated matrix Defining new matrix with 11 taxa and 1164 characters Missing data coded as ? Data matrix is interleaved Data is Dna Gaps coded as - Matching characters coded as . Taxon 1 -> C1 Taxon 2 -> C2 Taxon 3 -> C3 Taxon 4 -> C4 Taxon 5 -> C5 Taxon 6 -> C6 Taxon 7 -> C7 Taxon 8 -> C8 Taxon 9 -> C9 Taxon 10 -> C10 Taxon 11 -> C11 Successfully read matrix Setting default partition (does not divide up characters) Setting model defaults Seed (for generating default start values) = 1479801764 Setting output file names to "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>" Exiting data block Reading mrbayes block Setting autoclose to yes Setting nowarnings to yes Defining charset called first_pos Defining charset called second_pos Defining charset called third_pos Defining partition called by_codon Setting by_codon as the partition, dividing characters into 3 parts. Setting model defaults Seed (for generating default start values) = 227283013 Setting Nst to 6 for partition 1 Setting Nst to 6 for partition 2 Setting Nst to 6 for partition 3 Setting Rates to Invgamma for partition 1 Setting Rates to Invgamma for partition 2 Setting Rates to Invgamma for partition 3 Successfully set likelihood model parameters to all applicable data partitions Unlinking Setting number of generations to 1000000 Running Markov chain MCMC stamp = 4962710562 Seed = 1611456359 Swapseed = 1479801764 Model settings: Settings for partition 1 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 2 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Settings for partition 3 -- Datatype = DNA Nucmodel = 4by4 Nst = 6 Substitution rates, expressed as proportions of the rate sum, have a Dirichlet prior (1.00,1.00,1.00,1.00,1.00,1.00) Covarion = No # States = 4 State frequencies have a Dirichlet prior (1.00,1.00,1.00,1.00) Rates = Invgamma Gamma shape parameter is exponentially distributed with parameter (2.00). Proportion of invariable sites is uniformly dist- ributed on the interval (0.00,1.00). Gamma distribution is approximated using 4 categories. Likelihood summarized over all rate categories in each generation. Active parameters: Partition(s) Parameters 1 2 3 ------------------------ Revmat 1 1 1 Statefreq 2 2 2 Shape 3 3 4 Pinvar 5 5 5 Ratemultiplier 6 6 6 Topology 7 7 7 Brlens 8 8 8 ------------------------ Parameters can be linked or unlinked across partitions using 'link' and 'unlink' 1 -- Parameter = Revmat{all} Type = Rates of reversible rate matrix Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00) Partitions = All 2 -- Parameter = Pi{all} Type = Stationary state frequencies Prior = Dirichlet Partitions = All 3 -- Parameter = Alpha{1,2} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partitions = 1 and 2 4 -- Parameter = Alpha{3} Type = Shape of scaled gamma distribution of site rates Prior = Exponential(2.00) Partition = 3 5 -- Parameter = Pinvar{all} Type = Proportion of invariable sites Prior = Uniform(0.00,1.00) Partitions = All 6 -- Parameter = Ratemultiplier{all} Type = Partition-specific rate multiplier Prior = Fixed(1.0) Partitions = All 7 -- Parameter = Tau{all} Type = Topology Prior = All topologies equally probable a priori Partitions = All Subparam. = V{all} 8 -- Parameter = V{all} Type = Branch lengths Prior = Unconstrained:Exponential(10.0) Partitions = All The MCMC sampler will use the following moves: With prob. Chain will use move 1.06 % Dirichlet(Revmat{all}) 1.06 % Slider(Revmat{all}) 1.06 % Dirichlet(Pi{all}) 1.06 % Slider(Pi{all}) 2.13 % Multiplier(Alpha{1,2}) 2.13 % Multiplier(Alpha{3}) 2.13 % Slider(Pinvar{all}) 10.64 % ExtSPR(Tau{all},V{all}) 10.64 % ExtTBR(Tau{all},V{all}) 10.64 % NNI(Tau{all},V{all}) 10.64 % ParsSPR(Tau{all},V{all}) 31.91 % Multiplier(V{all}) 10.64 % Nodeslider(V{all}) 4.26 % TLMultiplier(V{all}) Division 1 has 17 unique site patterns Division 2 has 10 unique site patterns Division 3 has 72 unique site patterns Initializing conditional likelihoods Using standard SSE likelihood calculator for division 1 (single-precision) Using standard SSE likelihood calculator for division 2 (single-precision) Using standard SSE likelihood calculator for division 3 (single-precision) Initializing invariable-site conditional likelihoods Initial log likelihoods and log prior probs for run 1: Chain 1 -- -4298.010711 -- -24.640631 Chain 2 -- -4353.657875 -- -24.640631 Chain 3 -- -4318.873629 -- -24.640631 Chain 4 -- -4336.146478 -- -24.640631 Initial log likelihoods and log prior probs for run 2: Chain 1 -- -4332.256915 -- -24.640631 Chain 2 -- -4349.660431 -- -24.640631 Chain 3 -- -4326.046181 -- -24.640631 Chain 4 -- -4337.166282 -- -24.640631 Using a relative burnin of 25.0 % for diagnostics Chain results (1000000 generations requested): 0 -- [-4298.011] (-4353.658) (-4318.874) (-4336.146) * [-4332.257] (-4349.660) (-4326.046) (-4337.166) 500 -- [-2591.308] (-2624.100) (-2619.053) (-2631.878) * (-2610.011) [-2595.721] (-2602.005) (-2604.920) -- 0:00:00 1000 -- (-2567.387) (-2597.122) (-2567.309) [-2590.281] * (-2569.177) (-2563.388) [-2557.982] (-2563.561) -- 0:16:39 1500 -- [-2547.625] (-2548.724) (-2541.854) (-2554.515) * (-2558.222) (-2547.435) (-2556.927) [-2529.159] -- 0:11:05 2000 -- (-2539.217) (-2520.412) [-2487.167] (-2536.312) * (-2532.864) (-2524.550) [-2544.605] (-2514.938) -- 0:08:19 2500 -- (-2513.606) [-2500.064] (-2485.540) (-2521.363) * (-2517.342) (-2528.002) [-2512.081] (-2505.344) -- 0:06:39 3000 -- (-2499.053) [-2483.868] (-2488.267) (-2494.256) * [-2487.677] (-2509.412) (-2501.079) (-2501.005) -- 0:05:32 3500 -- (-2486.119) [-2478.224] (-2490.177) (-2486.486) * [-2478.177] (-2487.533) (-2502.893) (-2508.399) -- 0:09:29 4000 -- (-2485.459) (-2483.341) (-2501.041) [-2480.039] * [-2467.344] (-2490.820) (-2495.443) (-2493.391) -- 0:08:18 4500 -- (-2487.364) (-2478.794) (-2501.934) [-2470.668] * [-2469.741] (-2486.623) (-2494.128) (-2487.147) -- 0:07:22 5000 -- [-2474.967] (-2472.894) (-2488.482) (-2482.753) * [-2467.417] (-2486.614) (-2490.262) (-2493.335) -- 0:06:38 Average standard deviation of split frequencies: 0.104757 5500 -- (-2473.804) [-2477.033] (-2484.843) (-2485.258) * (-2479.783) [-2485.948] (-2481.842) (-2480.820) -- 0:06:01 6000 -- (-2478.656) (-2483.729) (-2489.929) [-2481.888] * [-2469.499] (-2483.382) (-2476.273) (-2487.794) -- 0:05:31 6500 -- (-2465.632) (-2480.350) [-2480.455] (-2488.026) * (-2475.705) [-2474.436] (-2475.587) (-2496.091) -- 0:07:38 7000 -- (-2471.345) [-2475.804] (-2481.772) (-2468.819) * (-2470.855) (-2476.356) [-2476.930] (-2494.292) -- 0:07:05 7500 -- [-2473.319] (-2481.622) (-2481.224) (-2472.329) * (-2469.197) (-2479.911) (-2481.102) [-2476.227] -- 0:06:37 8000 -- [-2464.345] (-2477.433) (-2476.101) (-2481.827) * (-2473.811) (-2483.314) (-2468.798) [-2477.076] -- 0:06:12 8500 -- (-2466.750) (-2474.791) [-2468.966] (-2467.633) * (-2465.961) (-2489.278) (-2480.762) [-2472.882] -- 0:05:49 9000 -- (-2480.376) (-2485.533) (-2482.090) [-2463.613] * [-2473.689] (-2475.285) (-2476.870) (-2477.438) -- 0:07:20 9500 -- (-2473.821) (-2487.810) [-2472.120] (-2465.424) * (-2470.216) (-2475.473) (-2489.993) [-2468.347] -- 0:06:57 10000 -- (-2476.998) (-2479.794) (-2471.416) [-2468.321] * [-2470.977] (-2469.166) (-2473.097) (-2480.682) -- 0:06:36 Average standard deviation of split frequencies: 0.044194 10500 -- [-2474.663] (-2483.627) (-2484.097) (-2467.861) * (-2486.023) [-2473.803] (-2476.259) (-2470.651) -- 0:06:16 11000 -- [-2472.823] (-2484.414) (-2479.259) (-2467.724) * (-2475.916) (-2472.476) [-2472.469] (-2478.254) -- 0:05:59 11500 -- (-2480.326) [-2464.141] (-2471.908) (-2472.184) * (-2479.261) [-2462.119] (-2473.460) (-2498.567) -- 0:07:09 12000 -- (-2468.864) (-2477.155) (-2471.750) [-2467.671] * (-2486.145) [-2474.821] (-2475.875) (-2485.190) -- 0:06:51 12500 -- (-2474.525) (-2475.104) (-2484.848) [-2471.351] * (-2478.683) (-2483.017) [-2478.138] (-2474.980) -- 0:06:35 13000 -- (-2471.437) (-2474.666) [-2471.586] (-2484.836) * (-2474.456) (-2488.165) (-2483.225) [-2476.699] -- 0:06:19 13500 -- (-2479.727) (-2470.232) (-2482.239) [-2467.309] * [-2477.293] (-2486.082) (-2480.740) (-2479.922) -- 0:06:05 14000 -- (-2488.311) (-2482.326) (-2473.586) [-2475.510] * (-2473.606) [-2468.436] (-2485.825) (-2481.222) -- 0:07:02 14500 -- (-2481.900) (-2478.365) [-2471.970] (-2483.224) * (-2473.469) (-2465.521) [-2477.308] (-2478.787) -- 0:06:47 15000 -- (-2477.768) (-2475.061) (-2469.776) [-2481.595] * (-2481.820) (-2472.497) (-2477.502) [-2465.084] -- 0:06:34 Average standard deviation of split frequencies: 0.045176 15500 -- (-2471.637) [-2474.226] (-2473.996) (-2471.326) * (-2484.074) [-2469.505] (-2471.846) (-2466.444) -- 0:06:21 16000 -- (-2469.231) [-2477.302] (-2471.093) (-2470.880) * [-2475.455] (-2476.034) (-2482.132) (-2476.108) -- 0:06:09 16500 -- (-2477.486) (-2482.865) [-2471.336] (-2478.147) * (-2495.767) [-2477.083] (-2479.618) (-2480.541) -- 0:05:57 17000 -- (-2482.732) [-2470.540] (-2468.714) (-2478.701) * (-2478.284) (-2480.832) [-2471.820] (-2492.315) -- 0:06:44 17500 -- (-2477.401) [-2468.155] (-2479.049) (-2477.689) * [-2475.548] (-2478.968) (-2474.251) (-2480.387) -- 0:06:33 18000 -- (-2475.190) [-2469.335] (-2472.425) (-2487.996) * [-2467.239] (-2476.460) (-2469.270) (-2495.945) -- 0:06:21 18500 -- (-2472.871) (-2463.790) (-2473.886) [-2478.388] * (-2487.014) (-2476.793) (-2478.814) [-2481.377] -- 0:06:11 19000 -- (-2471.984) (-2476.368) [-2471.461] (-2489.049) * (-2476.123) (-2471.593) (-2481.189) [-2474.551] -- 0:06:01 19500 -- (-2479.447) (-2469.066) [-2469.845] (-2480.903) * (-2472.516) (-2478.131) [-2465.151] (-2482.763) -- 0:06:42 20000 -- (-2468.921) (-2473.332) (-2482.362) [-2468.061] * (-2472.122) [-2468.650] (-2477.440) (-2478.986) -- 0:06:32 Average standard deviation of split frequencies: 0.052748 20500 -- [-2480.554] (-2472.876) (-2499.908) (-2470.562) * (-2470.165) (-2478.492) [-2473.944] (-2478.134) -- 0:06:22 21000 -- [-2466.094] (-2478.787) (-2482.144) (-2470.225) * [-2480.158] (-2483.418) (-2468.807) (-2474.096) -- 0:06:12 21500 -- [-2464.786] (-2472.992) (-2488.134) (-2477.512) * (-2484.030) [-2475.157] (-2475.727) (-2485.551) -- 0:06:04 22000 -- [-2468.922] (-2472.112) (-2475.243) (-2468.756) * (-2477.057) (-2481.296) [-2465.134] (-2481.956) -- 0:05:55 22500 -- (-2480.698) (-2480.852) [-2483.939] (-2474.413) * (-2476.612) (-2491.962) (-2467.134) [-2472.239] -- 0:05:47 23000 -- (-2482.888) (-2475.110) [-2473.662] (-2471.001) * (-2475.530) (-2479.475) (-2471.775) [-2471.755] -- 0:06:22 23500 -- (-2475.100) [-2463.904] (-2479.500) (-2469.150) * (-2475.222) (-2480.255) [-2470.982] (-2471.020) -- 0:06:13 24000 -- (-2474.336) (-2479.363) [-2474.504] (-2471.379) * [-2480.365] (-2488.469) (-2479.649) (-2469.863) -- 0:06:06 24500 -- (-2470.676) [-2471.313] (-2473.289) (-2476.305) * (-2478.322) (-2484.098) [-2475.233] (-2468.823) -- 0:05:58 25000 -- (-2482.256) (-2474.040) (-2481.590) [-2465.523] * (-2487.259) (-2474.806) (-2471.993) [-2469.936] -- 0:06:30 Average standard deviation of split frequencies: 0.037395 25500 -- (-2474.281) (-2475.148) (-2484.865) [-2479.836] * (-2486.772) (-2474.113) (-2474.152) [-2473.082] -- 0:06:22 26000 -- (-2472.298) (-2479.325) (-2473.987) [-2466.926] * (-2481.624) (-2470.904) (-2470.838) [-2471.830] -- 0:06:14 26500 -- (-2474.701) (-2487.143) (-2479.246) [-2466.984] * (-2474.241) (-2468.861) [-2478.056] (-2473.642) -- 0:06:07 27000 -- (-2483.928) [-2479.855] (-2483.143) (-2473.612) * (-2476.260) (-2479.349) (-2474.222) [-2471.696] -- 0:06:00 27500 -- [-2467.419] (-2471.914) (-2468.878) (-2469.093) * (-2474.708) (-2478.416) [-2468.695] (-2482.887) -- 0:05:53 28000 -- (-2470.873) [-2474.369] (-2489.595) (-2491.035) * (-2481.354) (-2485.296) [-2486.132] (-2470.960) -- 0:05:47 28500 -- (-2471.260) (-2486.887) (-2483.335) [-2470.200] * [-2470.994] (-2474.758) (-2481.646) (-2479.353) -- 0:06:14 29000 -- (-2474.769) (-2479.570) [-2477.816] (-2474.850) * [-2470.260] (-2471.684) (-2482.982) (-2475.348) -- 0:06:08 29500 -- (-2473.049) (-2475.915) [-2473.705] (-2475.835) * [-2471.838] (-2478.552) (-2479.384) (-2472.630) -- 0:06:01 30000 -- (-2476.879) (-2471.024) [-2472.348] (-2473.557) * (-2475.034) (-2472.943) (-2468.884) [-2473.079] -- 0:05:55 Average standard deviation of split frequencies: 0.035868 30500 -- (-2476.317) [-2466.172] (-2485.174) (-2467.207) * (-2481.956) (-2483.206) (-2477.009) [-2474.209] -- 0:06:21 31000 -- (-2479.076) [-2469.802] (-2483.752) (-2474.678) * (-2470.500) [-2476.206] (-2481.938) (-2471.164) -- 0:06:15 31500 -- [-2477.612] (-2478.368) (-2469.617) (-2487.252) * (-2468.783) (-2480.044) [-2470.887] (-2474.769) -- 0:06:08 32000 -- (-2476.712) (-2472.754) [-2477.982] (-2470.056) * (-2485.613) [-2469.511] (-2473.899) (-2466.567) -- 0:06:03 32500 -- (-2473.637) (-2482.980) [-2469.265] (-2476.578) * (-2478.630) (-2468.672) (-2483.312) [-2466.763] -- 0:05:57 33000 -- (-2485.605) [-2475.483] (-2467.855) (-2478.586) * (-2478.564) [-2479.829] (-2481.923) (-2476.568) -- 0:06:20 33500 -- (-2471.008) (-2476.660) [-2461.870] (-2477.901) * [-2474.423] (-2479.177) (-2469.586) (-2479.866) -- 0:06:15 34000 -- (-2467.968) (-2478.824) [-2471.879] (-2493.287) * (-2476.131) (-2480.280) (-2474.613) [-2479.143] -- 0:06:09 34500 -- (-2472.186) [-2468.358] (-2470.367) (-2490.239) * [-2479.502] (-2473.566) (-2475.216) (-2473.413) -- 0:06:03 35000 -- (-2470.553) [-2470.216] (-2475.265) (-2481.945) * [-2471.834] (-2480.422) (-2480.764) (-2473.911) -- 0:05:58 Average standard deviation of split frequencies: 0.046267 35500 -- (-2476.131) [-2470.057] (-2482.200) (-2468.653) * [-2471.412] (-2485.379) (-2471.527) (-2474.792) -- 0:05:53 36000 -- (-2481.307) (-2470.687) (-2478.041) [-2470.283] * (-2472.989) (-2474.310) [-2460.756] (-2500.266) -- 0:06:14 36500 -- (-2470.557) (-2477.986) [-2478.382] (-2479.295) * [-2481.812] (-2474.219) (-2469.005) (-2478.258) -- 0:06:09 37000 -- (-2470.126) (-2482.688) (-2473.957) [-2474.584] * (-2463.536) [-2471.154] (-2476.425) (-2472.057) -- 0:06:04 37500 -- [-2467.818] (-2478.190) (-2479.313) (-2472.802) * (-2477.983) (-2484.623) (-2488.445) [-2469.554] -- 0:05:59 38000 -- (-2476.605) [-2465.081] (-2469.266) (-2486.593) * (-2480.501) [-2468.518] (-2472.167) (-2476.073) -- 0:05:54 38500 -- [-2464.094] (-2473.545) (-2471.981) (-2478.991) * (-2469.601) [-2473.749] (-2473.836) (-2481.038) -- 0:05:49 39000 -- (-2464.962) [-2468.211] (-2478.881) (-2496.955) * (-2478.622) [-2477.845] (-2467.537) (-2474.038) -- 0:06:09 39500 -- [-2462.544] (-2479.157) (-2492.121) (-2480.700) * [-2476.405] (-2475.137) (-2472.434) (-2485.088) -- 0:06:04 40000 -- (-2474.974) (-2483.238) (-2472.131) [-2474.820] * (-2484.497) (-2482.328) [-2477.545] (-2483.948) -- 0:06:00 Average standard deviation of split frequencies: 0.043056 40500 -- (-2477.356) (-2483.036) [-2467.561] (-2471.224) * (-2479.287) [-2484.057] (-2483.190) (-2475.059) -- 0:05:55 41000 -- (-2479.276) (-2482.752) (-2472.573) [-2472.746] * (-2492.021) (-2479.855) [-2481.307] (-2477.884) -- 0:05:50 41500 -- (-2468.207) (-2472.059) (-2475.306) [-2475.376] * (-2471.761) (-2479.808) (-2467.710) [-2470.630] -- 0:06:09 42000 -- (-2468.239) (-2470.895) (-2475.375) [-2478.165] * (-2471.679) (-2474.144) (-2479.042) [-2465.889] -- 0:06:04 42500 -- (-2474.893) [-2468.902] (-2475.646) (-2481.677) * [-2472.587] (-2470.226) (-2481.130) (-2479.275) -- 0:06:00 43000 -- [-2471.428] (-2472.268) (-2482.033) (-2471.908) * (-2469.060) [-2469.679] (-2476.872) (-2477.602) -- 0:05:56 43500 -- [-2473.498] (-2477.046) (-2484.404) (-2474.308) * [-2472.265] (-2479.263) (-2472.001) (-2476.431) -- 0:05:51 44000 -- [-2477.579] (-2482.533) (-2481.848) (-2486.855) * [-2469.896] (-2475.631) (-2485.146) (-2478.835) -- 0:06:09 44500 -- (-2476.822) [-2474.193] (-2483.942) (-2483.492) * (-2462.621) (-2466.727) (-2478.095) [-2475.430] -- 0:06:05 45000 -- (-2480.202) (-2469.411) (-2476.329) [-2468.247] * (-2483.118) (-2475.808) (-2474.403) [-2466.447] -- 0:06:00 Average standard deviation of split frequencies: 0.045091 45500 -- (-2478.445) (-2478.922) (-2474.339) [-2477.876] * (-2483.376) (-2483.636) [-2467.720] (-2475.168) -- 0:05:56 46000 -- [-2468.750] (-2485.642) (-2470.114) (-2477.947) * (-2483.698) (-2486.879) (-2480.110) [-2470.454] -- 0:05:52 46500 -- (-2475.926) (-2472.008) (-2463.792) [-2464.173] * [-2473.415] (-2477.531) (-2471.611) (-2475.655) -- 0:06:09 47000 -- (-2482.456) (-2483.439) (-2474.872) [-2474.422] * (-2480.159) [-2466.394] (-2472.090) (-2484.887) -- 0:06:04 47500 -- [-2472.157] (-2479.020) (-2480.006) (-2475.662) * (-2480.809) [-2466.299] (-2471.500) (-2476.350) -- 0:06:00 48000 -- (-2469.884) (-2474.860) (-2469.370) [-2481.557] * [-2476.756] (-2482.020) (-2465.787) (-2474.789) -- 0:05:57 48500 -- (-2485.039) (-2468.882) (-2481.937) [-2468.941] * (-2478.539) (-2472.623) (-2485.005) [-2467.934] -- 0:05:53 49000 -- [-2470.602] (-2476.094) (-2480.725) (-2474.302) * (-2468.586) (-2471.509) [-2472.162] (-2474.629) -- 0:05:49 49500 -- (-2472.892) (-2472.511) (-2470.859) [-2471.209] * (-2484.823) [-2470.613] (-2469.477) (-2477.561) -- 0:05:45 50000 -- [-2484.526] (-2474.583) (-2480.265) (-2480.793) * [-2480.305] (-2472.780) (-2482.581) (-2492.840) -- 0:06:01 Average standard deviation of split frequencies: 0.040317 50500 -- [-2477.674] (-2482.346) (-2472.808) (-2476.725) * (-2481.791) (-2482.055) (-2483.990) [-2475.396] -- 0:05:57 51000 -- (-2466.929) (-2473.895) [-2475.607] (-2476.213) * [-2472.025] (-2480.434) (-2475.043) (-2470.857) -- 0:05:53 51500 -- [-2474.391] (-2477.806) (-2488.866) (-2470.337) * (-2482.781) [-2474.342] (-2476.805) (-2478.146) -- 0:05:49 52000 -- (-2477.851) [-2470.964] (-2494.208) (-2472.955) * (-2478.284) (-2467.195) [-2478.174] (-2483.670) -- 0:05:46 52500 -- (-2491.493) (-2477.511) (-2478.923) [-2470.871] * (-2471.798) (-2477.694) [-2477.774] (-2467.969) -- 0:05:42 53000 -- (-2487.959) [-2471.313] (-2482.242) (-2463.207) * [-2467.761] (-2478.889) (-2475.617) (-2477.147) -- 0:05:57 53500 -- [-2471.176] (-2479.514) (-2477.712) (-2457.585) * (-2481.493) (-2478.405) (-2475.844) [-2467.905] -- 0:05:53 54000 -- (-2467.955) (-2480.472) [-2477.713] (-2474.907) * (-2483.746) [-2475.497] (-2478.110) (-2484.683) -- 0:05:50 54500 -- [-2475.491] (-2485.081) (-2474.575) (-2468.481) * (-2479.723) [-2479.638] (-2477.403) (-2469.746) -- 0:05:46 55000 -- (-2465.629) (-2473.111) [-2472.462] (-2473.845) * (-2472.086) (-2485.014) (-2471.972) [-2479.032] -- 0:05:43 Average standard deviation of split frequencies: 0.042616 55500 -- (-2479.422) (-2471.216) (-2483.177) [-2478.388] * (-2479.771) [-2466.363] (-2474.661) (-2478.039) -- 0:05:57 56000 -- (-2481.101) (-2474.704) [-2468.063] (-2484.262) * (-2483.396) (-2477.146) (-2481.890) [-2468.678] -- 0:05:54 56500 -- [-2470.487] (-2468.409) (-2489.806) (-2487.884) * (-2487.539) (-2477.009) [-2475.452] (-2471.713) -- 0:05:50 57000 -- (-2490.772) (-2484.040) [-2467.475] (-2473.956) * (-2474.105) [-2472.994] (-2468.868) (-2486.137) -- 0:05:47 57500 -- (-2486.701) [-2471.561] (-2485.832) (-2469.299) * (-2471.582) (-2473.425) [-2466.654] (-2479.901) -- 0:05:44 58000 -- (-2482.505) [-2467.740] (-2479.259) (-2481.004) * [-2468.414] (-2477.572) (-2473.770) (-2467.958) -- 0:05:41 58500 -- (-2475.033) (-2470.390) (-2481.409) [-2465.477] * [-2467.064] (-2478.578) (-2477.902) (-2474.040) -- 0:05:54 59000 -- (-2482.958) (-2469.410) (-2478.637) [-2469.779] * (-2474.579) [-2469.700] (-2468.224) (-2471.811) -- 0:05:50 59500 -- (-2484.598) (-2473.858) (-2487.257) [-2475.283] * [-2483.178] (-2472.766) (-2475.924) (-2473.857) -- 0:05:47 60000 -- (-2484.120) [-2468.650] (-2477.578) (-2477.498) * (-2473.846) [-2477.128] (-2471.355) (-2474.808) -- 0:05:44 Average standard deviation of split frequencies: 0.042252 60500 -- [-2482.725] (-2487.054) (-2485.415) (-2477.656) * (-2475.337) (-2478.366) [-2463.845] (-2476.883) -- 0:05:41 61000 -- (-2471.043) (-2473.516) (-2475.634) [-2462.878] * (-2480.740) [-2477.940] (-2464.749) (-2468.318) -- 0:05:54 61500 -- (-2470.230) (-2466.076) [-2473.954] (-2475.772) * (-2476.793) [-2474.733] (-2473.249) (-2475.597) -- 0:05:50 62000 -- (-2482.696) (-2483.079) [-2473.948] (-2467.639) * [-2467.820] (-2478.667) (-2481.641) (-2474.311) -- 0:05:47 62500 -- (-2480.347) (-2481.000) [-2471.919] (-2479.584) * (-2473.502) [-2468.352] (-2474.776) (-2477.814) -- 0:05:45 63000 -- [-2484.130] (-2479.239) (-2474.138) (-2496.652) * [-2471.898] (-2472.959) (-2480.905) (-2478.061) -- 0:05:42 63500 -- (-2484.916) (-2483.294) (-2484.211) [-2479.742] * (-2490.087) [-2475.199] (-2472.573) (-2469.352) -- 0:05:39 64000 -- (-2479.478) (-2474.652) [-2486.765] (-2481.930) * [-2474.772] (-2476.098) (-2479.699) (-2482.455) -- 0:05:51 64500 -- [-2488.199] (-2467.649) (-2477.073) (-2479.883) * (-2476.881) (-2478.157) [-2467.561] (-2485.481) -- 0:05:48 65000 -- [-2476.672] (-2481.464) (-2489.212) (-2488.839) * (-2482.673) (-2485.692) [-2466.773] (-2475.067) -- 0:05:45 Average standard deviation of split frequencies: 0.037052 65500 -- (-2466.902) (-2477.802) (-2481.812) [-2472.808] * (-2485.207) (-2479.051) (-2474.770) [-2473.302] -- 0:05:42 66000 -- [-2471.534] (-2480.951) (-2470.467) (-2473.690) * (-2474.588) [-2480.967] (-2484.032) (-2478.786) -- 0:05:39 66500 -- (-2473.970) (-2470.516) [-2474.476] (-2477.855) * (-2483.539) [-2471.748] (-2487.938) (-2482.517) -- 0:05:36 67000 -- (-2487.862) [-2475.613] (-2482.303) (-2476.013) * (-2477.109) (-2478.431) (-2491.659) [-2482.809] -- 0:05:48 67500 -- (-2489.813) (-2472.281) [-2470.382] (-2494.994) * (-2469.135) [-2471.215] (-2503.696) (-2484.234) -- 0:05:45 68000 -- (-2494.302) (-2478.391) [-2472.146] (-2487.529) * [-2470.640] (-2472.951) (-2484.733) (-2477.507) -- 0:05:42 68500 -- (-2481.119) [-2471.404] (-2472.660) (-2472.535) * (-2471.877) [-2473.316] (-2482.574) (-2493.433) -- 0:05:39 69000 -- (-2488.564) [-2478.723] (-2483.923) (-2483.459) * [-2471.176] (-2480.606) (-2482.299) (-2476.695) -- 0:05:37 69500 -- (-2491.563) [-2483.713] (-2479.318) (-2468.595) * (-2475.541) [-2481.155] (-2481.905) (-2468.771) -- 0:05:34 70000 -- (-2489.248) (-2471.280) [-2478.557] (-2477.833) * (-2468.930) (-2478.003) (-2489.785) [-2469.781] -- 0:05:45 Average standard deviation of split frequencies: 0.034605 70500 -- (-2472.943) (-2471.614) (-2476.043) [-2464.297] * (-2472.035) (-2478.561) (-2494.746) [-2477.327] -- 0:05:42 71000 -- (-2478.956) (-2476.707) (-2470.108) [-2469.254] * (-2478.044) [-2474.426] (-2481.133) (-2478.893) -- 0:05:40 71500 -- (-2478.142) (-2483.554) [-2475.648] (-2476.560) * (-2472.599) (-2484.763) (-2471.972) [-2472.093] -- 0:05:37 72000 -- (-2477.780) (-2487.181) (-2496.483) [-2471.596] * [-2479.806] (-2480.924) (-2483.295) (-2475.630) -- 0:05:35 72500 -- (-2470.707) (-2475.539) (-2478.505) [-2465.895] * [-2473.597] (-2484.804) (-2481.198) (-2480.046) -- 0:05:32 73000 -- (-2478.277) (-2474.137) (-2481.105) [-2481.273] * (-2481.050) (-2482.081) (-2481.923) [-2466.024] -- 0:05:30 73500 -- [-2468.090] (-2470.576) (-2470.665) (-2472.465) * (-2474.217) (-2498.551) (-2478.999) [-2471.948] -- 0:05:40 74000 -- [-2470.388] (-2465.530) (-2474.383) (-2489.459) * (-2473.219) [-2477.970] (-2477.800) (-2468.330) -- 0:05:37 74500 -- [-2470.571] (-2467.698) (-2477.607) (-2477.967) * (-2477.818) (-2481.468) (-2480.957) [-2468.800] -- 0:05:35 75000 -- (-2487.022) [-2478.417] (-2476.563) (-2469.009) * (-2482.065) (-2479.292) (-2468.654) [-2478.194] -- 0:05:33 Average standard deviation of split frequencies: 0.029075 75500 -- (-2477.422) (-2488.825) [-2478.490] (-2471.889) * (-2475.366) (-2488.053) [-2470.899] (-2470.835) -- 0:05:30 76000 -- [-2477.000] (-2468.364) (-2483.202) (-2479.728) * (-2485.134) (-2480.368) (-2481.797) [-2468.474] -- 0:05:28 76500 -- [-2475.827] (-2472.170) (-2489.115) (-2481.020) * (-2465.871) (-2465.598) (-2479.713) [-2473.952] -- 0:05:38 77000 -- (-2479.886) [-2472.577] (-2481.153) (-2479.200) * (-2467.269) [-2465.130] (-2489.372) (-2475.354) -- 0:05:35 77500 -- [-2474.544] (-2475.422) (-2478.082) (-2491.518) * [-2477.595] (-2478.192) (-2469.140) (-2475.952) -- 0:05:33 78000 -- (-2478.950) [-2465.959] (-2499.666) (-2490.033) * (-2477.427) (-2476.769) [-2467.527] (-2474.249) -- 0:05:30 78500 -- (-2491.588) (-2466.835) [-2471.194] (-2483.746) * (-2473.087) (-2471.031) (-2472.381) [-2467.869] -- 0:05:28 79000 -- (-2472.929) (-2473.603) [-2471.589] (-2485.905) * (-2480.019) (-2470.043) (-2478.852) [-2470.223] -- 0:05:26 79500 -- [-2473.010] (-2488.498) (-2467.685) (-2483.314) * (-2490.123) (-2474.044) (-2473.849) [-2467.321] -- 0:05:24 80000 -- (-2475.652) [-2469.287] (-2474.403) (-2484.561) * [-2481.582] (-2474.099) (-2471.865) (-2478.323) -- 0:05:33 Average standard deviation of split frequencies: 0.026882 80500 -- [-2469.118] (-2472.776) (-2474.552) (-2484.971) * (-2477.977) (-2476.526) [-2475.423] (-2481.912) -- 0:05:31 81000 -- (-2465.714) (-2476.741) [-2467.827] (-2483.433) * (-2483.503) [-2474.704] (-2477.453) (-2471.810) -- 0:05:29 81500 -- [-2464.841] (-2487.688) (-2468.748) (-2482.500) * (-2485.372) [-2476.550] (-2482.054) (-2474.100) -- 0:05:26 82000 -- (-2466.399) (-2487.329) [-2467.722] (-2480.256) * (-2476.042) (-2475.809) [-2471.395] (-2478.505) -- 0:05:24 82500 -- (-2483.223) (-2490.386) [-2464.097] (-2472.454) * (-2480.786) (-2468.146) [-2470.806] (-2473.201) -- 0:05:22 83000 -- (-2486.120) [-2484.915] (-2479.238) (-2469.132) * (-2487.030) (-2484.421) [-2470.461] (-2484.688) -- 0:05:31 83500 -- (-2470.848) (-2475.843) [-2468.597] (-2480.613) * (-2470.866) [-2470.759] (-2475.166) (-2480.105) -- 0:05:29 84000 -- (-2483.874) (-2490.817) [-2466.229] (-2472.076) * (-2471.531) (-2487.897) (-2476.098) [-2471.847] -- 0:05:27 84500 -- (-2473.540) (-2482.366) [-2466.341] (-2476.990) * (-2473.823) [-2467.809] (-2471.086) (-2487.762) -- 0:05:25 85000 -- (-2481.991) (-2485.397) [-2475.685] (-2476.294) * (-2473.489) (-2471.448) [-2473.059] (-2475.681) -- 0:05:22 Average standard deviation of split frequencies: 0.026676 85500 -- (-2478.274) (-2479.733) [-2476.972] (-2479.295) * (-2471.537) [-2473.396] (-2473.924) (-2478.889) -- 0:05:20 86000 -- [-2477.990] (-2475.299) (-2476.949) (-2485.820) * (-2484.415) [-2473.299] (-2469.750) (-2472.842) -- 0:05:18 86500 -- [-2476.989] (-2481.071) (-2473.254) (-2489.070) * (-2490.462) (-2476.320) [-2473.846] (-2470.864) -- 0:05:27 87000 -- (-2474.372) (-2482.065) [-2477.614] (-2481.565) * (-2476.335) (-2476.678) (-2475.024) [-2475.214] -- 0:05:25 87500 -- (-2484.825) [-2472.791] (-2478.824) (-2477.733) * (-2484.444) (-2476.186) (-2494.575) [-2476.160] -- 0:05:23 88000 -- (-2476.574) (-2488.407) [-2468.783] (-2474.800) * [-2475.258] (-2481.670) (-2486.455) (-2474.365) -- 0:05:21 88500 -- [-2476.239] (-2491.104) (-2477.636) (-2476.371) * (-2493.924) (-2482.327) (-2491.226) [-2469.178] -- 0:05:19 89000 -- (-2475.837) (-2478.791) [-2468.192] (-2485.012) * (-2473.161) (-2486.926) (-2479.647) [-2477.479] -- 0:05:17 89500 -- [-2470.842] (-2481.217) (-2470.070) (-2474.874) * (-2475.934) (-2478.097) [-2466.490] (-2469.925) -- 0:05:25 90000 -- [-2476.980] (-2473.350) (-2480.896) (-2484.031) * (-2488.423) (-2479.490) (-2462.846) [-2478.285] -- 0:05:23 Average standard deviation of split frequencies: 0.027383 90500 -- [-2475.313] (-2484.572) (-2473.824) (-2490.610) * (-2479.581) (-2468.323) [-2473.007] (-2482.078) -- 0:05:21 91000 -- (-2478.959) [-2472.240] (-2477.545) (-2484.414) * (-2478.479) (-2472.665) [-2468.925] (-2465.346) -- 0:05:19 91500 -- (-2468.176) (-2479.079) [-2474.953] (-2468.022) * (-2483.887) (-2466.181) [-2467.971] (-2473.212) -- 0:05:17 92000 -- (-2463.008) (-2476.564) (-2490.352) [-2474.116] * (-2475.227) [-2478.764] (-2472.387) (-2465.913) -- 0:05:15 92500 -- [-2473.099] (-2503.979) (-2502.732) (-2476.834) * (-2486.881) (-2487.284) (-2469.198) [-2467.384] -- 0:05:23 93000 -- [-2464.332] (-2479.873) (-2485.829) (-2494.261) * (-2476.707) (-2487.570) (-2489.648) [-2465.687] -- 0:05:21 93500 -- [-2470.644] (-2471.713) (-2481.792) (-2480.705) * (-2470.518) [-2483.857] (-2484.173) (-2474.950) -- 0:05:19 94000 -- [-2472.111] (-2488.183) (-2472.566) (-2476.799) * (-2488.059) (-2487.197) (-2481.499) [-2466.264] -- 0:05:18 94500 -- (-2476.079) (-2470.971) (-2477.515) [-2473.841] * (-2475.905) (-2479.797) (-2480.749) [-2470.533] -- 0:05:16 95000 -- (-2475.954) [-2474.471] (-2474.393) (-2476.255) * [-2473.841] (-2474.917) (-2486.116) (-2469.150) -- 0:05:14 Average standard deviation of split frequencies: 0.023243 95500 -- (-2491.384) (-2487.152) (-2472.607) [-2478.784] * [-2471.213] (-2477.452) (-2468.067) (-2478.271) -- 0:05:12 96000 -- (-2471.422) (-2480.818) [-2478.873] (-2468.549) * [-2478.237] (-2488.424) (-2472.376) (-2470.884) -- 0:05:20 96500 -- (-2479.551) (-2481.845) (-2468.553) [-2462.854] * [-2471.135] (-2478.437) (-2476.905) (-2476.863) -- 0:05:18 97000 -- (-2476.843) (-2473.652) (-2476.302) [-2467.616] * [-2467.482] (-2482.311) (-2478.957) (-2472.772) -- 0:05:16 97500 -- (-2476.803) (-2471.237) [-2470.776] (-2470.881) * [-2470.539] (-2477.863) (-2476.415) (-2472.368) -- 0:05:14 98000 -- [-2472.974] (-2467.231) (-2480.115) (-2473.642) * (-2475.132) (-2467.175) [-2481.236] (-2475.891) -- 0:05:12 98500 -- (-2470.568) (-2477.484) [-2468.803] (-2480.234) * (-2466.862) [-2464.516] (-2476.061) (-2481.115) -- 0:05:11 99000 -- [-2473.029] (-2467.427) (-2474.252) (-2474.955) * [-2468.430] (-2468.209) (-2478.837) (-2476.626) -- 0:05:18 99500 -- (-2475.230) [-2473.865] (-2478.905) (-2470.929) * (-2481.982) (-2479.940) (-2473.416) [-2470.142] -- 0:05:16 100000 -- [-2479.423] (-2474.612) (-2469.881) (-2481.562) * (-2481.015) (-2477.005) (-2469.254) [-2474.771] -- 0:05:15 Average standard deviation of split frequencies: 0.021853 100500 -- (-2481.072) (-2471.021) [-2466.777] (-2485.538) * (-2476.443) [-2472.110] (-2478.438) (-2473.714) -- 0:05:13 101000 -- (-2476.369) (-2474.411) [-2476.715] (-2477.853) * (-2478.705) (-2481.513) [-2476.183] (-2473.775) -- 0:05:11 101500 -- (-2474.394) (-2489.419) [-2468.729] (-2477.991) * (-2475.320) [-2478.504] (-2475.877) (-2477.856) -- 0:05:09 102000 -- (-2494.373) [-2475.320] (-2466.071) (-2481.701) * (-2469.950) [-2471.426] (-2473.973) (-2478.382) -- 0:05:08 102500 -- (-2478.787) (-2480.329) (-2470.098) [-2470.218] * (-2488.154) (-2479.282) [-2476.831] (-2483.900) -- 0:05:15 103000 -- (-2484.654) (-2476.947) (-2471.500) [-2476.974] * [-2471.483] (-2481.722) (-2472.687) (-2465.346) -- 0:05:13 103500 -- (-2476.264) [-2473.764] (-2475.912) (-2470.557) * (-2468.728) (-2482.711) [-2473.473] (-2471.242) -- 0:05:11 104000 -- [-2474.732] (-2482.303) (-2476.231) (-2477.072) * (-2468.533) [-2478.887] (-2469.662) (-2477.883) -- 0:05:10 104500 -- (-2469.227) (-2476.738) [-2471.872] (-2485.781) * (-2478.219) (-2481.805) (-2480.719) [-2473.334] -- 0:05:08 105000 -- (-2469.353) (-2481.658) (-2472.473) [-2472.148] * (-2482.889) (-2477.556) (-2481.449) [-2463.379] -- 0:05:06 Average standard deviation of split frequencies: 0.021050 105500 -- (-2475.049) [-2484.792] (-2477.683) (-2469.815) * (-2479.000) (-2472.682) [-2471.982] (-2477.863) -- 0:05:13 106000 -- (-2478.932) (-2476.780) (-2488.773) [-2463.932] * (-2482.652) (-2473.301) (-2489.127) [-2478.335] -- 0:05:12 106500 -- (-2469.570) (-2486.701) (-2482.496) [-2468.491] * (-2486.312) (-2485.852) [-2479.186] (-2481.098) -- 0:05:10 107000 -- (-2472.392) [-2475.962] (-2485.429) (-2471.013) * (-2475.456) (-2480.815) (-2475.929) [-2468.822] -- 0:05:08 107500 -- [-2470.523] (-2474.414) (-2478.874) (-2471.215) * [-2471.331] (-2480.458) (-2470.337) (-2486.160) -- 0:05:07 108000 -- (-2483.691) (-2479.820) (-2478.280) [-2473.992] * (-2473.655) (-2483.711) (-2472.381) [-2466.823] -- 0:05:05 108500 -- (-2486.690) (-2471.203) [-2475.669] (-2474.067) * (-2472.271) (-2479.577) (-2476.599) [-2473.527] -- 0:05:12 109000 -- (-2477.285) (-2481.197) [-2472.836] (-2469.796) * (-2479.389) (-2486.051) (-2487.663) [-2474.732] -- 0:05:10 109500 -- [-2471.451] (-2496.088) (-2473.473) (-2466.938) * [-2481.435] (-2471.381) (-2477.485) (-2484.051) -- 0:05:09 110000 -- (-2476.339) (-2487.817) [-2478.430] (-2471.387) * (-2468.321) (-2473.994) [-2463.593] (-2480.583) -- 0:05:07 Average standard deviation of split frequencies: 0.020446 110500 -- (-2471.083) (-2484.088) [-2477.259] (-2478.883) * [-2467.358] (-2473.695) (-2470.358) (-2472.176) -- 0:05:05 111000 -- (-2473.836) [-2473.159] (-2485.700) (-2478.777) * (-2471.908) (-2486.797) [-2472.775] (-2481.672) -- 0:05:04 111500 -- (-2477.582) (-2466.261) [-2485.966] (-2478.176) * (-2470.504) (-2492.865) (-2466.217) [-2472.616] -- 0:05:02 112000 -- (-2472.673) (-2464.345) (-2485.941) [-2467.402] * (-2482.039) [-2470.743] (-2467.037) (-2477.921) -- 0:05:09 112500 -- (-2472.999) [-2473.273] (-2482.129) (-2477.352) * (-2481.270) (-2486.396) [-2473.383] (-2480.127) -- 0:05:07 113000 -- [-2469.572] (-2475.946) (-2477.935) (-2481.376) * (-2484.074) (-2469.009) [-2465.814] (-2474.749) -- 0:05:06 113500 -- (-2472.434) (-2489.670) [-2473.921] (-2483.229) * (-2471.835) (-2479.353) (-2470.664) [-2475.697] -- 0:05:04 114000 -- [-2483.575] (-2478.928) (-2486.551) (-2483.641) * (-2477.614) (-2496.389) (-2470.616) [-2473.326] -- 0:05:03 114500 -- [-2465.905] (-2484.466) (-2484.257) (-2482.141) * (-2469.150) (-2482.838) [-2470.824] (-2492.505) -- 0:05:09 115000 -- (-2466.430) (-2473.571) [-2473.202] (-2473.589) * (-2471.071) (-2474.168) [-2472.088] (-2481.489) -- 0:05:07 Average standard deviation of split frequencies: 0.018287 115500 -- (-2471.962) [-2473.003] (-2486.171) (-2484.238) * [-2474.574] (-2486.068) (-2469.716) (-2484.004) -- 0:05:06 116000 -- (-2470.286) (-2475.421) [-2481.076] (-2482.498) * (-2480.476) (-2474.145) (-2473.976) [-2471.151] -- 0:05:04 116500 -- [-2468.231] (-2471.249) (-2482.974) (-2474.882) * (-2475.200) (-2478.000) [-2475.365] (-2484.245) -- 0:05:03 117000 -- (-2466.671) (-2486.626) (-2479.012) [-2467.230] * (-2471.640) (-2468.839) [-2467.532] (-2482.212) -- 0:05:01 117500 -- [-2464.915] (-2463.992) (-2480.001) (-2482.208) * (-2474.561) (-2478.647) (-2479.220) [-2473.466] -- 0:05:07 118000 -- [-2473.539] (-2485.817) (-2467.653) (-2474.874) * (-2475.383) [-2478.879] (-2474.469) (-2484.431) -- 0:05:06 118500 -- (-2474.340) (-2480.431) [-2469.985] (-2482.280) * (-2473.586) [-2473.425] (-2483.022) (-2491.977) -- 0:05:04 119000 -- [-2473.478] (-2474.621) (-2472.355) (-2470.898) * (-2475.837) (-2485.511) [-2472.651] (-2483.284) -- 0:05:03 119500 -- [-2470.259] (-2468.884) (-2474.197) (-2479.206) * [-2476.084] (-2471.490) (-2481.318) (-2476.355) -- 0:05:02 120000 -- [-2472.881] (-2472.178) (-2472.351) (-2489.600) * [-2475.426] (-2476.738) (-2468.682) (-2488.609) -- 0:05:00 Average standard deviation of split frequencies: 0.016603 120500 -- [-2475.773] (-2472.625) (-2484.957) (-2472.150) * (-2471.886) (-2479.361) [-2477.711] (-2475.056) -- 0:05:06 121000 -- (-2483.024) (-2479.624) (-2480.780) [-2470.489] * (-2478.873) [-2478.864] (-2487.885) (-2478.254) -- 0:05:05 121500 -- [-2473.706] (-2477.096) (-2475.612) (-2479.762) * (-2485.822) (-2480.527) (-2482.977) [-2485.503] -- 0:05:03 122000 -- [-2472.159] (-2471.193) (-2473.840) (-2486.876) * [-2469.778] (-2471.171) (-2494.408) (-2474.814) -- 0:05:02 122500 -- [-2470.259] (-2462.825) (-2484.943) (-2488.101) * [-2473.695] (-2477.978) (-2480.676) (-2475.630) -- 0:05:00 123000 -- [-2464.367] (-2480.878) (-2485.259) (-2477.603) * (-2486.595) (-2480.559) [-2476.820] (-2484.851) -- 0:04:59 123500 -- (-2488.576) (-2476.760) (-2494.987) [-2469.006] * (-2477.768) [-2480.359] (-2474.706) (-2475.072) -- 0:04:58 124000 -- (-2479.025) (-2492.202) (-2490.424) [-2479.452] * (-2477.473) (-2475.714) (-2483.565) [-2470.371] -- 0:05:03 124500 -- (-2475.165) (-2484.191) [-2482.856] (-2489.537) * [-2473.394] (-2474.182) (-2467.721) (-2472.045) -- 0:05:02 125000 -- (-2489.509) (-2476.717) (-2474.479) [-2466.934] * (-2474.066) (-2476.207) [-2477.530] (-2470.706) -- 0:05:01 Average standard deviation of split frequencies: 0.015667 125500 -- (-2488.532) [-2480.440] (-2472.094) (-2477.416) * (-2475.995) (-2482.835) [-2479.447] (-2473.540) -- 0:04:59 126000 -- [-2475.132] (-2486.495) (-2473.611) (-2477.538) * (-2482.680) (-2477.218) (-2476.048) [-2475.141] -- 0:04:58 126500 -- (-2476.470) (-2482.223) [-2487.234] (-2482.144) * [-2471.935] (-2482.913) (-2486.095) (-2482.631) -- 0:04:56 127000 -- (-2486.372) (-2475.918) [-2471.402] (-2483.596) * (-2471.661) [-2474.411] (-2477.523) (-2480.356) -- 0:05:02 127500 -- [-2470.325] (-2472.203) (-2465.193) (-2475.832) * (-2476.163) (-2479.987) (-2473.895) [-2472.426] -- 0:05:01 128000 -- (-2466.780) (-2474.014) (-2469.932) [-2469.069] * (-2477.930) [-2468.278] (-2480.200) (-2479.808) -- 0:04:59 128500 -- [-2467.617] (-2468.885) (-2488.030) (-2474.798) * (-2474.938) [-2474.416] (-2478.415) (-2491.860) -- 0:04:58 129000 -- (-2476.383) (-2482.445) [-2471.750] (-2480.826) * (-2469.226) (-2488.316) (-2470.062) [-2474.464] -- 0:04:57 129500 -- (-2484.300) (-2489.954) (-2472.908) [-2472.148] * (-2472.190) (-2481.642) [-2468.961] (-2475.086) -- 0:04:55 130000 -- (-2479.147) (-2476.103) [-2472.883] (-2480.813) * (-2466.422) (-2484.817) (-2472.839) [-2473.824] -- 0:04:54 Average standard deviation of split frequencies: 0.019000 130500 -- [-2476.443] (-2480.027) (-2475.558) (-2479.715) * [-2471.850] (-2486.007) (-2476.828) (-2481.860) -- 0:04:59 131000 -- [-2478.102] (-2482.350) (-2472.770) (-2481.989) * (-2468.967) (-2472.925) (-2477.805) [-2469.109] -- 0:04:58 131500 -- (-2472.905) [-2469.138] (-2480.677) (-2478.402) * (-2477.245) (-2473.777) (-2477.870) [-2465.036] -- 0:04:57 132000 -- (-2472.836) [-2466.631] (-2491.146) (-2480.795) * (-2491.039) (-2474.497) (-2475.824) [-2476.920] -- 0:04:55 132500 -- (-2469.546) (-2477.635) [-2476.158] (-2479.126) * [-2478.925] (-2481.829) (-2469.936) (-2485.539) -- 0:04:54 133000 -- [-2474.579] (-2469.353) (-2477.087) (-2479.536) * [-2465.195] (-2467.622) (-2475.069) (-2469.404) -- 0:04:53 133500 -- (-2480.461) [-2485.316] (-2481.508) (-2475.062) * (-2482.471) (-2476.792) [-2476.453] (-2476.181) -- 0:04:58 134000 -- [-2478.059] (-2465.738) (-2478.390) (-2484.849) * (-2482.085) (-2476.124) (-2485.970) [-2471.329] -- 0:04:57 134500 -- (-2479.947) [-2471.147] (-2477.376) (-2491.941) * (-2491.319) [-2470.778] (-2477.926) (-2480.607) -- 0:04:56 135000 -- [-2466.083] (-2481.080) (-2473.917) (-2478.258) * [-2480.659] (-2476.102) (-2478.758) (-2489.901) -- 0:04:54 Average standard deviation of split frequencies: 0.018414 135500 -- (-2476.284) (-2474.689) [-2466.589] (-2466.272) * [-2471.911] (-2473.460) (-2468.989) (-2473.231) -- 0:04:53 136000 -- (-2481.493) [-2473.170] (-2469.187) (-2469.041) * (-2475.775) (-2478.903) [-2475.753] (-2484.783) -- 0:04:52 136500 -- (-2488.153) (-2472.974) [-2474.024] (-2485.996) * [-2470.859] (-2486.785) (-2470.517) (-2475.002) -- 0:04:50 137000 -- (-2485.398) (-2483.810) (-2480.995) [-2469.182] * [-2479.062] (-2488.118) (-2479.078) (-2489.520) -- 0:04:56 137500 -- (-2475.097) (-2480.572) (-2478.127) [-2470.496] * (-2489.887) (-2473.841) (-2468.468) [-2474.992] -- 0:04:54 138000 -- (-2480.710) [-2473.809] (-2473.643) (-2477.058) * (-2475.743) (-2472.125) [-2466.488] (-2479.089) -- 0:04:53 138500 -- (-2486.219) (-2483.655) (-2478.861) [-2470.462] * (-2483.332) (-2483.818) (-2477.237) [-2473.334] -- 0:04:52 139000 -- [-2471.316] (-2484.012) (-2476.989) (-2473.481) * [-2475.348] (-2483.798) (-2480.036) (-2474.941) -- 0:04:51 139500 -- (-2489.583) (-2482.978) [-2483.245] (-2470.966) * [-2480.214] (-2485.007) (-2488.538) (-2481.124) -- 0:04:49 140000 -- (-2480.150) [-2475.621] (-2485.269) (-2484.237) * (-2478.279) (-2475.391) (-2487.341) [-2478.802] -- 0:04:54 Average standard deviation of split frequencies: 0.018097 140500 -- (-2468.814) (-2475.635) (-2483.734) [-2468.676] * [-2468.378] (-2485.278) (-2485.584) (-2468.128) -- 0:04:53 141000 -- (-2479.739) (-2481.812) (-2483.971) [-2478.182] * (-2469.859) (-2484.095) (-2476.509) [-2471.173] -- 0:04:52 141500 -- (-2468.898) [-2486.281] (-2484.391) (-2474.243) * (-2476.700) [-2468.987] (-2482.182) (-2476.184) -- 0:04:51 142000 -- (-2474.784) (-2468.379) [-2469.779] (-2470.947) * (-2473.278) [-2469.342] (-2487.573) (-2486.459) -- 0:04:50 142500 -- (-2482.996) [-2475.823] (-2473.389) (-2463.511) * [-2474.865] (-2474.205) (-2474.946) (-2473.965) -- 0:04:48 143000 -- (-2483.160) (-2483.596) (-2483.699) [-2480.951] * (-2482.778) (-2464.548) [-2473.849] (-2476.832) -- 0:04:47 143500 -- [-2474.156] (-2477.458) (-2481.197) (-2468.133) * (-2467.586) [-2474.882] (-2479.865) (-2477.272) -- 0:04:52 144000 -- (-2480.399) [-2469.112] (-2469.374) (-2474.970) * [-2467.022] (-2470.325) (-2471.619) (-2486.883) -- 0:04:51 144500 -- (-2477.304) [-2470.914] (-2469.905) (-2485.245) * (-2470.333) [-2478.383] (-2476.670) (-2475.271) -- 0:04:50 145000 -- (-2473.261) (-2470.699) [-2463.088] (-2476.262) * (-2481.421) (-2485.986) (-2483.939) [-2464.882] -- 0:04:48 Average standard deviation of split frequencies: 0.017758 145500 -- (-2475.944) [-2466.765] (-2466.970) (-2473.784) * (-2473.385) (-2484.690) (-2480.899) [-2481.426] -- 0:04:47 146000 -- [-2471.393] (-2473.510) (-2478.661) (-2482.049) * (-2470.893) [-2471.211] (-2482.409) (-2475.128) -- 0:04:46 146500 -- (-2468.765) [-2472.424] (-2474.376) (-2476.586) * [-2470.908] (-2464.398) (-2494.726) (-2475.239) -- 0:04:51 147000 -- (-2475.950) (-2473.361) [-2472.100] (-2481.289) * [-2478.587] (-2473.237) (-2480.963) (-2476.454) -- 0:04:50 147500 -- (-2480.129) (-2484.081) [-2472.580] (-2476.564) * [-2470.054] (-2475.405) (-2473.553) (-2476.401) -- 0:04:48 148000 -- [-2470.223] (-2475.974) (-2486.819) (-2476.749) * (-2476.933) (-2474.179) [-2472.884] (-2465.419) -- 0:04:47 148500 -- (-2469.995) (-2486.167) [-2466.655] (-2484.716) * (-2474.323) (-2477.203) (-2481.061) [-2479.765] -- 0:04:46 149000 -- (-2484.722) (-2482.258) [-2475.790] (-2477.987) * (-2484.344) (-2474.008) (-2492.490) [-2477.932] -- 0:04:45 149500 -- (-2473.568) (-2469.562) [-2467.380] (-2471.676) * [-2464.785] (-2467.626) (-2473.676) (-2477.385) -- 0:04:44 150000 -- (-2490.556) (-2492.703) [-2466.114] (-2489.583) * (-2478.124) (-2474.937) [-2480.083] (-2477.042) -- 0:04:49 Average standard deviation of split frequencies: 0.015840 150500 -- (-2474.531) (-2485.333) [-2469.521] (-2467.478) * (-2474.630) [-2467.970] (-2470.667) (-2477.421) -- 0:04:47 151000 -- (-2488.591) (-2467.569) (-2468.927) [-2469.050] * (-2471.199) (-2480.705) [-2476.271] (-2479.194) -- 0:04:46 151500 -- (-2474.954) (-2475.910) (-2473.983) [-2473.134] * (-2487.832) (-2477.661) (-2471.297) [-2475.466] -- 0:04:45 152000 -- (-2476.649) (-2486.469) [-2474.230] (-2482.542) * [-2480.057] (-2490.714) (-2471.365) (-2472.016) -- 0:04:44 152500 -- (-2483.553) (-2484.674) [-2471.619] (-2480.315) * (-2471.028) (-2477.143) (-2473.155) [-2472.371] -- 0:04:43 153000 -- [-2479.044] (-2469.515) (-2471.104) (-2472.261) * [-2475.212] (-2469.888) (-2475.785) (-2485.192) -- 0:04:47 153500 -- (-2482.542) (-2472.920) [-2468.564] (-2480.245) * (-2476.409) [-2477.833] (-2486.136) (-2475.894) -- 0:04:46 154000 -- (-2481.391) (-2474.560) (-2471.861) [-2481.097] * (-2471.038) [-2476.173] (-2484.393) (-2494.440) -- 0:04:45 154500 -- (-2474.460) [-2469.181] (-2471.869) (-2494.473) * (-2472.022) [-2475.061] (-2479.712) (-2482.513) -- 0:04:44 155000 -- (-2476.159) [-2470.387] (-2470.952) (-2489.847) * (-2477.227) (-2482.838) (-2472.903) [-2473.846] -- 0:04:43 Average standard deviation of split frequencies: 0.014731 155500 -- [-2466.693] (-2479.109) (-2471.822) (-2489.173) * (-2479.161) [-2466.138] (-2477.731) (-2482.988) -- 0:04:42 156000 -- [-2477.618] (-2475.878) (-2479.039) (-2487.349) * (-2469.733) (-2466.932) (-2484.529) [-2464.707] -- 0:04:41 156500 -- (-2480.363) (-2478.257) (-2475.914) [-2476.508] * (-2477.037) (-2478.623) (-2471.299) [-2477.409] -- 0:04:45 157000 -- [-2464.899] (-2484.319) (-2474.057) (-2470.559) * [-2474.650] (-2480.143) (-2467.430) (-2472.712) -- 0:04:44 157500 -- (-2486.776) [-2473.859] (-2473.207) (-2481.855) * (-2483.393) (-2478.503) (-2473.840) [-2465.388] -- 0:04:43 158000 -- (-2472.389) [-2468.202] (-2468.135) (-2468.592) * [-2472.817] (-2482.162) (-2476.139) (-2477.121) -- 0:04:42 158500 -- (-2463.609) [-2468.890] (-2471.995) (-2478.380) * (-2481.106) [-2478.335] (-2477.567) (-2480.611) -- 0:04:41 159000 -- (-2479.563) (-2477.168) [-2474.317] (-2470.404) * (-2468.612) [-2473.399] (-2471.245) (-2482.819) -- 0:04:40 159500 -- (-2476.832) (-2474.876) (-2495.615) [-2470.506] * (-2471.834) (-2481.477) [-2475.315] (-2473.227) -- 0:04:44 160000 -- (-2483.063) (-2478.576) [-2471.607] (-2469.146) * [-2469.127] (-2468.905) (-2475.896) (-2490.816) -- 0:04:43 Average standard deviation of split frequencies: 0.015404 160500 -- [-2470.550] (-2480.321) (-2476.826) (-2476.732) * (-2479.409) [-2465.649] (-2478.001) (-2492.770) -- 0:04:42 161000 -- (-2484.250) (-2478.269) (-2477.766) [-2472.016] * (-2487.066) (-2474.162) [-2476.761] (-2479.617) -- 0:04:41 161500 -- (-2472.538) (-2478.024) [-2472.768] (-2478.942) * (-2483.395) (-2482.552) [-2477.698] (-2476.751) -- 0:04:40 162000 -- (-2481.799) (-2478.331) (-2473.378) [-2472.183] * (-2487.113) (-2475.578) (-2479.754) [-2477.354] -- 0:04:44 162500 -- (-2472.133) (-2481.261) (-2476.806) [-2471.636] * (-2476.389) [-2473.400] (-2487.381) (-2482.095) -- 0:04:43 163000 -- (-2481.510) (-2484.872) [-2463.573] (-2470.375) * (-2472.405) (-2471.178) [-2487.537] (-2493.002) -- 0:04:42 163500 -- [-2472.733] (-2489.181) (-2474.041) (-2475.703) * (-2472.248) (-2468.885) [-2474.457] (-2481.032) -- 0:04:41 164000 -- [-2471.768] (-2484.334) (-2478.458) (-2472.992) * (-2482.378) (-2470.140) [-2468.520] (-2478.217) -- 0:04:40 164500 -- [-2473.764] (-2472.848) (-2480.068) (-2473.237) * [-2473.678] (-2477.858) (-2474.846) (-2474.646) -- 0:04:39 165000 -- (-2474.732) (-2477.385) [-2472.262] (-2487.190) * (-2464.639) [-2473.915] (-2486.674) (-2483.999) -- 0:04:43 Average standard deviation of split frequencies: 0.015619 165500 -- (-2469.548) [-2475.786] (-2480.095) (-2479.765) * (-2473.483) [-2466.503] (-2472.298) (-2476.702) -- 0:04:42 166000 -- (-2473.345) (-2478.509) (-2467.141) [-2468.322] * (-2481.703) (-2468.910) [-2475.973] (-2469.584) -- 0:04:41 166500 -- [-2473.796] (-2476.261) (-2469.236) (-2473.607) * (-2466.425) (-2475.679) [-2476.455] (-2487.069) -- 0:04:40 167000 -- (-2471.783) (-2484.955) [-2481.963] (-2467.990) * (-2482.081) (-2477.091) [-2473.182] (-2475.631) -- 0:04:39 167500 -- [-2472.400] (-2493.326) (-2475.268) (-2475.415) * (-2467.798) [-2473.661] (-2491.975) (-2478.002) -- 0:04:38 168000 -- [-2477.230] (-2474.839) (-2481.694) (-2481.936) * (-2475.645) [-2477.133] (-2478.700) (-2484.121) -- 0:04:37 168500 -- [-2469.336] (-2480.611) (-2470.175) (-2488.379) * (-2487.827) (-2474.998) (-2479.770) [-2473.270] -- 0:04:41 169000 -- [-2472.977] (-2470.188) (-2477.865) (-2485.848) * (-2472.449) (-2472.795) [-2469.648] (-2476.420) -- 0:04:40 169500 -- (-2477.550) (-2472.859) [-2469.132] (-2486.937) * (-2479.324) [-2465.361] (-2477.002) (-2481.160) -- 0:04:39 170000 -- (-2483.963) (-2488.585) (-2472.662) [-2475.615] * (-2476.966) (-2471.012) [-2468.043] (-2481.581) -- 0:04:38 Average standard deviation of split frequencies: 0.017309 170500 -- (-2470.541) (-2480.263) (-2486.230) [-2474.479] * (-2474.771) [-2475.018] (-2474.012) (-2488.923) -- 0:04:37 171000 -- (-2482.304) (-2482.171) (-2468.765) [-2467.164] * (-2471.897) [-2475.320] (-2478.092) (-2475.996) -- 0:04:36 171500 -- (-2477.581) (-2486.336) [-2471.864] (-2478.296) * (-2481.329) [-2479.780] (-2475.782) (-2471.676) -- 0:04:40 172000 -- (-2483.643) (-2481.151) (-2470.174) [-2467.534] * (-2483.132) (-2477.878) [-2469.858] (-2475.144) -- 0:04:39 172500 -- (-2472.960) [-2464.652] (-2468.111) (-2478.753) * [-2476.229] (-2473.551) (-2470.348) (-2480.849) -- 0:04:38 173000 -- [-2468.880] (-2487.197) (-2470.800) (-2477.332) * [-2470.691] (-2482.433) (-2476.139) (-2480.564) -- 0:04:37 173500 -- (-2472.657) [-2471.980] (-2472.397) (-2479.319) * (-2474.819) (-2471.725) (-2488.802) [-2472.952] -- 0:04:36 174000 -- (-2477.399) [-2467.944] (-2481.388) (-2472.140) * (-2471.926) (-2472.678) (-2480.845) [-2473.114] -- 0:04:35 174500 -- (-2478.754) [-2471.772] (-2474.920) (-2470.227) * (-2476.616) (-2464.625) [-2472.258] (-2477.932) -- 0:04:39 175000 -- (-2474.457) (-2468.216) (-2483.954) [-2478.161] * (-2480.271) (-2475.150) (-2484.335) [-2474.578] -- 0:04:38 Average standard deviation of split frequencies: 0.016071 175500 -- [-2466.232] (-2468.864) (-2483.168) (-2484.845) * (-2475.702) [-2472.878] (-2481.776) (-2470.584) -- 0:04:37 176000 -- [-2470.575] (-2475.077) (-2469.494) (-2475.622) * (-2478.554) (-2473.438) (-2475.572) [-2480.846] -- 0:04:36 176500 -- (-2472.755) [-2472.347] (-2481.933) (-2470.536) * [-2478.301] (-2478.826) (-2481.911) (-2485.670) -- 0:04:35 177000 -- (-2490.062) (-2475.436) (-2484.808) [-2471.026] * [-2477.803] (-2484.392) (-2474.754) (-2475.170) -- 0:04:38 177500 -- (-2476.453) (-2470.053) (-2472.559) [-2463.034] * [-2477.717] (-2479.692) (-2473.196) (-2470.274) -- 0:04:38 178000 -- (-2463.577) (-2480.091) [-2468.857] (-2478.132) * (-2473.255) [-2469.317] (-2486.327) (-2480.885) -- 0:04:37 178500 -- (-2484.536) (-2480.618) [-2469.184] (-2477.648) * [-2472.739] (-2468.274) (-2476.250) (-2482.561) -- 0:04:36 179000 -- (-2476.581) (-2470.997) (-2469.672) [-2481.990] * (-2484.083) [-2468.919] (-2477.811) (-2481.694) -- 0:04:35 179500 -- [-2477.672] (-2483.942) (-2477.986) (-2490.235) * (-2481.052) [-2471.215] (-2474.101) (-2481.751) -- 0:04:38 180000 -- (-2499.512) (-2476.185) (-2481.348) [-2469.690] * (-2471.265) (-2468.090) [-2475.639] (-2488.980) -- 0:04:37 Average standard deviation of split frequencies: 0.017462 180500 -- (-2481.088) (-2473.910) [-2478.723] (-2461.760) * [-2473.558] (-2474.988) (-2475.473) (-2470.878) -- 0:04:36 181000 -- (-2480.180) (-2479.766) (-2482.582) [-2471.142] * [-2478.720] (-2476.909) (-2478.240) (-2483.446) -- 0:04:36 181500 -- (-2484.046) (-2479.051) (-2478.986) [-2469.542] * (-2471.016) (-2481.306) (-2475.519) [-2469.964] -- 0:04:35 182000 -- [-2483.819] (-2468.322) (-2496.063) (-2474.493) * (-2475.508) (-2484.729) (-2475.004) [-2470.011] -- 0:04:34 182500 -- (-2479.048) [-2468.600] (-2485.776) (-2477.275) * (-2465.568) (-2486.371) (-2470.643) [-2470.471] -- 0:04:37 183000 -- (-2492.700) (-2472.037) (-2474.101) [-2477.598] * (-2478.486) (-2477.175) (-2480.244) [-2469.884] -- 0:04:36 183500 -- (-2478.632) (-2482.910) [-2470.907] (-2485.249) * [-2477.332] (-2469.432) (-2478.471) (-2474.250) -- 0:04:35 184000 -- [-2471.660] (-2475.946) (-2480.012) (-2486.262) * [-2465.120] (-2472.879) (-2490.173) (-2474.642) -- 0:04:34 184500 -- (-2482.000) (-2481.587) (-2484.326) [-2470.462] * (-2475.029) (-2487.769) (-2480.723) [-2471.530] -- 0:04:34 185000 -- (-2480.806) (-2472.766) [-2477.409] (-2475.166) * (-2471.124) (-2478.669) (-2487.690) [-2470.230] -- 0:04:33 Average standard deviation of split frequencies: 0.016112 185500 -- [-2470.534] (-2478.326) (-2484.391) (-2480.479) * [-2470.893] (-2484.555) (-2491.282) (-2472.523) -- 0:04:36 186000 -- (-2483.666) [-2461.924] (-2477.918) (-2472.197) * (-2476.085) [-2468.170] (-2476.606) (-2494.544) -- 0:04:35 186500 -- [-2473.341] (-2475.850) (-2474.022) (-2479.094) * (-2465.813) (-2479.318) (-2476.405) [-2462.860] -- 0:04:34 187000 -- (-2473.719) [-2463.165] (-2488.872) (-2468.578) * [-2469.496] (-2484.236) (-2466.682) (-2483.486) -- 0:04:33 187500 -- (-2467.482) (-2482.376) (-2482.802) [-2471.157] * (-2470.712) [-2473.021] (-2464.898) (-2482.620) -- 0:04:33 188000 -- (-2473.846) [-2479.667] (-2481.312) (-2478.517) * (-2483.156) [-2466.176] (-2471.289) (-2482.414) -- 0:04:32 188500 -- (-2480.317) [-2478.444] (-2485.417) (-2475.858) * (-2483.535) [-2477.882] (-2477.969) (-2472.629) -- 0:04:35 189000 -- (-2475.457) (-2476.214) (-2479.396) [-2464.237] * [-2469.650] (-2470.103) (-2474.961) (-2470.621) -- 0:04:34 189500 -- [-2470.178] (-2485.901) (-2472.825) (-2484.261) * (-2478.944) (-2475.627) (-2474.221) [-2472.205] -- 0:04:33 190000 -- (-2479.516) (-2474.640) (-2468.733) [-2474.304] * (-2490.554) (-2478.103) (-2470.053) [-2476.263] -- 0:04:32 Average standard deviation of split frequencies: 0.017687 190500 -- (-2469.731) (-2472.876) [-2469.852] (-2473.105) * (-2486.323) (-2475.107) [-2476.024] (-2494.909) -- 0:04:31 191000 -- [-2480.700] (-2486.835) (-2475.085) (-2463.784) * [-2471.934] (-2479.294) (-2494.070) (-2476.005) -- 0:04:35 191500 -- (-2477.546) (-2471.641) (-2469.922) [-2468.398] * (-2476.123) [-2468.759] (-2474.553) (-2473.559) -- 0:04:34 192000 -- (-2468.160) (-2481.979) [-2483.086] (-2472.484) * (-2485.595) (-2473.301) [-2476.172] (-2471.291) -- 0:04:33 192500 -- (-2481.365) [-2466.685] (-2481.497) (-2477.799) * (-2471.710) [-2478.626] (-2467.990) (-2478.692) -- 0:04:32 193000 -- [-2469.842] (-2466.120) (-2473.879) (-2472.369) * [-2473.135] (-2487.844) (-2475.092) (-2475.884) -- 0:04:31 193500 -- [-2467.778] (-2472.095) (-2473.609) (-2481.424) * (-2472.076) (-2482.189) [-2473.749] (-2483.466) -- 0:04:30 194000 -- (-2472.678) [-2473.786] (-2476.004) (-2484.732) * (-2471.903) (-2487.014) [-2477.637] (-2481.983) -- 0:04:34 194500 -- (-2485.430) [-2478.183] (-2480.715) (-2483.052) * (-2472.328) [-2475.582] (-2471.419) (-2485.287) -- 0:04:33 195000 -- [-2472.070] (-2478.873) (-2485.290) (-2480.033) * (-2478.861) (-2478.448) (-2475.565) [-2475.679] -- 0:04:32 Average standard deviation of split frequencies: 0.017021 195500 -- (-2474.261) (-2487.644) (-2471.029) [-2472.461] * (-2473.163) (-2477.009) (-2482.801) [-2471.989] -- 0:04:31 196000 -- (-2474.467) [-2475.805] (-2472.074) (-2467.515) * (-2470.380) (-2483.178) (-2467.763) [-2468.227] -- 0:04:30 196500 -- (-2469.586) (-2483.102) (-2473.894) [-2465.354] * (-2468.598) (-2480.623) [-2473.226] (-2476.899) -- 0:04:29 197000 -- (-2477.376) (-2479.807) [-2474.285] (-2482.480) * (-2474.844) (-2480.838) [-2469.251] (-2477.462) -- 0:04:33 197500 -- (-2478.484) [-2478.951] (-2475.927) (-2469.441) * (-2477.625) [-2476.061] (-2468.610) (-2485.989) -- 0:04:32 198000 -- (-2483.495) (-2478.364) [-2470.009] (-2478.406) * (-2480.896) (-2479.085) [-2479.485] (-2494.745) -- 0:04:31 198500 -- [-2467.190] (-2489.103) (-2471.431) (-2478.185) * (-2485.900) (-2495.834) [-2472.503] (-2487.562) -- 0:04:30 199000 -- [-2471.780] (-2486.415) (-2469.666) (-2478.855) * (-2478.203) [-2469.543] (-2472.569) (-2474.982) -- 0:04:33 199500 -- (-2477.390) (-2478.857) (-2476.538) [-2473.798] * (-2479.268) [-2478.585] (-2480.363) (-2495.821) -- 0:04:32 200000 -- (-2476.033) (-2477.485) (-2473.260) [-2466.548] * [-2483.085] (-2477.105) (-2473.143) (-2483.076) -- 0:04:32 Average standard deviation of split frequencies: 0.018071 200500 -- (-2486.538) (-2471.298) [-2474.921] (-2484.771) * [-2473.389] (-2507.725) (-2467.884) (-2479.633) -- 0:04:31 201000 -- (-2485.531) (-2475.171) [-2473.320] (-2473.287) * (-2480.645) (-2481.213) [-2472.744] (-2471.175) -- 0:04:30 201500 -- [-2478.016] (-2483.500) (-2481.922) (-2485.857) * (-2472.005) [-2469.283] (-2487.933) (-2485.964) -- 0:04:33 202000 -- (-2468.527) (-2478.393) (-2473.296) [-2475.712] * [-2465.622] (-2466.185) (-2486.711) (-2479.824) -- 0:04:32 202500 -- (-2475.084) (-2479.189) (-2474.927) [-2470.445] * (-2476.462) (-2482.138) [-2474.262] (-2469.407) -- 0:04:31 203000 -- (-2474.895) [-2474.983] (-2480.110) (-2475.156) * (-2490.912) (-2482.134) [-2473.216] (-2472.075) -- 0:04:30 203500 -- (-2479.647) [-2471.419] (-2486.708) (-2468.964) * (-2480.161) (-2476.369) [-2464.667] (-2468.919) -- 0:04:30 204000 -- [-2476.493] (-2475.160) (-2465.802) (-2469.723) * (-2477.031) (-2464.728) [-2472.361] (-2481.423) -- 0:04:33 204500 -- (-2468.014) (-2473.546) [-2474.013] (-2487.294) * (-2467.244) (-2477.992) [-2462.842] (-2473.597) -- 0:04:32 205000 -- (-2472.716) (-2474.301) (-2483.652) [-2471.581] * (-2476.870) (-2474.408) (-2482.390) [-2475.574] -- 0:04:31 Average standard deviation of split frequencies: 0.018483 205500 -- (-2471.743) [-2473.822] (-2477.407) (-2484.132) * [-2474.969] (-2476.112) (-2488.387) (-2470.445) -- 0:04:30 206000 -- (-2476.548) (-2477.798) (-2488.204) [-2471.250] * (-2478.332) (-2474.604) (-2471.708) [-2469.073] -- 0:04:29 206500 -- (-2475.691) (-2490.467) (-2466.130) [-2468.207] * (-2474.427) [-2475.001] (-2477.378) (-2467.736) -- 0:04:32 207000 -- (-2467.199) (-2478.768) [-2463.544] (-2478.653) * (-2471.089) [-2468.810] (-2483.416) (-2471.999) -- 0:04:31 207500 -- (-2476.899) [-2477.500] (-2468.766) (-2471.041) * (-2476.745) [-2476.612] (-2477.710) (-2476.681) -- 0:04:31 208000 -- (-2479.963) [-2480.665] (-2478.475) (-2476.472) * (-2487.724) [-2478.517] (-2474.917) (-2485.366) -- 0:04:30 208500 -- (-2484.724) (-2482.862) (-2473.349) [-2464.944] * (-2476.676) (-2474.243) [-2467.718] (-2471.572) -- 0:04:29 209000 -- (-2465.258) (-2496.281) (-2477.507) [-2466.782] * [-2476.719] (-2477.090) (-2474.526) (-2483.558) -- 0:04:28 209500 -- (-2467.558) [-2468.745] (-2484.494) (-2481.675) * (-2474.938) (-2482.625) [-2469.885] (-2473.567) -- 0:04:31 210000 -- (-2474.866) (-2475.362) [-2478.385] (-2479.270) * [-2478.147] (-2465.800) (-2473.419) (-2474.668) -- 0:04:30 Average standard deviation of split frequencies: 0.017213 210500 -- [-2480.420] (-2477.613) (-2474.601) (-2475.430) * (-2480.546) [-2470.463] (-2485.889) (-2476.658) -- 0:04:30 211000 -- (-2474.333) (-2467.442) [-2470.184] (-2482.152) * [-2470.124] (-2485.573) (-2473.247) (-2472.227) -- 0:04:29 211500 -- (-2471.159) (-2475.061) [-2471.061] (-2478.138) * [-2467.311] (-2486.616) (-2471.615) (-2469.061) -- 0:04:28 212000 -- [-2469.063] (-2476.462) (-2472.813) (-2479.746) * (-2471.233) (-2477.114) [-2468.286] (-2470.378) -- 0:04:31 212500 -- (-2475.371) (-2474.870) [-2475.999] (-2494.393) * (-2472.481) (-2474.148) (-2480.830) [-2469.501] -- 0:04:30 213000 -- (-2491.448) (-2467.978) (-2480.969) [-2474.392] * (-2468.423) [-2475.166] (-2475.374) (-2481.844) -- 0:04:29 213500 -- [-2471.027] (-2479.952) (-2481.650) (-2479.013) * (-2474.441) (-2489.137) (-2477.349) [-2474.286] -- 0:04:28 214000 -- [-2472.710] (-2476.048) (-2480.921) (-2471.759) * (-2475.938) (-2484.765) (-2478.647) [-2465.975] -- 0:04:28 214500 -- (-2476.159) (-2470.003) [-2471.583] (-2475.012) * [-2475.132] (-2471.798) (-2473.085) (-2480.767) -- 0:04:27 215000 -- (-2488.557) (-2468.694) [-2478.712] (-2475.131) * (-2477.774) (-2475.484) [-2474.827] (-2475.963) -- 0:04:26 Average standard deviation of split frequencies: 0.016956 215500 -- (-2475.652) [-2474.941] (-2482.034) (-2478.526) * (-2481.355) (-2478.035) [-2470.756] (-2487.110) -- 0:04:29 216000 -- (-2473.745) (-2476.557) (-2485.145) [-2469.472] * (-2482.042) [-2479.037] (-2471.650) (-2476.605) -- 0:04:28 216500 -- (-2473.722) [-2472.316] (-2476.899) (-2481.702) * [-2477.202] (-2483.213) (-2470.882) (-2481.414) -- 0:04:27 217000 -- (-2472.843) (-2475.551) (-2485.290) [-2478.213] * (-2466.957) (-2485.924) (-2489.570) [-2473.378] -- 0:04:27 217500 -- (-2475.604) (-2465.710) [-2468.595] (-2478.537) * (-2480.323) [-2473.836] (-2473.176) (-2480.319) -- 0:04:26 218000 -- (-2482.853) (-2474.420) [-2474.001] (-2470.514) * (-2479.211) (-2469.413) (-2471.446) [-2476.207] -- 0:04:25 218500 -- [-2473.062] (-2479.753) (-2481.875) (-2476.155) * (-2474.057) [-2475.675] (-2471.022) (-2475.305) -- 0:04:28 219000 -- [-2471.286] (-2478.036) (-2469.217) (-2486.497) * (-2472.385) (-2477.731) [-2475.950] (-2476.597) -- 0:04:27 219500 -- (-2468.503) [-2467.625] (-2477.568) (-2492.625) * [-2468.121] (-2476.216) (-2475.454) (-2473.390) -- 0:04:26 220000 -- (-2471.004) (-2480.481) [-2477.852] (-2483.455) * (-2480.959) [-2468.774] (-2474.940) (-2490.523) -- 0:04:25 Average standard deviation of split frequencies: 0.017583 220500 -- [-2469.714] (-2471.833) (-2476.637) (-2484.571) * [-2480.871] (-2467.644) (-2476.758) (-2486.930) -- 0:04:25 221000 -- [-2462.935] (-2475.863) (-2486.758) (-2486.059) * (-2472.997) (-2468.536) (-2473.913) [-2474.687] -- 0:04:24 221500 -- [-2467.977] (-2472.190) (-2471.813) (-2479.190) * [-2479.618] (-2473.566) (-2487.916) (-2470.290) -- 0:04:27 222000 -- (-2469.534) [-2471.453] (-2472.556) (-2489.706) * [-2470.809] (-2473.613) (-2475.438) (-2476.997) -- 0:04:26 222500 -- (-2481.856) [-2477.380] (-2472.867) (-2473.641) * (-2468.493) (-2481.746) [-2474.197] (-2476.081) -- 0:04:25 223000 -- (-2473.720) (-2477.697) (-2471.122) [-2480.428] * (-2477.576) [-2477.608] (-2474.263) (-2488.748) -- 0:04:24 223500 -- (-2484.560) [-2468.186] (-2470.623) (-2491.418) * [-2464.689] (-2478.771) (-2481.087) (-2467.510) -- 0:04:24 224000 -- (-2479.141) (-2471.889) [-2469.427] (-2480.528) * (-2474.778) [-2476.457] (-2473.198) (-2476.082) -- 0:04:26 224500 -- (-2480.528) [-2466.367] (-2473.088) (-2478.549) * (-2468.878) (-2488.783) (-2483.961) [-2475.577] -- 0:04:25 225000 -- (-2476.623) [-2465.689] (-2479.082) (-2469.395) * (-2478.663) [-2483.343] (-2484.341) (-2477.763) -- 0:04:25 Average standard deviation of split frequencies: 0.017581 225500 -- (-2481.571) [-2472.470] (-2477.575) (-2478.198) * (-2481.927) [-2477.841] (-2477.989) (-2489.395) -- 0:04:24 226000 -- [-2470.531] (-2471.669) (-2480.968) (-2479.827) * [-2482.710] (-2486.317) (-2488.312) (-2474.504) -- 0:04:23 226500 -- (-2470.867) (-2488.149) [-2470.740] (-2477.106) * (-2481.751) [-2478.598] (-2476.886) (-2487.762) -- 0:04:26 227000 -- [-2476.868] (-2479.923) (-2482.743) (-2478.407) * [-2472.488] (-2483.474) (-2473.753) (-2480.132) -- 0:04:25 227500 -- (-2476.868) (-2473.691) (-2482.176) [-2476.582] * (-2469.219) (-2480.669) [-2463.264] (-2470.462) -- 0:04:24 228000 -- [-2476.140] (-2476.314) (-2478.230) (-2477.976) * (-2480.308) (-2471.913) (-2473.907) [-2480.830] -- 0:04:24 228500 -- [-2472.924] (-2478.861) (-2480.128) (-2485.406) * (-2482.537) (-2478.614) (-2478.144) [-2469.034] -- 0:04:23 229000 -- (-2479.560) [-2476.233] (-2474.769) (-2471.734) * (-2478.561) (-2467.111) (-2482.736) [-2469.837] -- 0:04:25 229500 -- (-2487.990) [-2473.106] (-2478.349) (-2483.664) * (-2474.947) [-2468.855] (-2475.220) (-2480.804) -- 0:04:25 230000 -- (-2481.803) [-2475.919] (-2471.141) (-2474.426) * (-2468.872) (-2467.113) (-2473.058) [-2466.554] -- 0:04:24 Average standard deviation of split frequencies: 0.017225 230500 -- (-2481.544) (-2479.420) [-2477.515] (-2483.852) * (-2480.723) (-2471.611) (-2478.802) [-2472.767] -- 0:04:23 231000 -- (-2490.868) (-2483.484) [-2467.972] (-2495.746) * (-2489.402) [-2473.106] (-2484.522) (-2470.511) -- 0:04:22 231500 -- (-2470.647) (-2482.095) (-2478.336) [-2479.045] * (-2482.836) (-2465.236) [-2467.487] (-2479.566) -- 0:04:22 232000 -- (-2477.445) (-2473.971) (-2467.711) [-2465.103] * [-2475.154] (-2473.021) (-2473.103) (-2476.795) -- 0:04:21 232500 -- (-2474.243) (-2468.227) (-2483.178) [-2467.699] * [-2470.124] (-2480.635) (-2493.244) (-2474.440) -- 0:04:24 233000 -- (-2482.139) (-2473.821) [-2468.926] (-2483.283) * (-2473.340) (-2472.469) (-2472.306) [-2468.455] -- 0:04:23 233500 -- (-2480.089) (-2479.396) (-2470.242) [-2469.681] * (-2474.856) [-2466.890] (-2476.774) (-2483.861) -- 0:04:22 234000 -- (-2471.021) [-2465.747] (-2480.652) (-2466.498) * [-2472.594] (-2487.706) (-2463.948) (-2474.102) -- 0:04:21 234500 -- (-2480.212) (-2477.240) (-2475.495) [-2483.343] * (-2479.994) (-2475.086) (-2477.741) [-2472.974] -- 0:04:21 235000 -- (-2474.213) [-2469.543] (-2482.789) (-2473.162) * (-2484.965) [-2483.178] (-2475.608) (-2471.559) -- 0:04:23 Average standard deviation of split frequencies: 0.016693 235500 -- (-2490.865) (-2474.693) [-2474.904] (-2482.142) * (-2481.042) (-2480.422) (-2476.261) [-2471.299] -- 0:04:22 236000 -- (-2466.911) [-2470.168] (-2477.963) (-2471.332) * (-2484.832) [-2478.960] (-2462.934) (-2483.153) -- 0:04:22 236500 -- (-2481.939) (-2477.353) [-2471.691] (-2478.787) * (-2475.474) (-2470.614) [-2466.927] (-2478.380) -- 0:04:21 237000 -- (-2469.513) [-2467.952] (-2472.228) (-2475.545) * (-2472.691) (-2482.213) [-2474.259] (-2475.476) -- 0:04:20 237500 -- [-2472.765] (-2475.975) (-2469.519) (-2471.688) * [-2469.059] (-2473.045) (-2482.940) (-2481.388) -- 0:04:20 238000 -- (-2470.368) (-2493.444) [-2470.211] (-2473.814) * [-2477.726] (-2470.921) (-2472.522) (-2476.591) -- 0:04:22 238500 -- (-2475.057) [-2471.286] (-2477.809) (-2474.353) * [-2467.891] (-2472.313) (-2482.683) (-2470.105) -- 0:04:21 239000 -- [-2487.303] (-2471.687) (-2487.452) (-2487.523) * [-2477.426] (-2477.463) (-2472.458) (-2470.379) -- 0:04:21 239500 -- (-2475.119) (-2472.569) [-2470.684] (-2478.973) * (-2490.720) [-2475.215] (-2473.486) (-2473.843) -- 0:04:20 240000 -- [-2479.193] (-2466.378) (-2480.716) (-2475.695) * [-2477.077] (-2484.594) (-2473.956) (-2481.642) -- 0:04:19 Average standard deviation of split frequencies: 0.017209 240500 -- (-2477.314) [-2482.227] (-2473.602) (-2468.651) * [-2470.757] (-2469.082) (-2476.617) (-2470.375) -- 0:04:18 241000 -- (-2473.473) (-2482.722) [-2469.947] (-2485.926) * (-2484.473) (-2482.939) [-2468.114] (-2473.111) -- 0:04:21 241500 -- (-2477.159) (-2477.863) (-2474.371) [-2471.573] * (-2480.846) [-2470.935] (-2475.030) (-2475.198) -- 0:04:20 242000 -- (-2482.151) [-2472.563] (-2467.428) (-2470.249) * (-2480.544) [-2472.115] (-2474.112) (-2467.828) -- 0:04:19 242500 -- (-2484.026) (-2473.752) (-2470.673) [-2466.817] * (-2479.209) (-2474.338) (-2474.533) [-2471.761] -- 0:04:19 243000 -- (-2473.029) (-2469.364) [-2472.121] (-2472.245) * (-2473.615) [-2472.327] (-2470.961) (-2476.306) -- 0:04:18 243500 -- (-2468.563) [-2476.356] (-2484.328) (-2477.146) * (-2480.800) [-2472.475] (-2492.066) (-2483.195) -- 0:04:17 244000 -- (-2472.227) [-2464.663] (-2477.167) (-2484.651) * [-2471.283] (-2479.973) (-2488.960) (-2505.330) -- 0:04:20 244500 -- (-2473.877) [-2469.430] (-2473.055) (-2487.974) * (-2475.940) [-2485.605] (-2483.064) (-2495.983) -- 0:04:19 245000 -- [-2471.239] (-2481.743) (-2477.935) (-2483.642) * [-2474.346] (-2475.754) (-2489.309) (-2495.600) -- 0:04:18 Average standard deviation of split frequencies: 0.019437 245500 -- (-2478.521) (-2482.135) [-2469.912] (-2481.272) * (-2475.604) (-2481.840) [-2482.355] (-2487.788) -- 0:04:18 246000 -- (-2484.497) (-2475.126) [-2476.689] (-2487.336) * (-2471.489) [-2482.149] (-2482.130) (-2493.557) -- 0:04:17 246500 -- [-2475.049] (-2475.382) (-2484.172) (-2481.466) * (-2474.901) (-2481.384) (-2481.224) [-2474.812] -- 0:04:19 247000 -- [-2474.210] (-2469.663) (-2484.867) (-2479.371) * [-2468.934] (-2475.139) (-2479.396) (-2480.001) -- 0:04:19 247500 -- (-2465.118) (-2478.600) [-2468.213] (-2473.311) * [-2468.217] (-2475.470) (-2482.406) (-2486.932) -- 0:04:18 248000 -- [-2471.282] (-2481.842) (-2473.309) (-2489.206) * (-2485.597) (-2480.374) [-2473.541] (-2482.101) -- 0:04:17 248500 -- (-2477.282) [-2472.112] (-2478.525) (-2473.092) * (-2478.968) [-2475.424] (-2477.998) (-2472.278) -- 0:04:20 249000 -- (-2473.814) (-2475.354) (-2479.641) [-2464.896] * (-2499.476) (-2470.162) (-2466.927) [-2476.335] -- 0:04:19 249500 -- (-2469.034) (-2489.118) (-2474.063) [-2468.078] * (-2475.092) (-2479.153) (-2481.148) [-2471.969] -- 0:04:18 250000 -- [-2471.334] (-2472.611) (-2470.351) (-2479.922) * (-2474.874) (-2476.508) [-2475.676] (-2477.510) -- 0:04:18 Average standard deviation of split frequencies: 0.019343 250500 -- (-2470.462) (-2476.976) (-2470.380) [-2471.402] * (-2474.394) (-2471.040) [-2473.758] (-2477.962) -- 0:04:17 251000 -- (-2470.737) (-2487.475) [-2476.932] (-2471.202) * [-2476.320] (-2471.652) (-2478.464) (-2467.937) -- 0:04:16 251500 -- [-2468.488] (-2476.512) (-2470.943) (-2482.564) * [-2468.276] (-2472.045) (-2479.472) (-2486.040) -- 0:04:18 252000 -- (-2474.207) [-2467.333] (-2476.758) (-2478.865) * (-2472.635) (-2467.519) (-2476.555) [-2475.395] -- 0:04:18 252500 -- (-2479.391) (-2479.156) (-2473.635) [-2465.882] * [-2471.384] (-2472.712) (-2474.245) (-2485.704) -- 0:04:17 253000 -- (-2478.752) (-2477.424) (-2473.570) [-2472.085] * (-2475.855) [-2475.628] (-2472.446) (-2468.263) -- 0:04:16 253500 -- (-2476.860) (-2475.369) [-2466.437] (-2480.951) * [-2468.165] (-2475.888) (-2478.115) (-2470.672) -- 0:04:16 254000 -- (-2483.183) [-2475.837] (-2464.819) (-2475.983) * (-2467.135) [-2472.324] (-2481.985) (-2469.096) -- 0:04:15 254500 -- (-2483.763) [-2476.762] (-2472.175) (-2467.596) * [-2472.247] (-2475.451) (-2489.248) (-2472.272) -- 0:04:14 255000 -- (-2477.466) (-2473.028) (-2476.193) [-2475.642] * [-2471.281] (-2479.242) (-2471.838) (-2478.726) -- 0:04:17 Average standard deviation of split frequencies: 0.019274 255500 -- [-2486.475] (-2470.139) (-2482.933) (-2484.838) * (-2487.687) (-2466.149) [-2468.512] (-2472.808) -- 0:04:16 256000 -- (-2474.640) (-2483.933) (-2464.204) [-2469.894] * (-2497.180) [-2467.486] (-2475.410) (-2477.570) -- 0:04:15 256500 -- (-2469.218) (-2479.996) (-2475.192) [-2477.022] * (-2477.709) (-2482.820) [-2467.940] (-2471.811) -- 0:04:15 257000 -- [-2475.011] (-2490.091) (-2469.794) (-2479.980) * (-2483.840) [-2483.195] (-2480.746) (-2471.847) -- 0:04:14 257500 -- (-2479.358) (-2479.912) [-2475.367] (-2489.064) * (-2488.476) [-2482.100] (-2474.449) (-2469.985) -- 0:04:13 258000 -- (-2471.184) [-2469.071] (-2476.627) (-2474.378) * (-2473.445) (-2474.834) (-2474.258) [-2475.408] -- 0:04:15 258500 -- (-2478.279) (-2474.988) (-2484.919) [-2473.759] * (-2480.359) (-2475.101) [-2475.484] (-2476.329) -- 0:04:15 259000 -- (-2474.878) [-2468.837] (-2471.818) (-2484.004) * (-2469.663) [-2472.258] (-2499.462) (-2475.747) -- 0:04:14 259500 -- [-2471.397] (-2473.950) (-2481.250) (-2481.734) * (-2478.211) [-2474.884] (-2479.816) (-2488.660) -- 0:04:13 260000 -- (-2484.202) [-2470.255] (-2478.549) (-2469.227) * (-2476.178) [-2478.568] (-2483.901) (-2484.377) -- 0:04:13 Average standard deviation of split frequencies: 0.018085 260500 -- (-2478.079) (-2487.666) (-2477.729) [-2477.321] * [-2474.467] (-2473.741) (-2472.330) (-2480.842) -- 0:04:15 261000 -- (-2477.563) (-2471.481) (-2494.649) [-2475.140] * [-2475.247] (-2477.368) (-2473.773) (-2479.822) -- 0:04:14 261500 -- (-2490.300) (-2482.449) (-2487.517) [-2470.706] * (-2466.290) (-2481.135) (-2491.016) [-2474.235] -- 0:04:14 262000 -- (-2477.028) (-2475.063) (-2485.583) [-2477.779] * [-2475.643] (-2470.665) (-2481.578) (-2479.676) -- 0:04:13 262500 -- (-2470.343) [-2469.408] (-2480.352) (-2482.048) * [-2477.363] (-2477.414) (-2476.869) (-2476.332) -- 0:04:12 263000 -- [-2471.793] (-2483.065) (-2473.969) (-2470.130) * (-2469.872) (-2475.690) (-2483.329) [-2469.388] -- 0:04:12 263500 -- (-2488.327) [-2476.780] (-2475.745) (-2464.923) * [-2475.885] (-2472.528) (-2475.814) (-2468.175) -- 0:04:14 264000 -- (-2483.414) [-2480.560] (-2476.662) (-2465.606) * (-2487.687) (-2476.840) (-2475.957) [-2468.201] -- 0:04:13 264500 -- (-2479.745) [-2470.161] (-2473.580) (-2473.483) * [-2468.250] (-2487.665) (-2474.750) (-2484.211) -- 0:04:13 265000 -- (-2471.170) (-2485.425) [-2476.138] (-2474.585) * (-2480.669) [-2484.695] (-2482.771) (-2481.585) -- 0:04:12 Average standard deviation of split frequencies: 0.018988 265500 -- (-2470.550) (-2490.651) [-2475.941] (-2470.827) * [-2465.319] (-2474.303) (-2496.769) (-2478.745) -- 0:04:11 266000 -- (-2479.750) (-2484.996) (-2486.198) [-2469.521] * (-2475.929) [-2476.300] (-2475.042) (-2477.616) -- 0:04:11 266500 -- (-2477.137) (-2483.146) (-2479.657) [-2468.872] * (-2474.846) (-2470.871) (-2482.867) [-2472.869] -- 0:04:10 267000 -- (-2476.161) (-2482.366) (-2482.306) [-2473.114] * [-2477.724] (-2476.905) (-2496.220) (-2467.273) -- 0:04:12 267500 -- [-2463.485] (-2478.538) (-2474.347) (-2476.500) * (-2473.531) (-2484.359) (-2482.728) [-2465.913] -- 0:04:11 268000 -- [-2470.826] (-2469.235) (-2484.385) (-2471.973) * (-2485.792) (-2474.753) [-2474.399] (-2472.763) -- 0:04:11 268500 -- (-2474.616) (-2470.819) (-2471.634) [-2463.947] * (-2477.816) (-2483.004) [-2465.730] (-2494.211) -- 0:04:10 269000 -- (-2470.779) [-2476.983] (-2476.578) (-2470.256) * (-2478.375) [-2481.709] (-2476.708) (-2475.100) -- 0:04:12 269500 -- [-2466.215] (-2475.801) (-2471.948) (-2475.881) * [-2467.741] (-2482.352) (-2474.252) (-2468.612) -- 0:04:12 270000 -- [-2471.951] (-2481.595) (-2475.106) (-2487.462) * (-2477.462) (-2482.152) [-2474.662] (-2462.781) -- 0:04:11 Average standard deviation of split frequencies: 0.017881 270500 -- (-2479.263) (-2476.850) (-2477.556) [-2484.249] * (-2467.179) (-2464.292) [-2475.754] (-2483.735) -- 0:04:10 271000 -- (-2477.479) [-2475.571] (-2472.372) (-2476.112) * (-2466.138) (-2493.387) (-2472.033) [-2474.692] -- 0:04:12 271500 -- (-2495.247) (-2484.210) [-2474.977] (-2488.162) * [-2473.799] (-2477.686) (-2477.304) (-2467.065) -- 0:04:12 272000 -- (-2469.696) (-2489.157) (-2475.147) [-2467.334] * (-2487.426) (-2469.781) [-2473.943] (-2480.499) -- 0:04:11 272500 -- (-2490.419) [-2470.340] (-2468.624) (-2473.522) * (-2487.132) (-2467.388) (-2473.396) [-2475.540] -- 0:04:10 273000 -- (-2468.743) (-2468.819) (-2478.313) [-2469.299] * (-2475.746) [-2477.313] (-2489.805) (-2478.763) -- 0:04:10 273500 -- [-2471.733] (-2482.920) (-2484.070) (-2472.080) * (-2471.878) [-2468.647] (-2473.894) (-2481.470) -- 0:04:12 274000 -- (-2474.540) (-2471.083) (-2482.365) [-2475.092] * (-2478.436) (-2493.665) [-2470.174] (-2471.553) -- 0:04:11 274500 -- (-2480.983) (-2476.759) [-2467.286] (-2491.101) * (-2484.773) (-2478.991) [-2476.774] (-2473.060) -- 0:04:11 275000 -- [-2482.485] (-2481.175) (-2466.579) (-2474.825) * [-2473.345] (-2482.414) (-2476.371) (-2472.367) -- 0:04:10 Average standard deviation of split frequencies: 0.017308 275500 -- (-2474.903) (-2476.223) [-2472.337] (-2472.844) * [-2469.031] (-2481.815) (-2481.297) (-2477.090) -- 0:04:09 276000 -- (-2473.282) (-2491.322) [-2470.884] (-2479.409) * (-2474.355) (-2466.337) (-2476.569) [-2473.199] -- 0:04:09 276500 -- [-2477.610] (-2469.882) (-2471.155) (-2481.692) * (-2475.744) [-2478.406] (-2475.835) (-2468.364) -- 0:04:11 277000 -- (-2475.415) (-2478.366) (-2466.639) [-2466.076] * (-2465.960) (-2471.206) (-2489.120) [-2471.905] -- 0:04:10 277500 -- [-2477.142] (-2467.991) (-2478.582) (-2472.289) * (-2475.488) [-2469.066] (-2482.145) (-2478.537) -- 0:04:09 278000 -- (-2470.221) (-2473.631) [-2472.734] (-2480.102) * [-2471.308] (-2474.377) (-2476.798) (-2471.687) -- 0:04:09 278500 -- (-2481.037) (-2481.747) [-2466.782] (-2488.977) * (-2475.547) (-2473.811) (-2470.415) [-2475.200] -- 0:04:08 279000 -- (-2477.811) [-2475.224] (-2471.451) (-2472.143) * (-2475.327) (-2473.566) (-2471.021) [-2471.228] -- 0:04:10 279500 -- (-2478.871) (-2476.466) (-2493.811) [-2468.786] * (-2475.501) (-2475.950) (-2470.118) [-2475.187] -- 0:04:10 280000 -- (-2479.621) (-2479.874) [-2477.055] (-2477.017) * (-2480.809) (-2469.571) [-2475.167] (-2472.692) -- 0:04:09 Average standard deviation of split frequencies: 0.017468 280500 -- [-2475.515] (-2481.110) (-2473.592) (-2472.666) * [-2471.969] (-2476.651) (-2472.713) (-2481.465) -- 0:04:08 281000 -- [-2473.932] (-2474.814) (-2478.169) (-2480.162) * (-2479.367) [-2474.154] (-2485.082) (-2480.787) -- 0:04:08 281500 -- (-2478.560) (-2482.416) [-2473.275] (-2480.709) * (-2472.448) [-2469.490] (-2476.471) (-2479.394) -- 0:04:07 282000 -- [-2478.036] (-2465.867) (-2471.091) (-2483.679) * (-2475.245) (-2474.681) (-2484.103) [-2467.611] -- 0:04:09 282500 -- [-2476.137] (-2489.410) (-2473.392) (-2477.341) * [-2472.007] (-2479.948) (-2480.123) (-2469.064) -- 0:04:08 283000 -- (-2484.707) [-2471.667] (-2473.157) (-2474.530) * [-2471.504] (-2484.628) (-2488.193) (-2478.093) -- 0:04:08 283500 -- (-2480.902) (-2487.665) [-2473.163] (-2472.763) * (-2483.716) (-2481.904) (-2479.172) [-2465.855] -- 0:04:07 284000 -- (-2471.009) [-2467.582] (-2475.412) (-2477.120) * (-2482.934) [-2474.547] (-2484.950) (-2471.503) -- 0:04:07 284500 -- (-2486.243) (-2475.420) (-2491.484) [-2471.910] * [-2476.201] (-2478.079) (-2468.197) (-2492.987) -- 0:04:06 285000 -- (-2471.311) (-2473.696) [-2471.096] (-2475.789) * (-2474.687) [-2469.801] (-2491.796) (-2478.162) -- 0:04:05 Average standard deviation of split frequencies: 0.016702 285500 -- (-2494.581) [-2480.517] (-2472.025) (-2474.517) * [-2469.911] (-2474.590) (-2485.849) (-2482.614) -- 0:04:07 286000 -- (-2476.853) [-2478.857] (-2470.502) (-2473.672) * (-2469.738) (-2476.672) (-2479.010) [-2473.351] -- 0:04:07 286500 -- [-2478.488] (-2481.761) (-2467.007) (-2467.173) * [-2471.910] (-2474.958) (-2475.844) (-2479.320) -- 0:04:06 287000 -- (-2470.609) [-2468.820] (-2472.319) (-2481.250) * [-2469.328] (-2480.368) (-2475.168) (-2483.665) -- 0:04:05 287500 -- (-2487.831) (-2478.336) (-2479.819) [-2471.452] * (-2481.571) (-2481.394) [-2475.998] (-2478.693) -- 0:04:05 288000 -- (-2478.416) [-2472.302] (-2481.861) (-2477.065) * (-2487.383) (-2483.126) (-2470.129) [-2472.505] -- 0:04:07 288500 -- (-2481.751) (-2476.973) (-2470.186) [-2467.358] * (-2470.358) (-2483.258) (-2469.952) [-2482.235] -- 0:04:06 289000 -- [-2479.534] (-2484.716) (-2462.922) (-2474.603) * (-2468.545) (-2483.234) (-2472.292) [-2473.735] -- 0:04:06 289500 -- (-2470.776) [-2470.123] (-2469.507) (-2476.558) * [-2469.553] (-2468.464) (-2473.118) (-2465.809) -- 0:04:05 290000 -- (-2468.515) (-2480.919) (-2477.457) [-2479.497] * (-2468.491) [-2464.186] (-2485.760) (-2475.330) -- 0:04:04 Average standard deviation of split frequencies: 0.017083 290500 -- [-2468.105] (-2471.184) (-2476.229) (-2486.271) * (-2475.989) [-2468.030] (-2469.735) (-2475.381) -- 0:04:04 291000 -- (-2467.423) (-2493.279) [-2480.582] (-2479.577) * (-2474.802) (-2484.876) [-2468.270] (-2481.468) -- 0:04:06 291500 -- (-2475.485) (-2473.012) [-2472.477] (-2471.556) * [-2468.555] (-2488.089) (-2469.412) (-2476.697) -- 0:04:05 292000 -- (-2470.537) [-2472.345] (-2476.093) (-2472.644) * [-2471.752] (-2476.842) (-2487.087) (-2472.225) -- 0:04:04 292500 -- (-2470.356) [-2469.828] (-2479.660) (-2472.215) * (-2476.761) (-2482.221) (-2470.215) [-2475.308] -- 0:04:04 293000 -- (-2473.250) [-2468.322] (-2466.085) (-2474.228) * (-2470.858) (-2495.533) (-2485.662) [-2481.960] -- 0:04:03 293500 -- (-2477.970) (-2471.120) [-2470.557] (-2478.428) * (-2468.096) (-2472.399) [-2473.138] (-2498.714) -- 0:04:03 294000 -- [-2480.215] (-2477.929) (-2474.964) (-2468.386) * (-2470.614) (-2481.066) [-2470.613] (-2484.027) -- 0:04:04 294500 -- (-2462.897) (-2468.614) (-2483.126) [-2468.499] * [-2475.475] (-2483.298) (-2472.825) (-2476.004) -- 0:04:04 295000 -- (-2470.813) [-2473.642] (-2476.792) (-2474.522) * (-2481.073) (-2485.456) (-2476.372) [-2472.132] -- 0:04:03 Average standard deviation of split frequencies: 0.015607 295500 -- (-2470.286) (-2470.246) [-2482.749] (-2470.869) * (-2490.406) (-2473.586) (-2472.340) [-2474.621] -- 0:04:03 296000 -- [-2464.349] (-2476.335) (-2478.396) (-2472.645) * (-2467.954) (-2483.882) (-2477.054) [-2477.101] -- 0:04:02 296500 -- (-2468.418) (-2477.828) (-2471.883) [-2467.420] * (-2491.478) (-2479.826) (-2474.527) [-2475.180] -- 0:04:04 297000 -- (-2477.451) (-2474.806) [-2471.888] (-2483.293) * (-2489.858) (-2484.995) [-2469.068] (-2484.452) -- 0:04:03 297500 -- (-2471.461) [-2466.904] (-2473.376) (-2479.038) * (-2476.856) [-2475.081] (-2477.050) (-2481.252) -- 0:04:03 298000 -- (-2476.644) (-2469.148) (-2470.503) [-2467.881] * (-2480.125) [-2474.060] (-2476.006) (-2493.804) -- 0:04:02 298500 -- (-2481.770) (-2475.573) (-2476.455) [-2474.280] * (-2475.736) (-2491.028) [-2470.291] (-2476.699) -- 0:04:02 299000 -- (-2475.291) (-2472.201) [-2464.449] (-2480.152) * [-2466.265] (-2484.413) (-2473.946) (-2480.852) -- 0:04:01 299500 -- (-2470.974) (-2478.328) (-2464.485) [-2473.982] * (-2471.859) (-2477.601) [-2479.236] (-2473.052) -- 0:04:03 300000 -- (-2478.465) (-2465.051) [-2473.423] (-2486.896) * (-2473.289) (-2472.928) (-2467.652) [-2471.539] -- 0:04:02 Average standard deviation of split frequencies: 0.015679 300500 -- (-2488.712) [-2468.655] (-2477.273) (-2473.554) * (-2490.011) (-2465.960) (-2472.757) [-2467.834] -- 0:04:02 301000 -- (-2475.456) (-2471.997) [-2473.009] (-2474.288) * (-2485.884) (-2472.734) (-2476.581) [-2471.610] -- 0:04:01 301500 -- (-2473.645) (-2475.055) [-2475.358] (-2483.741) * (-2482.331) (-2483.886) (-2483.098) [-2468.388] -- 0:04:00 302000 -- (-2472.465) (-2479.311) [-2473.350] (-2477.889) * (-2490.561) (-2470.010) (-2480.916) [-2477.330] -- 0:04:00 302500 -- (-2475.737) [-2475.493] (-2482.689) (-2478.673) * (-2482.954) (-2473.118) (-2471.259) [-2474.045] -- 0:03:59 303000 -- (-2471.269) (-2489.495) [-2474.878] (-2490.018) * [-2469.217] (-2473.372) (-2477.638) (-2482.805) -- 0:04:01 303500 -- (-2468.420) (-2490.223) [-2480.724] (-2477.134) * [-2466.671] (-2469.252) (-2470.379) (-2472.002) -- 0:04:00 304000 -- (-2468.091) [-2469.786] (-2478.692) (-2491.477) * (-2468.284) (-2475.521) [-2466.261] (-2472.295) -- 0:04:00 304500 -- [-2479.160] (-2472.916) (-2482.600) (-2481.475) * (-2468.112) (-2475.001) [-2474.738] (-2485.738) -- 0:03:59 305000 -- (-2482.365) (-2487.810) (-2474.136) [-2474.751] * [-2471.137] (-2479.485) (-2479.157) (-2482.565) -- 0:03:59 Average standard deviation of split frequencies: 0.015097 305500 -- (-2467.847) (-2493.513) [-2473.600] (-2475.302) * (-2469.972) [-2467.759] (-2470.149) (-2475.771) -- 0:03:58 306000 -- [-2467.274] (-2472.470) (-2475.689) (-2483.087) * (-2479.942) [-2471.956] (-2465.830) (-2468.966) -- 0:04:00 306500 -- [-2466.013] (-2473.480) (-2476.347) (-2477.153) * [-2482.598] (-2480.319) (-2479.270) (-2473.677) -- 0:03:59 307000 -- [-2467.018] (-2477.937) (-2474.030) (-2473.497) * (-2471.474) [-2471.315] (-2482.145) (-2477.237) -- 0:03:59 307500 -- (-2476.692) (-2479.052) [-2474.781] (-2482.277) * (-2474.440) [-2470.367] (-2480.486) (-2474.862) -- 0:03:58 308000 -- (-2475.018) [-2472.029] (-2473.767) (-2476.266) * (-2473.119) (-2466.713) (-2481.614) [-2471.538] -- 0:03:58 308500 -- [-2469.629] (-2484.616) (-2482.453) (-2487.041) * [-2468.413] (-2484.519) (-2471.706) (-2478.674) -- 0:03:59 309000 -- (-2472.963) [-2477.169] (-2489.140) (-2492.841) * [-2475.194] (-2470.536) (-2478.479) (-2480.536) -- 0:03:59 309500 -- (-2481.832) (-2480.448) [-2471.978] (-2475.054) * (-2485.150) [-2469.236] (-2468.837) (-2487.508) -- 0:03:58 310000 -- (-2464.766) (-2468.769) [-2468.655] (-2490.061) * (-2469.521) (-2474.667) (-2467.742) [-2477.958] -- 0:03:58 Average standard deviation of split frequencies: 0.015983 310500 -- (-2479.844) (-2468.881) [-2473.832] (-2480.942) * [-2473.261] (-2474.165) (-2473.876) (-2487.079) -- 0:03:57 311000 -- (-2479.365) (-2473.979) [-2474.721] (-2490.721) * (-2476.914) [-2468.337] (-2476.162) (-2479.818) -- 0:03:57 311500 -- (-2480.487) [-2468.535] (-2478.628) (-2491.216) * (-2486.973) [-2465.980] (-2470.143) (-2467.555) -- 0:03:58 312000 -- (-2475.191) (-2467.253) (-2482.543) [-2475.963] * (-2482.953) (-2475.286) [-2469.045] (-2475.872) -- 0:03:58 312500 -- (-2485.924) (-2477.880) [-2475.837] (-2481.736) * (-2473.342) (-2482.619) (-2479.245) [-2469.779] -- 0:03:57 313000 -- (-2475.024) (-2478.282) (-2481.064) [-2471.443] * (-2479.866) (-2476.663) (-2474.045) [-2472.085] -- 0:03:57 313500 -- (-2474.353) (-2471.472) [-2475.312] (-2477.364) * (-2484.396) (-2470.696) [-2476.182] (-2474.732) -- 0:03:56 314000 -- [-2477.581] (-2479.927) (-2471.643) (-2472.088) * [-2475.616] (-2469.146) (-2486.773) (-2465.297) -- 0:03:55 314500 -- (-2481.585) [-2480.851] (-2474.079) (-2480.605) * (-2473.394) (-2469.055) [-2472.812] (-2468.488) -- 0:03:55 315000 -- (-2474.730) (-2486.488) (-2481.261) [-2475.354] * (-2488.683) (-2470.944) [-2471.320] (-2475.560) -- 0:03:57 Average standard deviation of split frequencies: 0.015614 315500 -- (-2479.995) (-2473.752) (-2474.436) [-2469.605] * [-2474.782] (-2469.497) (-2470.354) (-2478.629) -- 0:03:56 316000 -- (-2478.595) [-2471.877] (-2482.647) (-2468.253) * (-2485.633) (-2479.825) [-2469.424] (-2487.965) -- 0:03:55 316500 -- [-2466.124] (-2490.034) (-2482.134) (-2475.699) * (-2490.686) [-2478.644] (-2474.152) (-2470.105) -- 0:03:55 317000 -- (-2468.114) (-2483.145) [-2468.222] (-2478.896) * [-2473.583] (-2464.737) (-2478.308) (-2479.459) -- 0:03:54 317500 -- [-2466.718] (-2477.405) (-2475.996) (-2474.886) * (-2482.119) [-2472.379] (-2469.975) (-2481.600) -- 0:03:56 318000 -- [-2467.024] (-2474.219) (-2469.715) (-2493.491) * (-2471.357) (-2475.427) [-2468.521] (-2479.846) -- 0:03:55 318500 -- (-2471.543) (-2477.092) [-2473.570] (-2477.398) * (-2479.793) (-2483.591) [-2471.435] (-2476.483) -- 0:03:55 319000 -- (-2477.909) (-2472.533) (-2473.355) [-2472.038] * (-2474.385) (-2479.753) [-2472.491] (-2483.499) -- 0:03:54 319500 -- (-2481.367) (-2469.509) [-2469.235] (-2475.127) * [-2472.212] (-2474.973) (-2479.961) (-2498.721) -- 0:03:54 320000 -- [-2476.908] (-2479.436) (-2470.449) (-2467.856) * (-2470.066) (-2471.684) [-2478.608] (-2474.906) -- 0:03:53 Average standard deviation of split frequencies: 0.015191 320500 -- (-2476.769) (-2485.689) [-2474.607] (-2473.715) * (-2475.578) (-2471.042) (-2479.926) [-2470.534] -- 0:03:55 321000 -- (-2474.664) (-2479.185) (-2476.068) [-2483.510] * [-2472.409] (-2471.586) (-2477.518) (-2467.554) -- 0:03:54 321500 -- (-2471.819) (-2475.340) [-2477.953] (-2475.171) * (-2482.718) (-2466.870) (-2472.478) [-2466.464] -- 0:03:54 322000 -- (-2475.094) (-2484.273) [-2474.512] (-2474.774) * (-2463.249) [-2468.675] (-2472.961) (-2482.047) -- 0:03:53 322500 -- [-2477.715] (-2477.816) (-2477.646) (-2469.721) * (-2484.390) [-2465.368] (-2474.260) (-2472.494) -- 0:03:55 323000 -- (-2478.350) (-2480.842) (-2490.617) [-2472.009] * (-2483.439) (-2472.154) (-2471.918) [-2483.473] -- 0:03:54 323500 -- (-2477.443) (-2480.055) [-2472.946] (-2480.151) * (-2472.869) (-2478.641) [-2471.544] (-2484.075) -- 0:03:54 324000 -- (-2475.976) (-2486.933) (-2472.583) [-2469.979] * (-2479.674) [-2482.133] (-2469.650) (-2478.404) -- 0:03:53 324500 -- (-2482.191) (-2473.274) (-2473.886) [-2472.116] * (-2473.716) (-2483.465) (-2477.542) [-2465.139] -- 0:03:53 325000 -- (-2479.187) (-2475.384) (-2480.382) [-2474.283] * (-2478.841) (-2481.617) (-2475.422) [-2477.151] -- 0:03:52 Average standard deviation of split frequencies: 0.017642 325500 -- (-2479.679) (-2480.529) (-2474.580) [-2476.770] * (-2472.480) (-2476.862) (-2476.370) [-2475.489] -- 0:03:54 326000 -- [-2475.689] (-2477.982) (-2480.007) (-2475.565) * (-2475.563) (-2474.404) (-2474.402) [-2479.137] -- 0:03:53 326500 -- (-2485.300) (-2471.599) (-2478.787) [-2480.817] * (-2480.136) (-2477.386) (-2470.778) [-2468.469] -- 0:03:53 327000 -- [-2471.867] (-2470.904) (-2484.768) (-2468.917) * (-2483.430) (-2475.949) (-2486.897) [-2468.307] -- 0:03:52 327500 -- [-2475.625] (-2482.843) (-2481.882) (-2480.703) * [-2467.659] (-2472.992) (-2483.672) (-2471.023) -- 0:03:52 328000 -- (-2472.367) (-2478.473) [-2480.176] (-2469.717) * (-2480.918) (-2465.083) (-2483.434) [-2468.323] -- 0:03:51 328500 -- (-2475.546) (-2480.052) (-2485.442) [-2476.627] * (-2479.433) [-2463.265] (-2472.727) (-2481.903) -- 0:03:50 329000 -- (-2476.288) [-2467.680] (-2480.958) (-2479.313) * (-2480.609) [-2464.501] (-2470.112) (-2478.942) -- 0:03:52 329500 -- (-2477.605) [-2483.210] (-2477.738) (-2474.110) * (-2474.292) (-2479.488) [-2468.272] (-2472.785) -- 0:03:51 330000 -- (-2477.893) [-2479.637] (-2477.872) (-2472.647) * (-2470.460) (-2497.563) [-2473.856] (-2475.938) -- 0:03:51 Average standard deviation of split frequencies: 0.018248 330500 -- (-2472.804) [-2482.562] (-2486.953) (-2483.553) * [-2470.417] (-2490.813) (-2468.624) (-2472.807) -- 0:03:50 331000 -- [-2464.951] (-2479.397) (-2483.363) (-2472.505) * (-2469.669) (-2479.588) [-2475.743] (-2478.143) -- 0:03:52 331500 -- [-2465.251] (-2486.902) (-2477.067) (-2479.118) * (-2475.866) (-2478.502) (-2473.757) [-2474.434] -- 0:03:51 332000 -- (-2462.499) [-2489.927] (-2489.931) (-2485.453) * (-2476.593) (-2502.483) (-2482.761) [-2476.151] -- 0:03:51 332500 -- [-2477.458] (-2472.996) (-2482.171) (-2472.029) * (-2470.721) (-2475.112) (-2476.105) [-2468.992] -- 0:03:50 333000 -- (-2478.871) (-2482.159) (-2486.234) [-2469.328] * (-2462.763) (-2491.620) (-2486.739) [-2470.018] -- 0:03:52 333500 -- (-2483.222) (-2484.268) [-2471.311] (-2485.091) * (-2470.405) [-2472.512] (-2480.320) (-2474.963) -- 0:03:51 334000 -- (-2472.593) (-2474.415) [-2468.274] (-2494.602) * [-2475.886] (-2484.893) (-2481.920) (-2479.887) -- 0:03:51 334500 -- [-2468.861] (-2478.925) (-2476.280) (-2489.351) * (-2481.564) (-2480.210) (-2475.311) [-2473.085] -- 0:03:50 335000 -- (-2469.177) [-2466.276] (-2480.318) (-2486.477) * (-2480.415) (-2479.622) [-2475.935] (-2490.933) -- 0:03:50 Average standard deviation of split frequencies: 0.017187 335500 -- [-2467.033] (-2479.322) (-2473.001) (-2488.327) * (-2479.911) (-2481.608) (-2469.571) [-2472.145] -- 0:03:49 336000 -- (-2479.869) (-2477.826) (-2485.277) [-2475.030] * [-2474.740] (-2494.306) (-2471.076) (-2469.137) -- 0:03:49 336500 -- (-2485.375) [-2483.176] (-2488.674) (-2490.079) * [-2479.164] (-2486.001) (-2469.742) (-2484.710) -- 0:03:50 337000 -- [-2466.981] (-2466.910) (-2474.079) (-2483.605) * (-2475.714) (-2473.568) [-2473.020] (-2482.081) -- 0:03:50 337500 -- (-2473.182) (-2478.738) (-2479.531) [-2476.205] * (-2490.428) [-2471.559] (-2469.386) (-2480.818) -- 0:03:49 338000 -- (-2470.500) (-2480.874) (-2476.631) [-2470.126] * (-2474.455) (-2482.886) [-2473.897] (-2466.920) -- 0:03:49 338500 -- [-2465.581] (-2476.894) (-2468.871) (-2472.799) * (-2481.619) (-2478.604) (-2473.711) [-2463.286] -- 0:03:48 339000 -- (-2477.385) [-2472.651] (-2480.546) (-2477.258) * (-2473.967) (-2480.830) [-2467.202] (-2468.433) -- 0:03:48 339500 -- (-2472.699) (-2489.084) (-2487.394) [-2480.131] * (-2486.358) [-2470.814] (-2470.655) (-2482.493) -- 0:03:49 340000 -- (-2483.508) [-2466.482] (-2474.460) (-2482.246) * (-2497.448) (-2471.856) [-2471.252] (-2474.353) -- 0:03:49 Average standard deviation of split frequencies: 0.015221 340500 -- (-2473.538) (-2469.019) (-2477.240) [-2472.335] * [-2479.496] (-2470.626) (-2467.286) (-2477.294) -- 0:03:48 341000 -- [-2473.124] (-2475.782) (-2483.230) (-2475.934) * (-2483.762) (-2479.393) [-2477.085] (-2480.202) -- 0:03:48 341500 -- (-2467.246) [-2484.327] (-2482.378) (-2479.738) * (-2484.446) (-2487.741) [-2470.796] (-2475.553) -- 0:03:47 342000 -- (-2478.853) (-2485.647) [-2478.543] (-2473.657) * (-2491.076) (-2480.261) (-2472.491) [-2465.890] -- 0:03:47 342500 -- [-2467.227] (-2481.672) (-2473.401) (-2473.027) * (-2484.160) (-2475.340) [-2476.789] (-2479.484) -- 0:03:48 343000 -- (-2471.061) (-2474.328) [-2478.378] (-2471.598) * (-2482.783) (-2476.753) [-2475.761] (-2479.939) -- 0:03:47 343500 -- (-2470.332) (-2474.517) (-2471.449) [-2469.104] * (-2468.945) (-2483.435) (-2481.073) [-2468.640] -- 0:03:47 344000 -- (-2478.265) (-2469.833) (-2475.724) [-2474.030] * (-2475.415) [-2474.096] (-2476.176) (-2474.986) -- 0:03:46 344500 -- [-2477.586] (-2476.145) (-2483.661) (-2479.517) * (-2471.168) (-2466.565) [-2466.740] (-2466.538) -- 0:03:46 345000 -- [-2479.089] (-2481.336) (-2482.072) (-2484.272) * (-2468.212) (-2472.783) (-2469.932) [-2473.707] -- 0:03:45 Average standard deviation of split frequencies: 0.016264 345500 -- (-2469.403) [-2473.402] (-2477.174) (-2477.817) * (-2470.393) (-2473.490) [-2465.063] (-2482.398) -- 0:03:45 346000 -- [-2486.194] (-2480.120) (-2479.078) (-2479.232) * (-2471.532) [-2476.224] (-2478.828) (-2489.176) -- 0:03:46 346500 -- (-2477.332) [-2470.462] (-2488.310) (-2479.281) * [-2472.916] (-2472.793) (-2475.760) (-2477.359) -- 0:03:46 347000 -- (-2469.259) (-2485.902) [-2482.917] (-2473.902) * (-2470.450) [-2466.096] (-2470.351) (-2464.601) -- 0:03:45 347500 -- (-2478.299) (-2482.512) (-2503.147) [-2476.169] * (-2479.340) [-2472.294] (-2463.011) (-2473.982) -- 0:03:45 348000 -- [-2469.056] (-2472.056) (-2477.625) (-2473.551) * (-2475.190) [-2477.415] (-2466.656) (-2484.254) -- 0:03:46 348500 -- (-2474.201) [-2476.951] (-2469.968) (-2484.416) * (-2475.499) (-2475.423) [-2478.858] (-2490.274) -- 0:03:46 349000 -- [-2471.179] (-2485.425) (-2482.876) (-2481.005) * [-2467.559] (-2482.291) (-2478.091) (-2485.807) -- 0:03:45 349500 -- [-2470.977] (-2487.560) (-2482.464) (-2474.481) * (-2472.190) [-2479.985] (-2475.905) (-2477.140) -- 0:03:45 350000 -- [-2469.425] (-2478.882) (-2471.012) (-2481.427) * (-2480.731) (-2479.583) [-2474.362] (-2487.447) -- 0:03:44 Average standard deviation of split frequencies: 0.015952 350500 -- (-2474.823) (-2468.336) (-2486.800) [-2473.239] * (-2475.868) (-2478.695) [-2468.112] (-2477.973) -- 0:03:44 351000 -- (-2475.772) (-2472.489) [-2470.552] (-2470.505) * [-2471.441] (-2480.328) (-2471.391) (-2476.986) -- 0:03:43 351500 -- (-2479.791) [-2472.277] (-2470.289) (-2467.174) * [-2475.495] (-2483.463) (-2475.384) (-2475.802) -- 0:03:45 352000 -- (-2483.865) (-2468.990) [-2465.414] (-2477.439) * (-2478.547) (-2492.296) [-2477.243] (-2478.216) -- 0:03:44 352500 -- (-2479.328) (-2483.793) (-2468.846) [-2478.947] * [-2471.451] (-2476.397) (-2474.147) (-2484.206) -- 0:03:44 353000 -- [-2473.112] (-2475.492) (-2469.218) (-2475.459) * [-2468.685] (-2482.569) (-2470.685) (-2482.477) -- 0:03:43 353500 -- (-2477.577) (-2469.110) [-2474.097] (-2478.337) * (-2491.420) (-2475.063) (-2467.795) [-2466.180] -- 0:03:43 354000 -- (-2470.902) [-2466.903] (-2479.531) (-2473.355) * (-2473.564) [-2473.559] (-2476.888) (-2472.170) -- 0:03:42 354500 -- [-2471.104] (-2478.553) (-2475.896) (-2464.852) * (-2462.943) [-2473.499] (-2478.099) (-2479.676) -- 0:03:43 355000 -- (-2483.076) (-2480.902) [-2471.949] (-2477.860) * (-2482.155) (-2473.259) [-2475.675] (-2492.739) -- 0:03:43 Average standard deviation of split frequencies: 0.016861 355500 -- [-2473.279] (-2491.407) (-2482.759) (-2473.661) * [-2466.692] (-2470.117) (-2465.524) (-2476.543) -- 0:03:42 356000 -- (-2475.784) (-2483.773) [-2472.394] (-2473.819) * [-2470.558] (-2475.113) (-2481.853) (-2489.178) -- 0:03:42 356500 -- (-2470.953) (-2491.011) [-2468.555] (-2482.425) * (-2467.767) (-2481.706) [-2477.580] (-2482.521) -- 0:03:42 357000 -- (-2469.246) (-2481.951) [-2466.819] (-2481.930) * (-2476.564) (-2477.010) (-2489.570) [-2466.248] -- 0:03:41 357500 -- (-2481.053) (-2492.340) (-2477.059) [-2473.868] * (-2486.806) (-2480.154) [-2476.047] (-2467.972) -- 0:03:41 358000 -- (-2474.894) (-2484.597) [-2477.112] (-2466.984) * (-2478.121) (-2482.664) (-2475.551) [-2477.280] -- 0:03:42 358500 -- (-2469.483) (-2469.513) [-2477.824] (-2475.603) * (-2466.537) [-2479.702] (-2486.575) (-2477.897) -- 0:03:41 359000 -- (-2474.482) (-2469.951) [-2477.434] (-2475.982) * [-2483.451] (-2477.352) (-2483.360) (-2468.337) -- 0:03:41 359500 -- (-2475.489) (-2486.296) (-2470.144) [-2476.449] * [-2471.491] (-2482.307) (-2482.286) (-2475.229) -- 0:03:40 360000 -- (-2475.356) [-2481.638] (-2480.688) (-2474.340) * (-2482.991) (-2468.705) (-2477.408) [-2484.404] -- 0:03:42 Average standard deviation of split frequencies: 0.016817 360500 -- (-2478.467) (-2480.133) (-2478.447) [-2480.154] * (-2481.877) (-2475.949) [-2483.818] (-2479.264) -- 0:03:41 361000 -- (-2474.464) [-2473.129] (-2473.948) (-2476.743) * (-2476.348) (-2469.713) [-2476.738] (-2478.343) -- 0:03:41 361500 -- (-2477.084) [-2470.803] (-2466.293) (-2475.824) * (-2477.044) [-2469.441] (-2485.113) (-2472.215) -- 0:03:40 362000 -- (-2467.815) (-2472.418) (-2483.551) [-2471.134] * (-2483.580) (-2473.184) (-2465.938) [-2478.957] -- 0:03:40 362500 -- [-2466.309] (-2474.804) (-2469.941) (-2475.844) * (-2479.035) [-2471.213] (-2471.562) (-2473.476) -- 0:03:41 363000 -- (-2480.531) (-2475.948) [-2472.956] (-2474.569) * (-2480.657) (-2478.496) (-2476.523) [-2479.768] -- 0:03:41 363500 -- [-2461.682] (-2482.041) (-2480.434) (-2481.018) * (-2476.398) (-2484.190) [-2473.493] (-2474.964) -- 0:03:40 364000 -- (-2476.823) [-2481.897] (-2474.764) (-2470.728) * (-2485.065) (-2481.699) [-2476.145] (-2477.050) -- 0:03:40 364500 -- (-2478.723) (-2482.748) [-2480.059] (-2476.489) * (-2476.555) (-2471.910) (-2482.486) [-2469.477] -- 0:03:39 365000 -- [-2464.510] (-2477.286) (-2476.332) (-2483.284) * (-2472.574) (-2479.272) (-2486.277) [-2477.877] -- 0:03:40 Average standard deviation of split frequencies: 0.016916 365500 -- [-2468.768] (-2484.222) (-2468.789) (-2469.227) * (-2486.977) [-2466.462] (-2476.458) (-2470.037) -- 0:03:40 366000 -- (-2478.778) (-2472.059) (-2478.936) [-2475.590] * (-2486.786) (-2478.843) [-2476.013] (-2465.871) -- 0:03:39 366500 -- (-2486.611) [-2468.210] (-2474.204) (-2495.187) * (-2480.846) [-2472.349] (-2465.585) (-2474.001) -- 0:03:39 367000 -- (-2467.701) (-2488.888) [-2473.285] (-2473.705) * (-2476.563) (-2478.583) (-2474.098) [-2475.674] -- 0:03:39 367500 -- [-2466.577] (-2485.392) (-2469.263) (-2477.925) * (-2477.030) [-2469.239] (-2476.341) (-2475.402) -- 0:03:38 368000 -- (-2472.282) (-2491.951) [-2462.038] (-2467.330) * (-2474.830) [-2469.068] (-2481.286) (-2467.744) -- 0:03:39 368500 -- (-2471.949) (-2475.097) (-2481.111) [-2472.543] * (-2480.056) (-2468.081) (-2480.005) [-2468.563] -- 0:03:39 369000 -- (-2476.746) [-2473.341] (-2487.551) (-2475.641) * (-2468.670) (-2477.253) [-2478.295] (-2476.293) -- 0:03:38 369500 -- [-2477.681] (-2478.081) (-2477.254) (-2477.757) * (-2483.384) (-2482.325) (-2486.216) [-2475.871] -- 0:03:38 370000 -- [-2476.558] (-2470.862) (-2471.372) (-2476.889) * (-2467.309) (-2479.769) (-2487.880) [-2473.861] -- 0:03:37 Average standard deviation of split frequencies: 0.015092 370500 -- (-2473.418) [-2474.149] (-2472.535) (-2479.423) * (-2490.523) (-2474.889) [-2487.081] (-2472.357) -- 0:03:37 371000 -- (-2473.325) (-2483.188) [-2471.276] (-2468.918) * [-2470.425] (-2481.733) (-2486.993) (-2479.350) -- 0:03:38 371500 -- (-2477.465) (-2488.649) (-2477.257) [-2476.982] * [-2473.300] (-2480.850) (-2486.046) (-2475.652) -- 0:03:38 372000 -- (-2486.715) [-2476.561] (-2474.702) (-2482.708) * (-2479.529) (-2480.810) (-2467.325) [-2465.932] -- 0:03:37 372500 -- (-2485.130) (-2476.636) (-2485.708) [-2475.500] * (-2478.412) [-2477.233] (-2472.962) (-2477.417) -- 0:03:37 373000 -- (-2483.887) (-2486.802) [-2465.289] (-2486.624) * (-2470.528) (-2483.107) [-2475.312] (-2477.613) -- 0:03:36 373500 -- (-2482.198) (-2471.933) [-2479.487] (-2485.851) * (-2465.022) [-2473.480] (-2467.500) (-2488.967) -- 0:03:36 374000 -- (-2480.827) (-2465.788) (-2481.824) [-2478.450] * [-2468.819] (-2487.149) (-2467.941) (-2469.384) -- 0:03:35 374500 -- (-2489.712) (-2479.285) [-2474.535] (-2475.901) * (-2473.266) (-2474.630) (-2472.808) [-2474.637] -- 0:03:37 375000 -- (-2476.256) (-2476.846) [-2474.950] (-2474.420) * [-2484.706] (-2475.054) (-2474.073) (-2500.581) -- 0:03:36 Average standard deviation of split frequencies: 0.015672 375500 -- (-2479.496) [-2473.852] (-2475.103) (-2468.994) * (-2477.122) (-2483.376) (-2481.166) [-2476.793] -- 0:03:36 376000 -- (-2476.064) (-2481.345) [-2469.783] (-2475.952) * (-2478.889) (-2464.382) [-2470.725] (-2491.316) -- 0:03:35 376500 -- [-2472.392] (-2475.244) (-2462.739) (-2476.200) * (-2472.336) (-2472.764) [-2467.612] (-2477.759) -- 0:03:35 377000 -- (-2491.896) (-2496.155) [-2473.112] (-2479.062) * (-2479.457) (-2477.730) [-2471.261] (-2487.457) -- 0:03:36 377500 -- (-2471.051) (-2484.962) [-2462.980] (-2476.373) * (-2465.159) [-2474.931] (-2478.820) (-2486.035) -- 0:03:36 378000 -- (-2473.052) (-2481.593) (-2482.237) [-2469.629] * (-2472.209) [-2477.781] (-2484.701) (-2475.951) -- 0:03:35 378500 -- (-2481.353) [-2469.273] (-2471.925) (-2484.709) * [-2467.281] (-2480.019) (-2476.922) (-2467.965) -- 0:03:35 379000 -- (-2477.238) (-2463.903) (-2485.589) [-2470.321] * (-2473.203) (-2480.999) (-2469.878) [-2469.938] -- 0:03:34 379500 -- (-2474.856) (-2472.428) (-2490.745) [-2475.309] * (-2475.903) (-2470.531) (-2478.749) [-2476.022] -- 0:03:34 380000 -- (-2472.796) [-2465.723] (-2474.861) (-2471.693) * (-2478.367) (-2476.538) (-2484.091) [-2471.801] -- 0:03:35 Average standard deviation of split frequencies: 0.016254 380500 -- (-2473.534) [-2465.104] (-2483.527) (-2475.326) * (-2474.670) [-2476.104] (-2478.315) (-2485.266) -- 0:03:34 381000 -- (-2473.315) (-2472.727) [-2466.921] (-2485.078) * [-2469.733] (-2465.579) (-2474.604) (-2474.550) -- 0:03:34 381500 -- [-2472.345] (-2477.718) (-2476.003) (-2485.590) * (-2477.824) (-2473.404) [-2478.347] (-2482.976) -- 0:03:34 382000 -- (-2461.728) [-2467.969] (-2471.691) (-2480.589) * (-2472.812) (-2472.410) (-2482.511) [-2465.633] -- 0:03:33 382500 -- (-2473.307) [-2479.530] (-2476.696) (-2482.064) * (-2503.053) (-2472.702) [-2470.278] (-2466.535) -- 0:03:33 383000 -- (-2471.096) (-2476.092) [-2472.716] (-2480.327) * (-2494.973) (-2476.082) (-2468.648) [-2470.194] -- 0:03:34 383500 -- (-2469.407) (-2473.032) (-2471.743) [-2479.585] * (-2492.684) (-2479.935) [-2469.617] (-2495.143) -- 0:03:33 384000 -- (-2475.067) (-2466.968) [-2473.038] (-2477.478) * (-2480.755) (-2474.470) (-2476.425) [-2476.737] -- 0:03:33 384500 -- [-2463.300] (-2468.071) (-2476.803) (-2479.437) * (-2482.157) (-2473.907) [-2484.995] (-2481.007) -- 0:03:32 385000 -- (-2473.751) [-2471.759] (-2479.024) (-2475.209) * (-2487.278) (-2481.284) [-2468.707] (-2478.668) -- 0:03:34 Average standard deviation of split frequencies: 0.015571 385500 -- (-2470.454) (-2471.410) (-2476.715) [-2475.539] * [-2479.771] (-2496.034) (-2473.407) (-2482.576) -- 0:03:33 386000 -- (-2466.019) (-2485.070) (-2472.105) [-2469.530] * (-2483.826) (-2475.340) [-2467.439] (-2489.729) -- 0:03:33 386500 -- [-2472.342] (-2472.541) (-2477.588) (-2478.739) * (-2483.666) (-2477.105) (-2474.783) [-2475.836] -- 0:03:32 387000 -- (-2492.315) (-2470.884) (-2480.977) [-2470.913] * (-2473.792) [-2475.875] (-2480.730) (-2487.397) -- 0:03:32 387500 -- (-2471.302) (-2483.235) (-2480.569) [-2475.405] * (-2481.561) [-2477.386] (-2473.150) (-2477.892) -- 0:03:31 388000 -- (-2468.263) (-2479.116) [-2478.210] (-2473.912) * (-2480.311) (-2480.506) (-2484.736) [-2473.991] -- 0:03:31 388500 -- (-2492.323) (-2476.186) [-2474.404] (-2473.100) * [-2470.503] (-2483.591) (-2481.726) (-2470.372) -- 0:03:32 389000 -- (-2469.818) (-2476.504) (-2474.711) [-2461.049] * [-2471.806] (-2476.998) (-2478.696) (-2480.779) -- 0:03:32 389500 -- [-2469.487] (-2473.817) (-2466.492) (-2476.981) * [-2474.999] (-2484.402) (-2475.132) (-2477.073) -- 0:03:31 390000 -- (-2480.104) (-2485.096) [-2472.362] (-2467.244) * [-2475.124] (-2470.057) (-2475.795) (-2469.049) -- 0:03:31 Average standard deviation of split frequencies: 0.015928 390500 -- [-2470.104] (-2484.988) (-2464.333) (-2480.518) * (-2475.902) (-2468.381) (-2483.012) [-2468.792] -- 0:03:30 391000 -- (-2469.610) (-2483.512) [-2469.357] (-2479.483) * (-2478.176) (-2489.296) (-2486.272) [-2474.453] -- 0:03:30 391500 -- [-2475.539] (-2479.395) (-2472.081) (-2480.877) * (-2469.062) (-2493.717) (-2489.559) [-2474.912] -- 0:03:31 392000 -- (-2482.790) [-2473.821] (-2476.272) (-2485.396) * (-2475.621) (-2479.681) [-2465.197] (-2477.602) -- 0:03:30 392500 -- (-2485.354) (-2482.500) (-2482.446) [-2466.251] * (-2486.630) [-2468.996] (-2475.040) (-2483.982) -- 0:03:30 393000 -- (-2469.298) (-2483.829) (-2492.006) [-2475.434] * (-2471.746) [-2473.882] (-2470.890) (-2473.378) -- 0:03:30 393500 -- (-2474.682) (-2474.253) (-2479.638) [-2469.661] * [-2470.360] (-2488.397) (-2469.594) (-2481.330) -- 0:03:29 394000 -- [-2482.836] (-2475.168) (-2480.946) (-2479.548) * [-2468.832] (-2480.511) (-2481.095) (-2467.321) -- 0:03:29 394500 -- (-2472.391) (-2467.652) [-2470.147] (-2477.581) * (-2473.748) (-2491.808) [-2466.160] (-2471.399) -- 0:03:30 395000 -- (-2479.734) [-2473.467] (-2467.989) (-2472.814) * (-2479.093) (-2480.896) [-2470.012] (-2471.239) -- 0:03:29 Average standard deviation of split frequencies: 0.016031 395500 -- (-2472.010) (-2467.546) (-2471.619) [-2473.179] * (-2468.494) [-2471.600] (-2467.938) (-2476.467) -- 0:03:29 396000 -- (-2495.620) (-2474.645) (-2475.893) [-2471.361] * (-2471.496) [-2471.017] (-2475.972) (-2482.641) -- 0:03:28 396500 -- (-2477.429) (-2475.200) (-2473.839) [-2475.838] * (-2483.115) [-2465.940] (-2468.609) (-2478.808) -- 0:03:28 397000 -- [-2468.393] (-2477.332) (-2469.201) (-2481.388) * (-2476.118) (-2465.881) [-2470.587] (-2475.719) -- 0:03:28 397500 -- (-2470.658) (-2471.906) [-2475.235] (-2481.907) * (-2485.437) [-2469.437] (-2469.342) (-2484.470) -- 0:03:27 398000 -- [-2473.001] (-2474.584) (-2471.872) (-2502.096) * (-2495.091) (-2489.408) (-2475.324) [-2473.699] -- 0:03:28 398500 -- [-2473.845] (-2477.393) (-2492.657) (-2481.187) * [-2473.385] (-2483.140) (-2481.465) (-2467.982) -- 0:03:28 399000 -- [-2471.987] (-2477.457) (-2475.938) (-2491.167) * (-2483.570) (-2478.217) [-2472.994] (-2479.505) -- 0:03:27 399500 -- (-2472.274) (-2466.947) [-2467.267] (-2470.556) * (-2482.954) [-2479.248] (-2477.919) (-2471.673) -- 0:03:27 400000 -- (-2482.176) [-2465.284] (-2480.805) (-2482.509) * (-2488.281) (-2480.412) [-2474.443] (-2476.513) -- 0:03:27 Average standard deviation of split frequencies: 0.015060 400500 -- (-2481.089) [-2471.190] (-2484.323) (-2479.704) * [-2469.648] (-2477.243) (-2480.180) (-2478.735) -- 0:03:26 401000 -- (-2463.985) (-2484.181) (-2471.038) [-2487.509] * (-2475.520) (-2501.410) (-2474.648) [-2472.344] -- 0:03:27 401500 -- [-2473.382] (-2478.671) (-2481.741) (-2495.707) * [-2472.507] (-2493.716) (-2477.490) (-2475.824) -- 0:03:27 402000 -- [-2482.194] (-2478.511) (-2476.267) (-2488.088) * (-2477.967) (-2473.959) [-2471.259] (-2474.233) -- 0:03:26 402500 -- (-2487.368) (-2495.360) [-2470.472] (-2486.720) * (-2481.766) [-2475.797] (-2475.361) (-2476.701) -- 0:03:26 403000 -- (-2485.031) (-2499.635) (-2471.840) [-2478.354] * (-2488.444) (-2472.052) [-2464.752] (-2475.217) -- 0:03:25 403500 -- (-2480.558) (-2470.964) [-2466.891] (-2481.512) * (-2482.133) (-2492.059) [-2477.329] (-2475.256) -- 0:03:25 404000 -- (-2483.098) (-2475.429) [-2468.957] (-2476.183) * (-2492.051) [-2469.459] (-2485.885) (-2474.656) -- 0:03:26 404500 -- (-2476.205) (-2482.609) [-2476.211] (-2476.390) * (-2473.630) (-2468.554) (-2479.656) [-2466.859] -- 0:03:26 405000 -- (-2467.970) (-2473.284) (-2473.005) [-2471.290] * (-2482.284) (-2474.705) (-2476.333) [-2475.591] -- 0:03:25 Average standard deviation of split frequencies: 0.014514 405500 -- (-2466.904) (-2489.152) (-2470.592) [-2473.293] * (-2484.205) (-2471.330) [-2475.534] (-2477.089) -- 0:03:25 406000 -- (-2480.884) (-2487.427) [-2473.983] (-2476.022) * (-2472.489) [-2474.881] (-2482.506) (-2468.791) -- 0:03:24 406500 -- (-2477.385) (-2476.907) [-2469.207] (-2480.691) * (-2467.017) (-2483.924) (-2472.897) [-2469.167] -- 0:03:25 407000 -- (-2476.225) [-2466.926] (-2474.858) (-2470.904) * (-2472.700) [-2473.434] (-2488.970) (-2471.987) -- 0:03:25 407500 -- [-2466.887] (-2470.574) (-2482.404) (-2487.186) * [-2468.869] (-2477.560) (-2485.445) (-2467.549) -- 0:03:25 408000 -- [-2468.073] (-2475.365) (-2469.605) (-2474.589) * (-2478.073) (-2486.327) [-2469.595] (-2473.320) -- 0:03:24 408500 -- (-2474.231) (-2478.189) [-2470.748] (-2469.429) * [-2482.746] (-2476.073) (-2471.862) (-2474.501) -- 0:03:24 409000 -- (-2475.925) [-2478.592] (-2472.299) (-2471.739) * (-2482.771) (-2484.887) (-2489.067) [-2469.218] -- 0:03:23 409500 -- (-2488.632) (-2469.259) (-2481.656) [-2476.264] * (-2477.872) (-2480.973) (-2474.352) [-2469.223] -- 0:03:24 410000 -- (-2469.118) (-2478.155) [-2469.864] (-2487.783) * (-2465.912) (-2489.744) (-2473.558) [-2470.771] -- 0:03:24 Average standard deviation of split frequencies: 0.013847 410500 -- [-2473.183] (-2474.024) (-2473.723) (-2477.813) * (-2490.073) (-2490.439) [-2481.751] (-2479.818) -- 0:03:23 411000 -- (-2486.629) (-2473.711) [-2475.262] (-2473.372) * (-2475.898) [-2488.589] (-2466.628) (-2478.704) -- 0:03:23 411500 -- (-2487.234) (-2476.660) [-2469.626] (-2483.054) * (-2468.375) (-2494.201) (-2474.612) [-2476.023] -- 0:03:23 412000 -- (-2481.866) [-2476.264] (-2471.050) (-2494.496) * (-2476.391) (-2492.040) [-2473.360] (-2489.020) -- 0:03:22 412500 -- (-2484.490) (-2473.174) [-2470.266] (-2476.600) * (-2475.871) [-2481.126] (-2484.398) (-2467.026) -- 0:03:23 413000 -- (-2478.438) (-2470.391) (-2464.718) [-2465.474] * (-2486.371) (-2472.721) (-2483.808) [-2479.873] -- 0:03:23 413500 -- (-2467.504) (-2478.850) [-2474.448] (-2474.675) * (-2483.682) (-2475.667) [-2471.431] (-2483.655) -- 0:03:22 414000 -- (-2467.354) (-2470.413) [-2470.723] (-2481.216) * (-2491.437) [-2470.808] (-2473.810) (-2481.354) -- 0:03:22 414500 -- (-2475.597) (-2471.827) [-2467.922] (-2476.698) * (-2476.533) (-2485.397) (-2479.757) [-2469.998] -- 0:03:21 415000 -- (-2485.863) (-2476.211) [-2477.559] (-2468.545) * [-2477.162] (-2477.816) (-2480.030) (-2479.735) -- 0:03:21 Average standard deviation of split frequencies: 0.013900 415500 -- (-2481.451) (-2479.217) [-2475.901] (-2473.624) * (-2473.717) [-2478.393] (-2487.722) (-2479.655) -- 0:03:21 416000 -- (-2487.851) (-2475.428) (-2468.666) [-2472.897] * (-2469.277) [-2469.669] (-2480.118) (-2486.960) -- 0:03:22 416500 -- [-2469.825] (-2473.255) (-2479.614) (-2475.868) * (-2473.309) (-2468.460) (-2484.484) [-2465.397] -- 0:03:21 417000 -- (-2476.858) (-2470.838) [-2469.431] (-2484.845) * [-2471.557] (-2481.317) (-2479.523) (-2471.655) -- 0:03:21 417500 -- (-2474.505) (-2471.801) [-2478.187] (-2487.602) * (-2476.526) (-2475.482) (-2475.243) [-2469.301] -- 0:03:20 418000 -- [-2483.548] (-2475.682) (-2477.748) (-2479.474) * (-2473.620) (-2481.916) (-2475.066) [-2467.685] -- 0:03:20 418500 -- (-2482.312) [-2471.495] (-2468.362) (-2483.972) * (-2476.418) (-2475.318) (-2485.708) [-2475.381] -- 0:03:20 419000 -- (-2473.189) (-2477.550) [-2474.100] (-2477.943) * (-2474.894) (-2482.618) (-2482.872) [-2462.668] -- 0:03:21 419500 -- (-2476.524) (-2478.229) [-2479.508] (-2485.538) * (-2473.516) [-2470.063] (-2481.379) (-2468.648) -- 0:03:20 420000 -- [-2471.557] (-2475.984) (-2483.969) (-2471.130) * (-2486.677) [-2469.544] (-2479.587) (-2480.556) -- 0:03:20 Average standard deviation of split frequencies: 0.014120 420500 -- [-2471.811] (-2477.854) (-2482.840) (-2468.253) * [-2470.624] (-2470.127) (-2496.508) (-2472.427) -- 0:03:19 421000 -- [-2472.841] (-2474.648) (-2483.449) (-2475.027) * (-2475.406) [-2473.689] (-2486.929) (-2473.952) -- 0:03:19 421500 -- (-2484.726) (-2472.439) [-2467.672] (-2474.393) * (-2486.514) (-2484.307) [-2469.998] (-2473.454) -- 0:03:20 422000 -- [-2476.074] (-2473.454) (-2472.433) (-2477.821) * (-2479.970) [-2470.229] (-2491.227) (-2479.241) -- 0:03:19 422500 -- (-2464.950) (-2480.647) [-2464.542] (-2479.130) * [-2474.756] (-2469.735) (-2488.337) (-2479.808) -- 0:03:19 423000 -- (-2475.898) [-2464.745] (-2474.828) (-2473.267) * (-2478.598) [-2474.328] (-2483.598) (-2492.563) -- 0:03:19 423500 -- [-2466.333] (-2481.430) (-2474.003) (-2473.411) * [-2469.935] (-2478.380) (-2472.453) (-2472.452) -- 0:03:18 424000 -- (-2482.468) (-2462.425) [-2484.016] (-2477.369) * (-2476.064) (-2478.889) (-2481.273) [-2471.608] -- 0:03:19 424500 -- (-2478.417) [-2476.789] (-2478.069) (-2485.226) * [-2464.511] (-2480.206) (-2465.303) (-2468.479) -- 0:03:19 425000 -- (-2469.082) (-2480.268) (-2480.757) [-2460.763] * (-2477.006) (-2473.851) (-2476.307) [-2472.024] -- 0:03:18 Average standard deviation of split frequencies: 0.014238 425500 -- [-2472.136] (-2480.870) (-2474.464) (-2481.554) * (-2467.120) (-2471.988) [-2481.706] (-2478.203) -- 0:03:18 426000 -- [-2471.657] (-2483.753) (-2491.660) (-2479.121) * (-2481.527) (-2482.146) (-2474.619) [-2476.399] -- 0:03:18 426500 -- [-2468.881] (-2470.883) (-2478.927) (-2484.026) * (-2470.267) [-2476.202] (-2473.333) (-2484.779) -- 0:03:19 427000 -- (-2471.993) [-2475.545] (-2478.068) (-2485.186) * [-2467.410] (-2475.611) (-2472.664) (-2468.063) -- 0:03:18 427500 -- (-2475.501) (-2473.046) (-2477.463) [-2469.459] * (-2480.480) (-2479.983) (-2475.187) [-2473.346] -- 0:03:18 428000 -- (-2494.665) [-2470.207] (-2480.653) (-2467.089) * (-2481.277) (-2478.951) [-2475.043] (-2489.041) -- 0:03:17 428500 -- (-2494.847) (-2492.635) [-2476.917] (-2471.772) * [-2471.103] (-2467.500) (-2482.824) (-2480.370) -- 0:03:17 429000 -- (-2480.148) [-2474.308] (-2473.519) (-2478.261) * (-2480.867) (-2474.567) (-2485.896) [-2473.235] -- 0:03:16 429500 -- (-2472.615) (-2476.492) [-2472.740] (-2490.731) * [-2485.734] (-2477.142) (-2481.824) (-2467.854) -- 0:03:16 430000 -- [-2467.057] (-2476.222) (-2488.594) (-2472.657) * (-2492.019) (-2476.848) [-2478.658] (-2471.305) -- 0:03:17 Average standard deviation of split frequencies: 0.015324 430500 -- (-2475.278) (-2472.939) (-2488.159) [-2469.351] * (-2485.564) [-2464.260] (-2481.946) (-2463.406) -- 0:03:17 431000 -- (-2477.043) [-2480.621] (-2488.513) (-2485.224) * (-2496.574) (-2490.623) (-2488.370) [-2479.141] -- 0:03:16 431500 -- (-2481.752) (-2475.442) (-2487.581) [-2473.717] * (-2484.656) (-2488.227) [-2477.563] (-2468.958) -- 0:03:16 432000 -- (-2477.916) [-2487.155] (-2478.320) (-2483.047) * (-2483.192) (-2468.696) (-2472.934) [-2473.210] -- 0:03:15 432500 -- (-2487.135) (-2488.618) (-2484.852) [-2473.373] * (-2475.432) (-2470.468) [-2469.574] (-2477.258) -- 0:03:15 433000 -- (-2470.343) [-2477.684] (-2490.506) (-2477.502) * [-2468.773] (-2480.119) (-2475.739) (-2472.639) -- 0:03:16 433500 -- (-2479.118) [-2471.390] (-2477.473) (-2475.515) * (-2478.665) [-2467.581] (-2477.102) (-2484.337) -- 0:03:16 434000 -- (-2483.985) [-2470.928] (-2478.420) (-2466.864) * (-2494.312) [-2476.883] (-2479.578) (-2479.807) -- 0:03:15 434500 -- (-2479.755) (-2474.574) (-2479.093) [-2466.161] * (-2477.106) (-2473.840) (-2476.415) [-2474.053] -- 0:03:15 435000 -- (-2492.279) (-2479.026) [-2475.874] (-2489.145) * (-2477.373) [-2469.749] (-2486.372) (-2476.769) -- 0:03:14 Average standard deviation of split frequencies: 0.016218 435500 -- (-2486.992) (-2478.415) (-2477.164) [-2465.749] * (-2478.051) (-2479.857) [-2475.769] (-2476.161) -- 0:03:14 436000 -- (-2479.385) (-2479.812) [-2472.906] (-2479.423) * (-2466.467) (-2476.284) (-2472.064) [-2469.497] -- 0:03:15 436500 -- [-2463.889] (-2475.944) (-2471.350) (-2485.081) * [-2474.657] (-2482.988) (-2477.899) (-2487.514) -- 0:03:14 437000 -- (-2478.580) (-2474.692) [-2476.775] (-2483.087) * (-2475.156) (-2469.135) [-2477.790] (-2474.779) -- 0:03:14 437500 -- (-2472.497) (-2484.924) (-2471.363) [-2475.343] * (-2476.823) (-2467.410) (-2475.875) [-2476.516] -- 0:03:14 438000 -- (-2476.072) (-2477.739) [-2470.639] (-2472.710) * (-2472.178) (-2480.766) (-2484.286) [-2468.267] -- 0:03:13 438500 -- (-2480.110) (-2486.714) (-2464.702) [-2471.340] * [-2466.103] (-2468.409) (-2470.328) (-2474.210) -- 0:03:13 439000 -- (-2467.310) (-2472.110) [-2475.993] (-2484.358) * (-2480.045) [-2465.994] (-2476.490) (-2484.461) -- 0:03:14 439500 -- (-2472.619) [-2474.114] (-2476.819) (-2472.106) * (-2475.018) (-2473.972) [-2469.685] (-2476.657) -- 0:03:13 440000 -- [-2468.604] (-2473.330) (-2483.663) (-2479.576) * (-2481.572) [-2482.972] (-2482.084) (-2482.563) -- 0:03:13 Average standard deviation of split frequencies: 0.016474 440500 -- (-2470.213) [-2467.912] (-2474.048) (-2481.637) * (-2477.680) [-2472.857] (-2490.495) (-2479.543) -- 0:03:13 441000 -- (-2475.517) (-2485.145) (-2475.623) [-2471.304] * (-2468.471) [-2467.330] (-2478.799) (-2477.576) -- 0:03:12 441500 -- (-2473.975) (-2478.343) [-2473.728] (-2471.961) * [-2467.920] (-2473.906) (-2490.849) (-2475.776) -- 0:03:12 442000 -- [-2468.604] (-2481.560) (-2467.115) (-2474.815) * [-2471.985] (-2494.423) (-2475.899) (-2477.907) -- 0:03:11 442500 -- (-2469.643) (-2478.823) (-2478.453) [-2474.052] * [-2476.447] (-2497.596) (-2480.360) (-2480.915) -- 0:03:12 443000 -- (-2478.586) (-2477.644) (-2477.794) [-2465.785] * (-2487.085) (-2479.580) (-2472.443) [-2470.275] -- 0:03:12 443500 -- (-2482.537) (-2478.332) (-2485.058) [-2476.109] * (-2473.878) (-2480.857) [-2465.427] (-2480.026) -- 0:03:11 444000 -- [-2471.708] (-2479.856) (-2469.091) (-2480.545) * (-2481.868) (-2480.794) [-2478.046] (-2467.529) -- 0:03:11 444500 -- (-2466.524) (-2472.137) (-2476.593) [-2471.132] * (-2479.172) [-2464.935] (-2474.254) (-2491.708) -- 0:03:11 445000 -- (-2474.942) (-2470.576) [-2471.164] (-2473.161) * (-2479.902) (-2466.592) [-2467.984] (-2464.834) -- 0:03:10 Average standard deviation of split frequencies: 0.016418 445500 -- [-2479.364] (-2468.408) (-2484.715) (-2475.906) * (-2477.266) (-2475.675) (-2467.472) [-2474.554] -- 0:03:11 446000 -- (-2483.676) [-2475.124] (-2480.273) (-2468.678) * (-2480.182) [-2470.589] (-2469.492) (-2474.106) -- 0:03:11 446500 -- (-2471.222) (-2480.640) (-2484.270) [-2473.589] * (-2478.341) (-2492.167) [-2471.720] (-2473.001) -- 0:03:10 447000 -- (-2475.040) (-2466.963) [-2479.707] (-2474.085) * (-2476.182) (-2484.614) (-2474.969) [-2466.528] -- 0:03:10 447500 -- (-2479.923) [-2472.183] (-2497.478) (-2469.782) * (-2475.188) (-2481.159) (-2466.035) [-2469.852] -- 0:03:10 448000 -- (-2479.178) (-2478.418) (-2489.555) [-2469.045] * (-2471.570) [-2463.413] (-2476.407) (-2468.981) -- 0:03:09 448500 -- (-2481.371) (-2466.510) (-2485.817) [-2476.288] * [-2471.477] (-2472.433) (-2478.410) (-2474.788) -- 0:03:10 449000 -- (-2471.071) (-2486.308) (-2507.930) [-2473.404] * (-2472.832) (-2480.281) (-2487.591) [-2468.025] -- 0:03:10 449500 -- (-2473.632) [-2471.147] (-2492.344) (-2474.710) * [-2464.126] (-2472.824) (-2473.935) (-2484.868) -- 0:03:09 450000 -- [-2471.386] (-2471.899) (-2496.476) (-2482.211) * [-2477.091] (-2467.364) (-2474.979) (-2478.954) -- 0:03:09 Average standard deviation of split frequencies: 0.016318 450500 -- [-2468.095] (-2480.320) (-2493.935) (-2476.154) * (-2478.902) (-2489.105) [-2466.863] (-2486.546) -- 0:03:09 451000 -- (-2485.205) [-2471.677] (-2487.766) (-2479.717) * (-2476.874) (-2477.341) [-2463.927] (-2479.646) -- 0:03:09 451500 -- [-2474.825] (-2479.687) (-2491.578) (-2471.057) * (-2472.102) (-2485.400) [-2470.479] (-2468.903) -- 0:03:09 452000 -- (-2488.853) (-2475.505) [-2477.220] (-2486.343) * (-2481.955) (-2475.306) [-2468.114] (-2484.745) -- 0:03:09 452500 -- (-2482.463) (-2485.235) (-2495.288) [-2478.355] * [-2479.095] (-2473.960) (-2465.171) (-2480.676) -- 0:03:08 453000 -- (-2478.320) (-2472.726) [-2477.322] (-2472.055) * (-2479.579) (-2474.777) [-2474.952] (-2484.577) -- 0:03:08 453500 -- (-2481.535) (-2474.838) [-2468.594] (-2470.335) * [-2478.240] (-2486.784) (-2473.623) (-2494.029) -- 0:03:07 454000 -- (-2467.227) (-2479.203) [-2474.333] (-2479.306) * [-2471.531] (-2479.738) (-2476.643) (-2490.054) -- 0:03:08 454500 -- (-2477.781) [-2472.932] (-2485.337) (-2482.290) * (-2482.827) [-2473.932] (-2474.044) (-2478.197) -- 0:03:08 455000 -- (-2474.480) [-2470.239] (-2474.888) (-2481.652) * (-2493.146) (-2479.833) (-2469.599) [-2469.654] -- 0:03:08 Average standard deviation of split frequencies: 0.015507 455500 -- (-2477.181) [-2469.725] (-2472.285) (-2487.984) * (-2475.439) (-2474.376) (-2470.678) [-2466.929] -- 0:03:07 456000 -- (-2482.775) (-2475.451) [-2467.081] (-2481.711) * (-2476.630) (-2476.576) [-2467.170] (-2476.972) -- 0:03:07 456500 -- (-2470.792) (-2474.493) [-2472.351] (-2475.638) * (-2481.752) (-2478.747) (-2467.307) [-2474.321] -- 0:03:06 457000 -- [-2476.915] (-2472.485) (-2468.422) (-2484.647) * (-2468.731) (-2475.169) [-2468.261] (-2479.124) -- 0:03:06 457500 -- [-2462.835] (-2485.766) (-2471.711) (-2475.018) * [-2468.541] (-2496.078) (-2471.929) (-2481.929) -- 0:03:07 458000 -- (-2482.740) (-2473.812) (-2473.131) [-2475.658] * (-2478.213) (-2487.591) [-2478.829] (-2479.918) -- 0:03:06 458500 -- (-2493.912) (-2495.618) (-2480.761) [-2480.256] * [-2467.990] (-2475.628) (-2479.689) (-2477.785) -- 0:03:06 459000 -- (-2492.432) (-2467.375) (-2472.124) [-2481.716] * (-2479.041) (-2474.956) [-2471.546] (-2477.259) -- 0:03:06 459500 -- (-2486.361) (-2477.593) [-2483.433] (-2479.833) * (-2486.847) (-2476.562) [-2478.005] (-2471.774) -- 0:03:05 460000 -- (-2500.692) (-2476.236) (-2475.409) [-2468.594] * (-2480.179) (-2472.652) (-2478.592) [-2476.140] -- 0:03:05 Average standard deviation of split frequencies: 0.015145 460500 -- [-2476.796] (-2468.040) (-2474.168) (-2489.236) * (-2477.990) [-2476.273] (-2475.492) (-2475.192) -- 0:03:06 461000 -- (-2479.792) (-2477.228) (-2493.309) [-2480.030] * (-2468.556) (-2469.837) (-2470.645) [-2479.705] -- 0:03:05 461500 -- (-2478.729) (-2479.178) [-2477.544] (-2470.959) * (-2470.340) (-2485.378) (-2483.718) [-2485.536] -- 0:03:05 462000 -- (-2484.531) (-2474.483) [-2470.096] (-2470.148) * (-2481.490) (-2477.184) [-2466.899] (-2470.982) -- 0:03:05 462500 -- (-2489.711) (-2484.520) (-2473.467) [-2467.937] * (-2474.957) [-2481.094] (-2471.755) (-2467.505) -- 0:03:04 463000 -- [-2466.157] (-2484.120) (-2473.572) (-2468.720) * (-2471.089) (-2478.615) (-2479.666) [-2469.553] -- 0:03:05 463500 -- (-2474.050) (-2472.938) [-2469.418] (-2480.734) * (-2482.679) (-2475.422) [-2475.825] (-2479.177) -- 0:03:05 464000 -- (-2482.292) [-2473.024] (-2475.644) (-2480.633) * (-2479.286) (-2474.999) [-2474.784] (-2475.263) -- 0:03:04 464500 -- (-2486.404) (-2481.624) [-2471.536] (-2472.169) * (-2460.781) (-2483.369) [-2464.556] (-2475.198) -- 0:03:04 465000 -- (-2479.016) [-2468.300] (-2466.112) (-2479.393) * (-2484.558) (-2477.506) [-2469.939] (-2473.215) -- 0:03:04 Average standard deviation of split frequencies: 0.013973 465500 -- (-2470.055) [-2476.840] (-2473.177) (-2480.151) * (-2478.012) [-2475.358] (-2481.894) (-2486.938) -- 0:03:04 466000 -- [-2466.508] (-2487.443) (-2478.001) (-2474.274) * (-2473.400) (-2483.573) [-2475.420] (-2485.443) -- 0:03:04 466500 -- (-2474.239) [-2480.533] (-2485.868) (-2489.635) * (-2488.901) (-2470.663) (-2479.382) [-2468.753] -- 0:03:04 467000 -- (-2482.722) [-2465.395] (-2474.679) (-2474.130) * (-2483.034) (-2469.823) [-2466.620] (-2478.329) -- 0:03:03 467500 -- [-2479.910] (-2488.902) (-2485.883) (-2488.604) * [-2472.856] (-2473.247) (-2485.073) (-2477.865) -- 0:03:03 468000 -- (-2473.867) [-2476.206] (-2487.042) (-2486.685) * (-2475.663) [-2477.208] (-2479.566) (-2474.593) -- 0:03:03 468500 -- (-2471.571) (-2494.571) [-2471.700] (-2476.326) * (-2480.611) (-2491.882) [-2472.597] (-2475.150) -- 0:03:02 469000 -- (-2484.915) (-2490.949) (-2481.743) [-2469.459] * [-2472.883] (-2472.438) (-2480.890) (-2488.991) -- 0:03:03 469500 -- (-2485.464) (-2488.420) (-2470.851) [-2467.175] * (-2477.933) (-2479.112) (-2480.747) [-2478.697] -- 0:03:03 470000 -- [-2478.809] (-2489.788) (-2481.997) (-2486.569) * (-2483.492) [-2470.277] (-2472.891) (-2481.405) -- 0:03:02 Average standard deviation of split frequencies: 0.013772 470500 -- (-2480.157) (-2483.841) [-2474.804] (-2470.799) * (-2470.979) (-2470.658) [-2468.351] (-2476.026) -- 0:03:02 471000 -- [-2473.358] (-2487.171) (-2484.059) (-2483.017) * (-2475.010) (-2487.609) [-2476.826] (-2478.248) -- 0:03:01 471500 -- (-2468.989) (-2485.939) [-2475.163] (-2471.530) * (-2484.162) [-2468.141] (-2475.250) (-2480.324) -- 0:03:01 472000 -- (-2482.925) (-2485.855) [-2466.101] (-2483.729) * (-2470.209) (-2495.480) [-2476.900] (-2469.086) -- 0:03:02 472500 -- (-2481.957) [-2476.673] (-2479.308) (-2471.119) * (-2482.444) (-2472.460) [-2472.631] (-2481.108) -- 0:03:01 473000 -- (-2480.558) [-2474.791] (-2484.305) (-2486.997) * [-2474.605] (-2475.012) (-2488.180) (-2472.968) -- 0:03:01 473500 -- [-2470.316] (-2490.983) (-2479.379) (-2481.095) * [-2466.932] (-2472.244) (-2482.159) (-2470.748) -- 0:03:01 474000 -- (-2468.737) (-2484.142) [-2464.299] (-2481.617) * (-2475.222) (-2466.131) [-2471.887] (-2475.082) -- 0:03:00 474500 -- (-2470.811) (-2487.846) [-2470.773] (-2492.496) * (-2468.981) [-2468.395] (-2474.317) (-2485.474) -- 0:03:00 475000 -- [-2471.114] (-2475.560) (-2471.046) (-2480.769) * [-2466.030] (-2481.919) (-2484.427) (-2480.773) -- 0:03:01 Average standard deviation of split frequencies: 0.013060 475500 -- [-2477.397] (-2482.581) (-2475.821) (-2492.150) * (-2470.035) [-2467.711] (-2485.923) (-2474.358) -- 0:03:00 476000 -- [-2472.918] (-2480.051) (-2477.001) (-2476.959) * (-2483.892) (-2483.835) [-2466.155] (-2468.573) -- 0:03:00 476500 -- (-2482.493) [-2468.768] (-2475.594) (-2481.123) * (-2471.811) [-2473.795] (-2480.762) (-2470.865) -- 0:03:00 477000 -- (-2477.675) (-2482.946) (-2471.138) [-2473.800] * (-2479.727) (-2489.047) [-2466.375] (-2476.209) -- 0:02:59 477500 -- (-2474.786) (-2472.482) (-2475.001) [-2481.691] * (-2479.519) (-2470.112) [-2471.208] (-2478.419) -- 0:02:59 478000 -- (-2483.001) (-2468.596) [-2469.837] (-2473.706) * (-2483.759) (-2476.637) [-2478.414] (-2475.329) -- 0:02:59 478500 -- [-2480.075] (-2471.658) (-2473.499) (-2484.280) * (-2477.742) (-2474.178) [-2480.883] (-2474.676) -- 0:02:59 479000 -- (-2480.243) (-2468.891) [-2470.730] (-2471.774) * (-2482.148) (-2474.240) [-2470.398] (-2476.136) -- 0:02:59 479500 -- [-2477.598] (-2468.048) (-2475.016) (-2473.124) * (-2478.347) (-2477.504) [-2472.399] (-2480.040) -- 0:02:59 480000 -- (-2473.020) [-2474.804] (-2483.393) (-2486.153) * (-2474.239) (-2480.536) [-2473.167] (-2489.946) -- 0:02:58 Average standard deviation of split frequencies: 0.012946 480500 -- (-2478.262) [-2473.060] (-2479.159) (-2477.246) * [-2477.107] (-2491.953) (-2485.086) (-2487.657) -- 0:02:58 481000 -- (-2472.212) (-2466.085) (-2496.230) [-2465.276] * [-2467.024] (-2472.593) (-2471.947) (-2481.928) -- 0:02:58 481500 -- [-2483.657] (-2476.174) (-2480.864) (-2475.546) * (-2470.711) (-2472.550) [-2487.182] (-2481.232) -- 0:02:58 482000 -- [-2476.436] (-2471.025) (-2471.479) (-2474.627) * (-2484.809) [-2471.807] (-2475.832) (-2486.994) -- 0:02:58 482500 -- (-2473.551) [-2469.100] (-2469.990) (-2475.695) * (-2470.642) [-2484.458] (-2484.758) (-2476.945) -- 0:02:58 483000 -- (-2482.915) (-2482.474) (-2477.662) [-2471.382] * [-2469.173] (-2486.812) (-2481.753) (-2478.918) -- 0:02:57 483500 -- (-2473.448) (-2477.360) (-2484.673) [-2470.209] * (-2468.959) (-2465.996) (-2481.213) [-2472.708] -- 0:02:57 484000 -- (-2473.518) [-2473.926] (-2474.307) (-2469.383) * (-2480.746) (-2473.439) (-2481.319) [-2476.152] -- 0:02:56 484500 -- (-2478.081) [-2468.706] (-2477.922) (-2471.440) * (-2474.677) [-2480.525] (-2475.076) (-2478.975) -- 0:02:57 485000 -- [-2477.817] (-2474.883) (-2485.057) (-2472.844) * [-2467.237] (-2475.186) (-2483.480) (-2475.256) -- 0:02:57 Average standard deviation of split frequencies: 0.011276 485500 -- (-2480.621) (-2480.063) [-2473.038] (-2480.772) * [-2475.121] (-2471.302) (-2477.903) (-2473.419) -- 0:02:56 486000 -- [-2472.880] (-2481.195) (-2474.274) (-2483.182) * (-2477.837) [-2475.072] (-2478.305) (-2480.464) -- 0:02:56 486500 -- (-2471.188) (-2484.863) [-2480.291] (-2477.364) * (-2478.468) (-2470.338) [-2471.381] (-2469.940) -- 0:02:56 487000 -- (-2473.023) [-2473.320] (-2475.016) (-2486.250) * [-2469.114] (-2472.489) (-2476.292) (-2473.619) -- 0:02:55 487500 -- (-2477.940) [-2481.194] (-2474.588) (-2479.035) * [-2473.873] (-2470.186) (-2489.944) (-2475.543) -- 0:02:56 488000 -- (-2481.552) [-2475.337] (-2480.153) (-2476.762) * (-2486.627) (-2471.267) [-2472.693] (-2478.186) -- 0:02:56 488500 -- (-2484.609) (-2482.433) (-2481.749) [-2474.550] * (-2471.984) (-2467.971) [-2473.566] (-2477.807) -- 0:02:55 489000 -- (-2484.302) [-2474.059] (-2483.790) (-2475.883) * [-2476.341] (-2466.319) (-2469.012) (-2476.067) -- 0:02:55 489500 -- (-2472.990) [-2467.249] (-2475.568) (-2472.697) * (-2478.454) [-2477.642] (-2469.820) (-2497.053) -- 0:02:55 490000 -- (-2465.135) (-2487.298) [-2467.748] (-2471.670) * (-2478.552) (-2471.728) [-2474.819] (-2491.768) -- 0:02:54 Average standard deviation of split frequencies: 0.011169 490500 -- (-2476.969) [-2473.214] (-2482.988) (-2481.990) * (-2472.894) (-2475.680) [-2473.528] (-2471.202) -- 0:02:55 491000 -- (-2466.387) (-2468.909) [-2470.602] (-2467.682) * (-2476.584) (-2474.211) (-2469.163) [-2474.133] -- 0:02:55 491500 -- (-2477.390) (-2474.777) (-2486.987) [-2467.587] * (-2481.837) (-2466.688) [-2465.572] (-2481.297) -- 0:02:54 492000 -- (-2479.524) (-2471.059) (-2476.293) [-2473.335] * (-2480.102) (-2468.870) (-2477.510) [-2476.134] -- 0:02:54 492500 -- [-2467.632] (-2470.747) (-2486.383) (-2479.162) * (-2485.955) [-2471.232] (-2474.414) (-2473.746) -- 0:02:54 493000 -- (-2492.732) (-2472.612) [-2482.144] (-2477.674) * (-2483.682) (-2480.293) [-2469.945] (-2472.639) -- 0:02:54 493500 -- (-2474.877) (-2474.273) [-2467.651] (-2466.547) * (-2481.286) (-2479.048) (-2476.933) [-2480.597] -- 0:02:54 494000 -- (-2478.900) (-2476.690) [-2474.759] (-2467.658) * (-2479.931) [-2474.289] (-2471.854) (-2487.084) -- 0:02:54 494500 -- (-2481.568) [-2466.783] (-2476.917) (-2487.067) * (-2490.005) [-2472.591] (-2467.095) (-2483.792) -- 0:02:53 495000 -- (-2484.444) (-2481.336) [-2471.956] (-2481.865) * (-2470.969) (-2479.407) [-2487.857] (-2478.841) -- 0:02:53 Average standard deviation of split frequencies: 0.011049 495500 -- (-2463.389) [-2471.785] (-2478.588) (-2468.410) * [-2467.017] (-2481.061) (-2476.481) (-2478.351) -- 0:02:54 496000 -- [-2478.768] (-2478.138) (-2476.654) (-2474.446) * (-2467.349) (-2477.466) [-2468.737] (-2490.419) -- 0:02:53 496500 -- (-2473.685) [-2472.852] (-2480.988) (-2477.484) * [-2472.899] (-2477.591) (-2478.511) (-2468.874) -- 0:02:53 497000 -- (-2479.274) (-2466.936) (-2483.854) [-2471.079] * (-2473.379) (-2480.828) [-2472.143] (-2473.450) -- 0:02:53 497500 -- [-2478.742] (-2483.035) (-2482.334) (-2480.765) * (-2483.300) (-2474.346) (-2477.826) [-2471.542] -- 0:02:52 498000 -- (-2477.450) [-2483.428] (-2487.228) (-2487.374) * (-2485.389) (-2480.941) (-2479.400) [-2470.262] -- 0:02:52 498500 -- (-2470.384) (-2476.024) [-2470.329] (-2495.561) * (-2472.947) (-2483.528) (-2482.727) [-2481.401] -- 0:02:53 499000 -- [-2471.238] (-2473.686) (-2482.210) (-2476.375) * (-2479.697) (-2482.388) (-2478.889) [-2464.450] -- 0:02:52 499500 -- (-2478.658) (-2473.863) (-2473.151) [-2486.323] * [-2475.473] (-2472.340) (-2476.279) (-2472.209) -- 0:02:52 500000 -- (-2479.400) (-2472.472) [-2472.191] (-2478.405) * (-2476.176) (-2484.409) [-2466.876] (-2470.614) -- 0:02:52 Average standard deviation of split frequencies: 0.011004 500500 -- (-2470.861) (-2480.332) [-2466.985] (-2499.554) * (-2468.883) (-2479.959) (-2479.138) [-2474.682] -- 0:02:51 501000 -- (-2473.193) (-2480.852) [-2469.978] (-2485.451) * [-2467.217] (-2476.295) (-2475.660) (-2491.335) -- 0:02:52 501500 -- (-2481.672) [-2476.641] (-2476.135) (-2487.447) * (-2477.743) (-2468.732) [-2465.593] (-2486.098) -- 0:02:51 502000 -- (-2477.120) [-2472.213] (-2474.860) (-2480.109) * (-2473.320) (-2476.449) [-2470.502] (-2472.269) -- 0:02:51 502500 -- [-2471.440] (-2470.625) (-2484.042) (-2485.779) * (-2479.592) [-2473.416] (-2472.500) (-2490.933) -- 0:02:51 503000 -- (-2468.368) (-2476.265) [-2474.048] (-2475.653) * (-2471.755) [-2476.558] (-2478.399) (-2482.817) -- 0:02:50 503500 -- [-2467.689] (-2492.691) (-2487.477) (-2479.773) * (-2471.918) (-2481.802) (-2479.478) [-2472.950] -- 0:02:50 504000 -- (-2469.571) (-2488.519) [-2467.707] (-2473.014) * [-2475.066] (-2488.981) (-2470.768) (-2483.540) -- 0:02:51 504500 -- (-2470.557) (-2484.162) [-2470.699] (-2477.409) * (-2478.766) [-2470.223] (-2481.222) (-2480.533) -- 0:02:50 505000 -- (-2477.244) [-2475.544] (-2466.591) (-2475.136) * (-2471.174) (-2464.497) (-2490.194) [-2467.907] -- 0:02:50 Average standard deviation of split frequencies: 0.011063 505500 -- (-2476.254) (-2483.098) (-2466.545) [-2479.737] * (-2470.819) [-2478.862] (-2491.608) (-2481.472) -- 0:02:50 506000 -- [-2468.527] (-2475.303) (-2473.238) (-2473.280) * (-2471.839) [-2468.843] (-2486.861) (-2472.782) -- 0:02:49 506500 -- (-2479.115) (-2474.314) (-2483.308) [-2461.288] * [-2471.690] (-2477.677) (-2478.092) (-2470.674) -- 0:02:50 507000 -- [-2476.264] (-2479.889) (-2476.832) (-2469.803) * (-2491.890) (-2478.698) [-2471.527] (-2469.807) -- 0:02:50 507500 -- (-2472.741) (-2472.542) (-2472.272) [-2468.280] * (-2473.706) (-2491.825) (-2476.316) [-2468.640] -- 0:02:49 508000 -- (-2467.861) (-2471.186) [-2471.357] (-2485.001) * [-2472.942] (-2474.996) (-2476.565) (-2474.427) -- 0:02:49 508500 -- [-2472.625] (-2474.713) (-2475.051) (-2475.035) * [-2471.397] (-2478.560) (-2472.911) (-2472.901) -- 0:02:49 509000 -- (-2483.273) [-2480.973] (-2474.976) (-2470.694) * (-2472.357) (-2476.200) [-2475.504] (-2486.660) -- 0:02:48 509500 -- (-2472.012) [-2469.805] (-2485.950) (-2486.941) * (-2464.900) (-2471.316) [-2478.014] (-2477.578) -- 0:02:49 510000 -- (-2476.931) (-2475.631) [-2480.110] (-2488.832) * [-2462.673] (-2474.766) (-2468.997) (-2473.534) -- 0:02:49 Average standard deviation of split frequencies: 0.010385 510500 -- (-2480.296) [-2476.209] (-2493.222) (-2485.990) * (-2469.997) (-2497.876) [-2469.557] (-2478.277) -- 0:02:48 511000 -- (-2470.596) (-2477.995) (-2482.649) [-2474.541] * [-2476.546] (-2480.723) (-2483.234) (-2475.261) -- 0:02:48 511500 -- (-2475.549) (-2483.122) (-2481.303) [-2466.865] * [-2479.552] (-2475.653) (-2471.178) (-2484.400) -- 0:02:48 512000 -- (-2473.309) [-2469.259] (-2486.269) (-2482.193) * (-2479.387) (-2479.769) (-2484.397) [-2478.111] -- 0:02:48 512500 -- (-2482.246) [-2472.706] (-2493.773) (-2477.641) * (-2469.940) (-2478.974) [-2478.419] (-2484.858) -- 0:02:48 513000 -- [-2472.817] (-2473.302) (-2480.546) (-2476.915) * (-2481.733) (-2481.354) [-2470.499] (-2477.366) -- 0:02:48 513500 -- [-2479.678] (-2473.634) (-2473.453) (-2488.459) * [-2470.791] (-2474.727) (-2472.528) (-2472.040) -- 0:02:47 514000 -- [-2479.088] (-2473.989) (-2476.198) (-2482.470) * (-2475.948) (-2478.368) (-2476.392) [-2475.796] -- 0:02:47 514500 -- (-2472.366) (-2472.884) [-2464.346] (-2481.274) * (-2475.607) [-2477.917] (-2473.507) (-2471.483) -- 0:02:47 515000 -- (-2482.340) [-2471.734] (-2487.666) (-2467.519) * (-2479.599) (-2489.253) [-2470.193] (-2480.191) -- 0:02:47 Average standard deviation of split frequencies: 0.010415 515500 -- (-2480.833) [-2475.191] (-2479.716) (-2468.441) * (-2487.165) (-2474.675) [-2471.435] (-2479.402) -- 0:02:47 516000 -- (-2467.616) [-2468.807] (-2483.746) (-2488.775) * [-2474.658] (-2472.708) (-2467.981) (-2478.665) -- 0:02:46 516500 -- [-2473.189] (-2483.115) (-2483.189) (-2474.278) * [-2475.991] (-2470.566) (-2479.918) (-2472.586) -- 0:02:46 517000 -- [-2472.372] (-2466.667) (-2480.159) (-2477.290) * (-2484.974) (-2480.558) (-2470.097) [-2470.125] -- 0:02:47 517500 -- (-2467.024) (-2468.047) (-2479.949) [-2468.344] * (-2474.733) (-2483.981) [-2469.055] (-2471.348) -- 0:02:46 518000 -- (-2478.814) [-2477.635] (-2483.979) (-2472.466) * (-2470.208) [-2480.082] (-2477.549) (-2465.544) -- 0:02:46 518500 -- (-2482.284) [-2473.962] (-2476.602) (-2479.450) * (-2475.882) (-2478.957) [-2478.080] (-2472.622) -- 0:02:46 519000 -- (-2476.098) [-2475.686] (-2474.940) (-2479.105) * (-2478.129) [-2477.009] (-2479.365) (-2482.191) -- 0:02:45 519500 -- (-2482.456) [-2480.015] (-2473.373) (-2478.222) * [-2467.822] (-2482.569) (-2491.740) (-2484.213) -- 0:02:45 520000 -- (-2474.602) [-2467.238] (-2476.511) (-2487.679) * (-2491.552) [-2466.428] (-2488.469) (-2473.743) -- 0:02:46 Average standard deviation of split frequencies: 0.010261 520500 -- (-2482.773) (-2478.570) (-2498.992) [-2478.756] * (-2487.087) (-2473.306) [-2484.279] (-2477.175) -- 0:02:45 521000 -- (-2475.454) (-2475.100) [-2476.871] (-2470.240) * [-2475.253] (-2477.578) (-2469.123) (-2483.582) -- 0:02:45 521500 -- (-2478.503) (-2483.847) (-2474.502) [-2463.102] * (-2475.610) [-2470.278] (-2476.467) (-2481.192) -- 0:02:45 522000 -- (-2471.849) (-2480.846) (-2476.167) [-2464.258] * (-2482.679) (-2487.215) [-2482.292] (-2482.018) -- 0:02:44 522500 -- [-2475.883] (-2479.276) (-2475.017) (-2477.687) * (-2473.811) (-2470.435) (-2477.748) [-2470.205] -- 0:02:45 523000 -- (-2476.650) [-2477.925] (-2475.861) (-2480.563) * (-2468.890) [-2471.648] (-2478.976) (-2471.880) -- 0:02:45 523500 -- (-2467.378) (-2477.601) (-2477.956) [-2466.730] * [-2475.181] (-2478.071) (-2489.266) (-2480.198) -- 0:02:44 524000 -- [-2474.114] (-2476.084) (-2480.593) (-2485.284) * (-2473.175) (-2481.071) [-2472.910] (-2471.172) -- 0:02:44 524500 -- (-2471.352) [-2472.356] (-2471.893) (-2472.549) * (-2476.327) (-2478.754) [-2468.941] (-2473.051) -- 0:02:44 525000 -- (-2476.151) (-2478.500) [-2470.623] (-2470.928) * (-2475.253) (-2475.295) [-2465.302] (-2477.716) -- 0:02:44 Average standard deviation of split frequencies: 0.009298 525500 -- [-2478.245] (-2471.639) (-2477.115) (-2477.336) * [-2469.333] (-2479.493) (-2470.300) (-2471.650) -- 0:02:44 526000 -- [-2471.736] (-2477.627) (-2475.872) (-2481.032) * (-2483.420) (-2483.494) (-2481.913) [-2470.563] -- 0:02:44 526500 -- (-2480.319) [-2468.225] (-2474.728) (-2481.445) * (-2475.828) [-2467.934] (-2482.442) (-2475.900) -- 0:02:43 527000 -- [-2474.089] (-2472.823) (-2485.515) (-2472.506) * (-2471.500) [-2476.377] (-2494.491) (-2487.159) -- 0:02:43 527500 -- (-2471.603) [-2471.799] (-2479.531) (-2474.980) * [-2473.689] (-2473.700) (-2475.691) (-2472.859) -- 0:02:43 528000 -- [-2475.313] (-2471.232) (-2477.693) (-2474.515) * (-2468.485) (-2470.674) (-2488.490) [-2477.091] -- 0:02:43 528500 -- (-2484.402) (-2470.250) (-2481.272) [-2481.426] * [-2471.064] (-2470.512) (-2472.615) (-2468.616) -- 0:02:43 529000 -- (-2471.178) (-2473.117) (-2493.223) [-2476.014] * (-2472.887) [-2467.045] (-2479.954) (-2470.284) -- 0:02:42 529500 -- (-2472.926) [-2469.224] (-2482.353) (-2476.241) * (-2492.964) [-2472.035] (-2481.340) (-2471.670) -- 0:02:42 530000 -- (-2475.544) (-2484.046) (-2489.170) [-2465.805] * [-2475.737] (-2471.058) (-2472.338) (-2466.931) -- 0:02:43 Average standard deviation of split frequencies: 0.009002 530500 -- (-2474.583) (-2479.584) [-2473.753] (-2468.684) * (-2481.872) (-2486.330) (-2481.550) [-2471.217] -- 0:02:42 531000 -- (-2473.595) (-2480.091) (-2482.775) [-2470.424] * (-2488.685) (-2477.638) (-2472.819) [-2467.395] -- 0:02:42 531500 -- (-2479.039) [-2478.702] (-2475.270) (-2483.629) * (-2473.541) [-2475.397] (-2484.003) (-2478.035) -- 0:02:42 532000 -- (-2481.017) (-2470.968) (-2476.502) [-2475.352] * [-2477.870] (-2479.462) (-2472.376) (-2471.170) -- 0:02:41 532500 -- (-2476.977) (-2480.980) [-2469.178] (-2471.836) * [-2468.167] (-2473.766) (-2478.376) (-2484.366) -- 0:02:42 533000 -- (-2468.558) [-2476.135] (-2485.855) (-2474.097) * (-2477.593) (-2478.467) (-2481.411) [-2475.521] -- 0:02:42 533500 -- (-2481.321) [-2483.010] (-2477.255) (-2485.595) * (-2478.477) [-2476.941] (-2476.844) (-2472.792) -- 0:02:41 534000 -- (-2472.162) (-2488.121) [-2473.553] (-2485.951) * (-2475.246) [-2473.559] (-2482.870) (-2480.902) -- 0:02:41 534500 -- (-2474.398) [-2471.334] (-2473.077) (-2479.931) * (-2479.472) [-2468.008] (-2476.079) (-2486.076) -- 0:02:41 535000 -- [-2466.041] (-2469.570) (-2481.256) (-2480.773) * (-2472.926) (-2472.778) [-2466.742] (-2476.280) -- 0:02:41 Average standard deviation of split frequencies: 0.009557 535500 -- [-2466.701] (-2473.569) (-2476.035) (-2482.669) * [-2472.973] (-2467.540) (-2480.700) (-2470.101) -- 0:02:41 536000 -- (-2467.251) (-2471.837) (-2475.584) [-2473.066] * (-2468.471) [-2476.638] (-2471.709) (-2479.914) -- 0:02:41 536500 -- (-2482.107) (-2479.192) (-2471.506) [-2464.217] * [-2464.164] (-2474.188) (-2476.764) (-2471.576) -- 0:02:40 537000 -- (-2474.999) (-2468.955) (-2473.077) [-2467.130] * (-2487.001) (-2483.101) (-2473.786) [-2484.210] -- 0:02:40 537500 -- (-2475.348) (-2483.565) (-2464.167) [-2469.277] * [-2471.635] (-2480.420) (-2486.058) (-2486.727) -- 0:02:40 538000 -- (-2479.672) (-2493.025) [-2471.223] (-2485.151) * (-2480.923) [-2475.222] (-2472.649) (-2482.298) -- 0:02:40 538500 -- (-2475.181) [-2471.423] (-2477.642) (-2467.656) * (-2488.379) (-2478.576) (-2472.470) [-2470.492] -- 0:02:40 539000 -- (-2478.497) (-2473.070) (-2490.562) [-2467.221] * (-2486.347) (-2480.739) (-2471.204) [-2471.090] -- 0:02:39 539500 -- (-2476.172) (-2476.099) (-2476.799) [-2471.352] * (-2479.431) [-2469.843] (-2469.319) (-2472.623) -- 0:02:39 540000 -- (-2475.908) (-2478.594) (-2492.953) [-2479.625] * (-2471.135) (-2475.965) [-2471.988] (-2481.315) -- 0:02:39 Average standard deviation of split frequencies: 0.009765 540500 -- [-2469.892] (-2476.419) (-2479.439) (-2468.803) * (-2485.321) (-2474.675) (-2485.702) [-2487.031] -- 0:02:39 541000 -- (-2480.831) (-2467.404) (-2476.823) [-2470.862] * (-2479.942) [-2467.398] (-2473.262) (-2484.526) -- 0:02:39 541500 -- (-2481.544) (-2482.328) (-2472.651) [-2477.366] * (-2479.503) (-2476.967) (-2473.632) [-2474.422] -- 0:02:39 542000 -- (-2462.903) [-2467.800] (-2481.192) (-2481.301) * (-2480.048) (-2470.814) [-2474.237] (-2481.102) -- 0:02:38 542500 -- (-2471.598) (-2479.731) [-2468.314] (-2476.394) * [-2478.251] (-2468.469) (-2478.827) (-2468.919) -- 0:02:38 543000 -- (-2472.525) (-2481.220) (-2470.712) [-2473.811] * (-2481.814) (-2485.595) [-2473.606] (-2482.139) -- 0:02:38 543500 -- [-2477.938] (-2476.261) (-2481.872) (-2478.034) * [-2467.043] (-2476.242) (-2468.686) (-2489.221) -- 0:02:37 544000 -- (-2475.826) [-2468.507] (-2480.811) (-2495.240) * [-2475.755] (-2476.048) (-2484.565) (-2480.946) -- 0:02:38 544500 -- [-2472.535] (-2474.136) (-2480.189) (-2488.683) * (-2473.595) [-2479.166] (-2482.242) (-2472.851) -- 0:02:38 545000 -- (-2485.945) (-2474.127) [-2466.382] (-2485.971) * (-2484.559) (-2467.805) [-2481.977] (-2473.535) -- 0:02:37 Average standard deviation of split frequencies: 0.008634 545500 -- [-2481.398] (-2478.861) (-2476.706) (-2485.977) * (-2483.005) [-2472.194] (-2470.458) (-2475.521) -- 0:02:37 546000 -- [-2473.701] (-2467.842) (-2473.904) (-2483.272) * (-2488.716) (-2464.088) [-2480.438] (-2480.037) -- 0:02:37 546500 -- (-2475.926) (-2482.420) (-2479.073) [-2471.040] * (-2476.572) (-2472.880) (-2483.301) [-2469.942] -- 0:02:36 547000 -- (-2472.327) (-2475.076) [-2464.520] (-2490.331) * (-2473.882) (-2472.281) [-2468.191] (-2465.413) -- 0:02:37 547500 -- (-2474.358) [-2477.353] (-2488.694) (-2489.334) * (-2468.911) (-2468.885) (-2479.304) [-2468.454] -- 0:02:37 548000 -- (-2477.360) (-2467.181) [-2484.597] (-2477.337) * (-2475.152) [-2471.662] (-2479.760) (-2479.300) -- 0:02:36 548500 -- (-2478.944) [-2467.537] (-2483.636) (-2471.152) * (-2478.707) [-2468.793] (-2476.165) (-2473.441) -- 0:02:36 549000 -- [-2469.322] (-2469.454) (-2472.984) (-2477.344) * (-2474.275) [-2470.484] (-2484.134) (-2481.448) -- 0:02:36 549500 -- [-2467.964] (-2479.178) (-2486.501) (-2470.990) * (-2487.615) (-2480.929) [-2482.248] (-2496.281) -- 0:02:36 550000 -- (-2470.334) [-2473.144] (-2481.536) (-2480.937) * (-2474.551) (-2478.959) [-2474.147] (-2477.897) -- 0:02:36 Average standard deviation of split frequencies: 0.008846 550500 -- (-2472.011) (-2465.216) (-2481.294) [-2476.333] * (-2468.970) (-2473.091) (-2477.672) [-2477.744] -- 0:02:35 551000 -- [-2469.076] (-2478.662) (-2472.656) (-2482.311) * [-2483.686] (-2476.730) (-2479.800) (-2481.518) -- 0:02:35 551500 -- (-2476.797) (-2476.419) [-2476.486] (-2480.820) * (-2485.910) [-2470.954] (-2482.539) (-2476.664) -- 0:02:36 552000 -- [-2469.697] (-2474.777) (-2468.795) (-2484.371) * (-2473.149) (-2477.319) (-2484.712) [-2472.784] -- 0:02:35 552500 -- (-2470.499) (-2480.087) [-2470.534] (-2470.460) * [-2484.133] (-2479.504) (-2483.366) (-2487.249) -- 0:02:35 553000 -- (-2473.447) [-2471.778] (-2467.753) (-2476.234) * [-2481.733] (-2487.349) (-2466.959) (-2476.097) -- 0:02:35 553500 -- (-2475.678) (-2489.642) (-2481.539) [-2466.694] * (-2484.962) [-2472.646] (-2475.016) (-2475.436) -- 0:02:34 554000 -- (-2483.684) [-2471.929] (-2476.082) (-2471.864) * (-2488.341) (-2485.057) (-2474.544) [-2466.856] -- 0:02:34 554500 -- (-2471.634) (-2475.068) (-2470.164) [-2471.351] * (-2478.133) [-2481.118] (-2482.045) (-2492.058) -- 0:02:35 555000 -- (-2486.827) [-2465.851] (-2476.778) (-2484.542) * (-2468.461) (-2470.481) (-2472.979) [-2464.352] -- 0:02:34 Average standard deviation of split frequencies: 0.009948 555500 -- (-2485.387) [-2471.930] (-2476.048) (-2472.552) * (-2477.665) (-2470.772) (-2483.835) [-2470.326] -- 0:02:34 556000 -- [-2483.233] (-2475.388) (-2484.830) (-2465.700) * (-2477.199) (-2472.608) (-2473.237) [-2475.677] -- 0:02:34 556500 -- (-2471.589) (-2484.077) (-2476.088) [-2466.215] * [-2471.627] (-2479.861) (-2480.984) (-2471.947) -- 0:02:33 557000 -- (-2473.612) (-2476.427) [-2481.095] (-2474.403) * (-2480.094) (-2478.954) [-2472.160] (-2481.062) -- 0:02:34 557500 -- (-2471.357) (-2476.529) (-2467.525) [-2473.663] * [-2464.734] (-2474.006) (-2477.098) (-2489.996) -- 0:02:33 558000 -- (-2474.942) [-2474.797] (-2472.010) (-2468.398) * (-2466.938) [-2467.390] (-2471.797) (-2484.949) -- 0:02:33 558500 -- (-2483.080) (-2465.045) [-2483.853] (-2472.247) * (-2478.669) (-2465.973) [-2469.687] (-2477.253) -- 0:02:33 559000 -- (-2478.323) (-2474.119) (-2476.202) [-2474.822] * (-2484.728) (-2469.791) [-2465.562] (-2479.505) -- 0:02:33 559500 -- (-2482.300) (-2481.406) [-2472.724] (-2480.697) * [-2481.890] (-2478.858) (-2473.092) (-2483.467) -- 0:02:33 560000 -- (-2480.678) [-2481.571] (-2482.250) (-2472.749) * (-2477.894) (-2472.093) [-2474.535] (-2485.035) -- 0:02:33 Average standard deviation of split frequencies: 0.009193 560500 -- (-2478.145) (-2487.520) [-2477.449] (-2485.527) * (-2468.825) (-2482.679) (-2468.909) [-2470.554] -- 0:02:32 561000 -- [-2471.209] (-2493.038) (-2477.351) (-2476.960) * (-2476.238) [-2466.433] (-2483.809) (-2478.269) -- 0:02:32 561500 -- (-2475.428) (-2492.447) (-2480.493) [-2470.743] * (-2463.696) (-2475.513) (-2483.481) [-2475.858] -- 0:02:33 562000 -- (-2477.557) (-2492.980) (-2484.642) [-2484.801] * (-2467.258) [-2468.601] (-2478.400) (-2476.675) -- 0:02:32 562500 -- (-2467.457) [-2466.597] (-2483.888) (-2477.310) * [-2476.389] (-2484.427) (-2476.349) (-2484.821) -- 0:02:32 563000 -- (-2477.875) (-2481.972) [-2484.695] (-2471.452) * (-2477.109) (-2478.373) (-2480.408) [-2470.608] -- 0:02:32 563500 -- (-2481.580) [-2479.212] (-2476.917) (-2465.530) * (-2474.848) [-2473.880] (-2471.092) (-2479.531) -- 0:02:31 564000 -- (-2479.255) (-2480.435) (-2481.822) [-2468.266] * [-2469.489] (-2479.847) (-2479.821) (-2483.297) -- 0:02:31 564500 -- (-2478.629) [-2474.741] (-2490.999) (-2488.673) * (-2471.238) [-2473.138] (-2482.369) (-2476.211) -- 0:02:31 565000 -- (-2470.919) (-2469.159) [-2476.410] (-2486.666) * (-2476.623) (-2466.882) (-2471.832) [-2471.656] -- 0:02:31 Average standard deviation of split frequencies: 0.008273 565500 -- (-2484.324) (-2472.605) (-2471.968) [-2474.393] * (-2472.891) (-2478.522) (-2492.314) [-2468.754] -- 0:02:31 566000 -- (-2481.119) (-2482.323) (-2483.942) [-2473.543] * [-2474.261] (-2473.447) (-2485.013) (-2472.129) -- 0:02:31 566500 -- (-2483.267) (-2479.652) (-2471.608) [-2470.012] * [-2473.679] (-2475.793) (-2480.619) (-2478.249) -- 0:02:30 567000 -- [-2480.267] (-2485.900) (-2475.983) (-2477.800) * (-2477.989) (-2484.237) [-2470.507] (-2471.535) -- 0:02:30 567500 -- (-2487.528) [-2486.696] (-2475.551) (-2475.427) * (-2469.745) (-2480.205) (-2478.700) [-2467.081] -- 0:02:30 568000 -- [-2486.916] (-2477.571) (-2480.348) (-2471.619) * (-2469.681) (-2471.823) (-2489.115) [-2470.151] -- 0:02:30 568500 -- [-2478.240] (-2475.389) (-2478.177) (-2474.458) * (-2466.057) (-2463.351) (-2478.238) [-2474.325] -- 0:02:30 569000 -- (-2472.659) [-2471.740] (-2478.760) (-2473.361) * (-2472.989) [-2472.962] (-2476.556) (-2479.877) -- 0:02:29 569500 -- (-2474.654) (-2484.857) (-2470.953) [-2469.964] * (-2476.505) [-2475.588] (-2482.596) (-2479.166) -- 0:02:29 570000 -- (-2473.939) (-2483.050) (-2478.492) [-2470.075] * [-2468.951] (-2478.803) (-2481.132) (-2483.152) -- 0:02:29 Average standard deviation of split frequencies: 0.009032 570500 -- (-2476.440) (-2483.721) (-2475.786) [-2471.807] * (-2469.901) [-2474.058] (-2482.654) (-2475.554) -- 0:02:29 571000 -- (-2482.630) [-2476.218] (-2475.979) (-2469.410) * (-2473.798) [-2473.712] (-2476.663) (-2482.046) -- 0:02:28 571500 -- (-2478.177) (-2484.670) (-2472.247) [-2467.833] * (-2482.699) (-2477.921) (-2478.533) [-2466.026] -- 0:02:29 572000 -- (-2485.717) (-2483.813) [-2470.772] (-2471.285) * (-2471.937) [-2477.943] (-2477.783) (-2479.829) -- 0:02:28 572500 -- [-2472.741] (-2482.177) (-2479.468) (-2483.647) * (-2475.992) [-2471.667] (-2482.882) (-2483.816) -- 0:02:28 573000 -- (-2473.913) (-2483.455) (-2487.275) [-2471.706] * (-2477.799) (-2474.343) [-2476.125] (-2484.711) -- 0:02:28 573500 -- (-2465.979) (-2474.308) [-2470.131] (-2481.852) * [-2484.438] (-2465.946) (-2476.824) (-2477.455) -- 0:02:27 574000 -- (-2473.539) (-2487.475) (-2470.880) [-2474.620] * (-2472.479) [-2472.394] (-2479.312) (-2481.121) -- 0:02:27 574500 -- (-2481.900) (-2495.443) [-2466.895] (-2471.212) * (-2473.484) [-2470.864] (-2478.025) (-2467.765) -- 0:02:28 575000 -- (-2474.165) (-2482.463) [-2471.536] (-2477.903) * [-2481.172] (-2476.864) (-2481.833) (-2492.056) -- 0:02:27 Average standard deviation of split frequencies: 0.009938 575500 -- [-2475.343] (-2475.964) (-2474.467) (-2478.569) * (-2478.044) [-2467.306] (-2473.951) (-2482.092) -- 0:02:27 576000 -- (-2480.181) [-2469.628] (-2468.191) (-2477.219) * [-2470.747] (-2478.351) (-2482.232) (-2484.747) -- 0:02:27 576500 -- (-2490.949) [-2474.784] (-2479.961) (-2466.206) * (-2478.534) (-2467.487) (-2476.381) [-2474.056] -- 0:02:27 577000 -- [-2470.086] (-2470.281) (-2498.330) (-2482.449) * (-2483.397) (-2470.732) (-2482.262) [-2479.626] -- 0:02:27 577500 -- (-2473.900) [-2471.903] (-2472.320) (-2482.885) * (-2466.648) [-2473.936] (-2490.095) (-2470.321) -- 0:02:27 578000 -- (-2480.984) (-2481.067) [-2467.393] (-2479.351) * (-2469.221) (-2473.015) (-2492.763) [-2470.138] -- 0:02:26 578500 -- (-2466.915) (-2484.515) (-2472.364) [-2470.897] * (-2470.284) [-2468.825] (-2483.541) (-2472.362) -- 0:02:26 579000 -- (-2480.948) (-2477.547) [-2487.072] (-2474.176) * (-2477.636) (-2480.358) (-2476.067) [-2472.344] -- 0:02:26 579500 -- (-2482.966) [-2478.440] (-2476.970) (-2478.135) * (-2486.880) (-2484.638) (-2487.348) [-2464.154] -- 0:02:26 580000 -- (-2482.173) (-2473.155) [-2478.058] (-2481.024) * (-2480.800) (-2490.585) [-2471.474] (-2471.142) -- 0:02:26 Average standard deviation of split frequencies: 0.009394 580500 -- (-2475.754) (-2476.003) (-2476.408) [-2474.078] * (-2485.819) (-2482.570) [-2468.893] (-2480.392) -- 0:02:25 581000 -- (-2475.319) (-2477.415) (-2488.821) [-2475.232] * (-2484.234) [-2476.399] (-2466.442) (-2473.621) -- 0:02:25 581500 -- (-2479.070) [-2470.138] (-2483.306) (-2478.966) * (-2470.243) (-2488.619) [-2473.285] (-2476.371) -- 0:02:25 582000 -- [-2468.799] (-2470.753) (-2474.940) (-2468.755) * (-2470.243) [-2477.052] (-2472.154) (-2474.308) -- 0:02:25 582500 -- (-2480.498) (-2479.890) [-2471.159] (-2467.001) * (-2470.383) (-2472.697) (-2476.161) [-2466.563] -- 0:02:25 583000 -- (-2470.141) (-2481.302) (-2473.198) [-2469.125] * (-2479.128) (-2470.610) [-2478.723] (-2475.717) -- 0:02:25 583500 -- (-2484.441) [-2473.174] (-2483.394) (-2474.036) * (-2476.599) [-2478.643] (-2480.831) (-2480.264) -- 0:02:24 584000 -- [-2474.213] (-2483.101) (-2475.013) (-2475.040) * (-2478.415) (-2477.226) (-2499.195) [-2469.232] -- 0:02:24 584500 -- [-2477.424] (-2470.776) (-2469.141) (-2478.874) * (-2475.022) (-2480.163) (-2476.988) [-2470.337] -- 0:02:25 585000 -- (-2473.576) (-2475.088) (-2482.634) [-2468.770] * [-2475.752] (-2476.721) (-2470.007) (-2479.507) -- 0:02:24 Average standard deviation of split frequencies: 0.008098 585500 -- (-2469.924) (-2476.268) [-2472.067] (-2476.494) * [-2470.987] (-2479.213) (-2469.664) (-2478.269) -- 0:02:24 586000 -- (-2479.612) (-2475.565) (-2478.163) [-2477.727] * [-2472.939] (-2482.408) (-2469.184) (-2476.664) -- 0:02:24 586500 -- (-2472.596) [-2474.467] (-2479.852) (-2471.709) * (-2474.365) (-2494.371) [-2469.851] (-2476.426) -- 0:02:23 587000 -- (-2479.799) (-2475.321) (-2469.750) [-2470.479] * (-2480.435) (-2467.944) [-2475.599] (-2481.396) -- 0:02:24 587500 -- [-2472.308] (-2479.585) (-2477.294) (-2478.081) * (-2482.705) (-2463.549) [-2468.590] (-2467.644) -- 0:02:23 588000 -- [-2475.136] (-2488.179) (-2478.514) (-2475.930) * (-2476.212) [-2468.970] (-2467.498) (-2476.535) -- 0:02:23 588500 -- (-2470.986) [-2475.673] (-2481.720) (-2471.406) * (-2483.709) [-2472.189] (-2483.353) (-2472.083) -- 0:02:23 589000 -- [-2473.441] (-2462.425) (-2499.099) (-2487.470) * (-2477.049) (-2479.390) (-2483.055) [-2469.034] -- 0:02:23 589500 -- (-2476.730) (-2469.661) [-2479.508] (-2481.270) * (-2484.365) (-2481.717) [-2472.962] (-2481.173) -- 0:02:22 590000 -- (-2477.249) (-2472.121) (-2475.030) [-2470.523] * (-2473.747) [-2465.722] (-2472.566) (-2474.909) -- 0:02:23 Average standard deviation of split frequencies: 0.009748 590500 -- [-2477.449] (-2475.918) (-2472.372) (-2476.424) * (-2468.750) (-2470.114) [-2473.628] (-2470.578) -- 0:02:22 591000 -- (-2471.641) [-2464.462] (-2480.767) (-2467.629) * [-2477.141] (-2480.586) (-2473.422) (-2477.812) -- 0:02:22 591500 -- (-2469.392) (-2478.142) (-2485.923) [-2471.154] * [-2470.753] (-2476.409) (-2475.166) (-2482.015) -- 0:02:22 592000 -- (-2480.989) (-2471.669) (-2480.117) [-2466.558] * [-2473.331] (-2466.871) (-2470.017) (-2486.040) -- 0:02:21 592500 -- (-2470.717) (-2474.855) (-2477.490) [-2473.044] * (-2481.250) (-2485.501) [-2465.503] (-2470.063) -- 0:02:21 593000 -- (-2473.541) (-2488.475) (-2479.082) [-2475.741] * (-2473.939) (-2477.940) [-2469.493] (-2485.941) -- 0:02:22 593500 -- (-2480.044) [-2474.836] (-2469.426) (-2477.265) * (-2476.408) [-2473.358] (-2476.810) (-2472.678) -- 0:02:21 594000 -- (-2477.339) [-2471.591] (-2496.038) (-2485.352) * [-2473.538] (-2484.816) (-2475.255) (-2470.668) -- 0:02:21 594500 -- (-2481.869) [-2472.391] (-2484.001) (-2487.158) * [-2470.941] (-2489.733) (-2469.692) (-2470.946) -- 0:02:21 595000 -- (-2473.401) [-2478.976] (-2479.840) (-2480.355) * [-2475.670] (-2480.708) (-2472.788) (-2478.694) -- 0:02:20 Average standard deviation of split frequencies: 0.009661 595500 -- (-2473.024) [-2476.602] (-2478.877) (-2480.822) * (-2476.107) [-2474.220] (-2477.943) (-2475.263) -- 0:02:20 596000 -- (-2480.370) [-2471.880] (-2493.538) (-2474.389) * [-2481.203] (-2471.497) (-2478.836) (-2479.232) -- 0:02:20 596500 -- (-2470.878) [-2471.102] (-2489.795) (-2476.591) * (-2472.569) [-2474.046] (-2464.696) (-2476.118) -- 0:02:20 597000 -- [-2470.427] (-2479.884) (-2481.243) (-2471.620) * [-2469.565] (-2475.119) (-2478.189) (-2478.984) -- 0:02:20 597500 -- [-2467.008] (-2475.963) (-2470.671) (-2477.214) * (-2479.741) (-2471.836) [-2470.702] (-2477.236) -- 0:02:20 598000 -- (-2476.732) [-2477.778] (-2487.147) (-2482.284) * (-2472.491) [-2465.374] (-2474.567) (-2471.599) -- 0:02:19 598500 -- (-2477.377) (-2488.529) (-2474.446) [-2476.130] * (-2479.478) (-2473.122) [-2476.216] (-2474.706) -- 0:02:19 599000 -- [-2465.183] (-2475.091) (-2480.942) (-2470.871) * (-2476.114) (-2476.778) (-2478.043) [-2475.414] -- 0:02:19 599500 -- [-2478.229] (-2476.909) (-2478.429) (-2475.080) * [-2467.706] (-2467.375) (-2485.776) (-2472.810) -- 0:02:19 600000 -- (-2476.665) (-2469.495) (-2474.769) [-2476.184] * (-2474.272) (-2470.579) [-2467.613] (-2473.097) -- 0:02:19 Average standard deviation of split frequencies: 0.010034 600500 -- (-2474.910) (-2482.120) (-2472.446) [-2467.131] * [-2462.231] (-2475.661) (-2479.281) (-2475.185) -- 0:02:19 601000 -- [-2467.673] (-2478.936) (-2477.497) (-2473.034) * (-2485.351) (-2471.718) (-2478.146) [-2469.909] -- 0:02:18 601500 -- (-2466.376) (-2480.965) [-2469.755] (-2474.325) * [-2476.625] (-2477.483) (-2469.869) (-2477.404) -- 0:02:18 602000 -- (-2472.850) (-2489.295) (-2472.284) [-2475.691] * (-2479.961) (-2473.008) [-2472.968] (-2470.470) -- 0:02:18 602500 -- (-2481.677) [-2475.850] (-2477.937) (-2476.726) * [-2464.975] (-2476.942) (-2476.495) (-2481.879) -- 0:02:18 603000 -- [-2470.429] (-2472.962) (-2479.051) (-2476.166) * (-2468.784) (-2484.372) [-2465.242] (-2473.551) -- 0:02:18 603500 -- (-2465.920) (-2471.627) [-2474.375] (-2482.104) * (-2473.009) (-2478.215) (-2470.878) [-2470.681] -- 0:02:17 604000 -- [-2471.019] (-2474.889) (-2479.672) (-2483.953) * [-2474.627] (-2473.736) (-2477.192) (-2478.797) -- 0:02:17 604500 -- (-2478.027) [-2467.395] (-2478.747) (-2481.395) * (-2483.137) (-2479.453) [-2477.773] (-2477.393) -- 0:02:17 605000 -- (-2468.987) (-2482.812) (-2486.119) [-2478.315] * (-2473.868) [-2472.471] (-2482.771) (-2467.990) -- 0:02:17 Average standard deviation of split frequencies: 0.010113 605500 -- [-2480.124] (-2474.402) (-2487.935) (-2469.216) * (-2476.809) (-2478.778) (-2466.708) [-2464.295] -- 0:02:17 606000 -- (-2476.912) [-2473.684] (-2472.688) (-2479.061) * (-2481.164) (-2479.448) [-2467.073] (-2493.459) -- 0:02:17 606500 -- (-2482.194) (-2479.123) (-2474.464) [-2464.444] * (-2460.309) (-2476.779) [-2464.790] (-2477.231) -- 0:02:16 607000 -- (-2475.506) (-2476.623) (-2472.483) [-2477.554] * (-2475.607) [-2473.469] (-2472.852) (-2479.286) -- 0:02:16 607500 -- (-2467.634) (-2499.117) (-2464.199) [-2469.405] * [-2469.197] (-2473.164) (-2476.690) (-2480.028) -- 0:02:16 608000 -- (-2485.658) (-2477.356) [-2467.563] (-2475.069) * (-2471.667) (-2473.381) [-2471.211] (-2477.817) -- 0:02:16 608500 -- (-2482.335) (-2487.963) [-2474.264] (-2474.269) * [-2480.504] (-2479.554) (-2467.288) (-2468.355) -- 0:02:16 609000 -- (-2484.769) (-2481.074) [-2468.798] (-2483.388) * (-2473.344) (-2484.610) [-2477.378] (-2487.881) -- 0:02:16 609500 -- (-2474.552) [-2475.964] (-2491.408) (-2470.667) * (-2478.171) (-2466.366) [-2468.003] (-2470.317) -- 0:02:15 610000 -- (-2481.389) [-2470.726] (-2479.792) (-2474.374) * (-2485.958) (-2470.313) [-2477.299] (-2481.154) -- 0:02:15 Average standard deviation of split frequencies: 0.010697 610500 -- [-2474.486] (-2477.291) (-2474.124) (-2473.526) * (-2476.887) (-2471.002) [-2468.264] (-2474.582) -- 0:02:15 611000 -- (-2480.369) [-2469.808] (-2482.626) (-2478.333) * (-2492.957) (-2476.369) [-2472.107] (-2469.476) -- 0:02:15 611500 -- (-2478.913) [-2467.577] (-2475.457) (-2485.812) * (-2478.384) [-2471.350] (-2481.452) (-2480.295) -- 0:02:15 612000 -- (-2475.276) (-2466.619) (-2493.452) [-2480.951] * [-2466.734] (-2471.803) (-2472.946) (-2482.690) -- 0:02:15 612500 -- (-2473.972) [-2472.912] (-2480.870) (-2473.910) * [-2466.461] (-2461.505) (-2485.781) (-2469.666) -- 0:02:14 613000 -- (-2477.110) [-2476.721] (-2487.351) (-2482.791) * (-2469.532) (-2474.552) [-2467.862] (-2480.763) -- 0:02:14 613500 -- (-2473.355) [-2478.078] (-2482.666) (-2484.046) * (-2485.885) [-2468.263] (-2468.858) (-2468.680) -- 0:02:14 614000 -- (-2483.291) (-2478.937) [-2481.173] (-2478.363) * [-2474.861] (-2474.686) (-2472.878) (-2471.324) -- 0:02:14 614500 -- (-2488.272) (-2483.007) (-2478.458) [-2482.545] * (-2471.999) (-2487.555) (-2477.665) [-2472.048] -- 0:02:14 615000 -- (-2483.072) [-2476.103] (-2479.202) (-2473.098) * (-2471.244) [-2472.215] (-2475.221) (-2467.047) -- 0:02:13 Average standard deviation of split frequencies: 0.010987 615500 -- (-2481.489) (-2478.448) [-2472.929] (-2483.612) * (-2471.842) (-2470.234) [-2473.160] (-2472.477) -- 0:02:13 616000 -- [-2475.530] (-2479.890) (-2478.600) (-2473.434) * (-2485.487) (-2476.002) [-2474.046] (-2480.979) -- 0:02:13 616500 -- (-2470.916) (-2484.368) (-2490.788) [-2477.374] * (-2478.938) [-2480.093] (-2479.366) (-2469.695) -- 0:02:13 617000 -- [-2475.648] (-2478.595) (-2484.811) (-2480.312) * [-2487.427] (-2484.770) (-2477.293) (-2467.209) -- 0:02:13 617500 -- [-2474.377] (-2479.340) (-2490.853) (-2479.166) * [-2476.484] (-2473.813) (-2488.083) (-2489.833) -- 0:02:13 618000 -- (-2478.792) (-2492.346) (-2497.083) [-2475.791] * [-2476.589] (-2475.568) (-2474.106) (-2472.210) -- 0:02:12 618500 -- [-2483.253] (-2482.473) (-2489.184) (-2483.104) * (-2478.109) [-2472.247] (-2469.259) (-2477.179) -- 0:02:12 619000 -- (-2481.292) (-2476.176) (-2481.529) [-2482.176] * (-2479.249) [-2464.463] (-2468.910) (-2479.521) -- 0:02:12 619500 -- (-2483.774) [-2480.901] (-2483.419) (-2473.244) * [-2470.668] (-2467.064) (-2484.037) (-2485.437) -- 0:02:12 620000 -- (-2478.005) (-2477.174) (-2486.872) [-2476.719] * (-2479.155) (-2468.723) (-2489.961) [-2476.883] -- 0:02:12 Average standard deviation of split frequencies: 0.010470 620500 -- (-2474.438) (-2485.826) [-2470.870] (-2484.858) * (-2477.511) (-2466.484) (-2469.688) [-2478.737] -- 0:02:12 621000 -- [-2475.716] (-2483.742) (-2481.486) (-2489.401) * (-2477.333) (-2476.930) (-2472.520) [-2469.494] -- 0:02:11 621500 -- (-2488.960) (-2486.183) [-2478.885] (-2480.896) * (-2474.908) [-2483.968] (-2469.518) (-2474.148) -- 0:02:11 622000 -- (-2482.776) (-2479.555) (-2485.395) [-2474.977] * (-2487.854) (-2471.269) (-2474.988) [-2474.695] -- 0:02:11 622500 -- (-2482.307) [-2476.357] (-2469.963) (-2482.854) * (-2470.171) [-2467.105] (-2472.163) (-2474.024) -- 0:02:11 623000 -- [-2471.368] (-2477.597) (-2473.806) (-2487.657) * (-2472.751) (-2469.311) [-2467.220] (-2484.955) -- 0:02:11 623500 -- (-2475.964) (-2482.801) (-2472.794) [-2475.433] * (-2473.527) (-2485.273) (-2466.472) [-2475.875] -- 0:02:11 624000 -- (-2474.097) [-2470.831] (-2473.522) (-2492.459) * (-2466.970) [-2471.536] (-2480.490) (-2489.264) -- 0:02:10 624500 -- (-2480.473) (-2483.090) [-2472.006] (-2482.166) * (-2471.281) (-2479.863) (-2473.176) [-2477.246] -- 0:02:10 625000 -- (-2478.146) [-2477.546] (-2467.364) (-2481.756) * (-2482.575) (-2478.800) (-2472.319) [-2468.057] -- 0:02:10 Average standard deviation of split frequencies: 0.010292 625500 -- (-2479.211) (-2477.652) [-2471.059] (-2480.857) * (-2467.758) [-2470.222] (-2470.280) (-2480.681) -- 0:02:10 626000 -- (-2468.467) (-2479.241) [-2461.748] (-2481.150) * (-2469.924) [-2474.482] (-2480.483) (-2470.861) -- 0:02:10 626500 -- [-2474.936] (-2481.821) (-2486.861) (-2479.776) * (-2475.029) [-2474.460] (-2475.603) (-2479.530) -- 0:02:09 627000 -- (-2495.826) (-2486.011) (-2477.420) [-2470.453] * (-2470.927) (-2476.878) (-2482.394) [-2465.784] -- 0:02:09 627500 -- (-2479.898) (-2480.546) [-2467.104] (-2470.910) * (-2471.494) (-2476.803) [-2481.704] (-2473.203) -- 0:02:09 628000 -- [-2472.740] (-2485.546) (-2486.279) (-2473.358) * (-2467.685) [-2466.953] (-2475.866) (-2470.213) -- 0:02:09 628500 -- (-2483.851) (-2478.580) [-2475.728] (-2479.736) * (-2482.035) (-2482.875) [-2473.178] (-2474.421) -- 0:02:09 629000 -- (-2468.510) [-2470.135] (-2471.337) (-2478.555) * (-2482.842) (-2472.964) [-2465.198] (-2481.401) -- 0:02:09 629500 -- [-2465.119] (-2468.090) (-2473.047) (-2480.002) * (-2477.332) (-2482.838) (-2482.431) [-2477.328] -- 0:02:08 630000 -- (-2475.384) (-2478.385) [-2469.408] (-2477.271) * (-2482.499) (-2483.297) (-2488.857) [-2469.116] -- 0:02:08 Average standard deviation of split frequencies: 0.010564 630500 -- (-2474.343) [-2473.214] (-2467.803) (-2475.377) * (-2473.643) (-2499.227) (-2470.541) [-2476.933] -- 0:02:08 631000 -- (-2473.431) (-2473.436) [-2464.494] (-2477.758) * [-2464.985] (-2474.161) (-2485.327) (-2483.059) -- 0:02:08 631500 -- (-2485.635) (-2474.760) (-2476.587) [-2478.352] * [-2468.331] (-2472.037) (-2481.840) (-2485.844) -- 0:02:08 632000 -- (-2474.368) (-2473.192) (-2475.485) [-2469.333] * [-2474.486] (-2476.115) (-2475.430) (-2472.508) -- 0:02:08 632500 -- [-2476.862] (-2475.255) (-2473.408) (-2475.544) * [-2471.661] (-2474.408) (-2480.324) (-2474.965) -- 0:02:07 633000 -- [-2467.162] (-2477.693) (-2475.041) (-2475.673) * [-2468.729] (-2478.127) (-2471.098) (-2468.963) -- 0:02:08 633500 -- (-2468.926) [-2479.241] (-2486.748) (-2476.920) * (-2472.254) (-2474.728) (-2491.832) [-2469.706] -- 0:02:07 634000 -- (-2474.179) (-2478.429) (-2479.899) [-2476.368] * (-2491.581) (-2470.938) [-2482.009] (-2474.665) -- 0:02:07 634500 -- (-2467.691) (-2483.430) (-2479.082) [-2472.637] * (-2484.861) (-2473.937) (-2472.059) [-2477.989] -- 0:02:07 635000 -- (-2470.523) [-2469.957] (-2478.924) (-2472.199) * (-2475.207) [-2475.636] (-2475.668) (-2472.430) -- 0:02:07 Average standard deviation of split frequencies: 0.010574 635500 -- (-2477.650) (-2471.873) [-2480.019] (-2474.224) * (-2484.327) (-2472.067) [-2469.867] (-2481.973) -- 0:02:06 636000 -- (-2477.032) (-2484.165) (-2473.991) [-2470.851] * (-2477.916) (-2480.214) (-2481.085) [-2469.521] -- 0:02:07 636500 -- (-2469.158) [-2468.189] (-2493.846) (-2476.795) * (-2487.929) [-2466.870] (-2477.492) (-2465.895) -- 0:02:06 637000 -- [-2472.293] (-2481.289) (-2485.862) (-2486.014) * (-2478.458) [-2477.636] (-2474.034) (-2473.029) -- 0:02:06 637500 -- [-2472.439] (-2485.101) (-2490.297) (-2487.972) * (-2476.576) (-2477.068) (-2478.705) [-2477.927] -- 0:02:06 638000 -- (-2477.723) (-2474.430) [-2470.267] (-2482.159) * (-2475.721) [-2471.786] (-2468.572) (-2470.968) -- 0:02:05 638500 -- (-2489.368) [-2473.784] (-2470.196) (-2467.206) * (-2474.862) (-2487.342) [-2466.132] (-2478.750) -- 0:02:06 639000 -- (-2485.702) (-2479.813) (-2483.326) [-2471.258] * (-2469.765) (-2474.687) (-2466.724) [-2472.456] -- 0:02:05 639500 -- (-2472.645) (-2476.393) (-2478.146) [-2465.678] * [-2468.885] (-2469.205) (-2477.353) (-2479.646) -- 0:02:05 640000 -- [-2468.255] (-2474.705) (-2483.055) (-2485.371) * (-2480.371) [-2473.669] (-2475.326) (-2482.582) -- 0:02:05 Average standard deviation of split frequencies: 0.010932 640500 -- (-2485.553) [-2472.151] (-2490.375) (-2480.361) * (-2469.747) (-2476.282) [-2470.777] (-2478.522) -- 0:02:05 641000 -- (-2471.567) (-2473.660) (-2466.872) [-2470.573] * (-2484.150) (-2465.286) [-2467.910] (-2480.140) -- 0:02:04 641500 -- (-2468.766) (-2482.449) (-2468.113) [-2481.031] * (-2482.550) (-2478.671) (-2478.753) [-2469.946] -- 0:02:05 642000 -- (-2470.516) (-2468.320) (-2477.019) [-2473.198] * (-2484.238) (-2475.992) (-2470.939) [-2463.717] -- 0:02:04 642500 -- (-2483.726) (-2475.651) [-2479.932] (-2484.976) * (-2477.998) (-2485.029) (-2473.962) [-2470.465] -- 0:02:04 643000 -- (-2473.294) (-2473.403) (-2480.124) [-2472.278] * (-2474.268) (-2479.653) [-2471.639] (-2487.289) -- 0:02:04 643500 -- [-2471.144] (-2476.084) (-2469.096) (-2479.922) * (-2473.124) (-2482.304) (-2493.211) [-2473.802] -- 0:02:04 644000 -- (-2474.027) [-2473.980] (-2478.875) (-2478.359) * [-2468.600] (-2479.264) (-2495.622) (-2473.753) -- 0:02:03 644500 -- (-2478.277) (-2471.151) [-2478.706] (-2469.635) * (-2475.928) (-2475.102) [-2479.947] (-2470.532) -- 0:02:04 645000 -- (-2482.227) (-2470.879) (-2474.286) [-2472.010] * (-2480.510) [-2468.464] (-2474.255) (-2473.288) -- 0:02:03 Average standard deviation of split frequencies: 0.010022 645500 -- [-2476.902] (-2475.619) (-2490.616) (-2474.286) * (-2469.830) [-2475.615] (-2485.932) (-2472.441) -- 0:02:03 646000 -- [-2470.460] (-2469.573) (-2486.070) (-2490.796) * (-2476.427) (-2469.043) (-2481.246) [-2472.795] -- 0:02:03 646500 -- [-2464.657] (-2474.376) (-2489.354) (-2480.694) * [-2477.242] (-2482.924) (-2489.741) (-2471.012) -- 0:02:03 647000 -- (-2471.651) [-2468.522] (-2488.536) (-2474.781) * (-2475.032) (-2483.321) (-2477.222) [-2468.066] -- 0:02:02 647500 -- [-2469.669] (-2482.386) (-2482.576) (-2477.945) * (-2485.150) (-2478.676) (-2480.048) [-2472.677] -- 0:02:02 648000 -- [-2466.414] (-2482.317) (-2479.270) (-2473.400) * (-2487.288) [-2477.983] (-2465.912) (-2481.296) -- 0:02:02 648500 -- [-2466.527] (-2476.504) (-2484.185) (-2476.816) * (-2478.291) (-2479.513) [-2467.663] (-2474.359) -- 0:02:02 649000 -- (-2478.561) [-2469.225] (-2478.695) (-2471.587) * [-2477.575] (-2472.131) (-2476.981) (-2483.468) -- 0:02:02 649500 -- (-2477.247) (-2477.978) (-2481.459) [-2477.444] * (-2477.396) [-2467.027] (-2484.686) (-2477.541) -- 0:02:01 650000 -- (-2474.187) (-2476.258) [-2475.311] (-2483.318) * [-2474.027] (-2472.386) (-2481.480) (-2471.213) -- 0:02:01 Average standard deviation of split frequencies: 0.010609 650500 -- (-2470.978) [-2477.740] (-2481.282) (-2478.311) * (-2471.531) (-2480.612) [-2472.494] (-2474.485) -- 0:02:01 651000 -- [-2472.240] (-2475.453) (-2484.018) (-2488.697) * [-2472.108] (-2478.970) (-2468.891) (-2481.294) -- 0:02:01 651500 -- (-2488.036) [-2471.035] (-2475.682) (-2488.431) * [-2472.667] (-2477.033) (-2468.010) (-2471.409) -- 0:02:01 652000 -- (-2479.601) (-2478.582) (-2482.029) [-2470.524] * (-2485.866) (-2484.925) [-2467.362] (-2479.543) -- 0:02:01 652500 -- (-2478.539) (-2469.673) (-2479.688) [-2471.729] * (-2470.298) (-2495.841) [-2466.925] (-2480.863) -- 0:02:00 653000 -- (-2483.495) (-2478.014) (-2480.411) [-2472.532] * (-2480.027) (-2481.657) (-2478.606) [-2481.166] -- 0:02:00 653500 -- [-2475.746] (-2477.515) (-2480.951) (-2477.202) * (-2472.719) (-2477.268) [-2474.439] (-2482.115) -- 0:02:00 654000 -- (-2480.129) (-2478.920) [-2464.763] (-2482.982) * (-2482.764) (-2477.937) [-2472.392] (-2468.736) -- 0:02:00 654500 -- (-2469.572) [-2476.325] (-2489.228) (-2482.694) * (-2479.406) [-2475.456] (-2483.229) (-2483.216) -- 0:02:00 655000 -- [-2472.379] (-2475.628) (-2490.535) (-2473.264) * (-2466.215) [-2471.392] (-2464.035) (-2473.992) -- 0:02:00 Average standard deviation of split frequencies: 0.009701 655500 -- (-2482.437) [-2471.826] (-2481.999) (-2481.303) * (-2483.902) (-2479.247) (-2467.943) [-2462.399] -- 0:01:59 656000 -- [-2466.204] (-2476.561) (-2486.931) (-2485.432) * (-2472.234) (-2468.792) [-2470.739] (-2481.103) -- 0:01:59 656500 -- (-2470.027) (-2473.096) [-2471.388] (-2476.111) * (-2473.674) (-2476.997) (-2479.664) [-2477.733] -- 0:01:59 657000 -- (-2466.301) [-2474.323] (-2474.374) (-2474.886) * (-2479.569) (-2475.077) [-2476.792] (-2478.138) -- 0:01:59 657500 -- (-2504.371) [-2479.357] (-2485.288) (-2481.602) * [-2472.038] (-2486.794) (-2481.748) (-2474.951) -- 0:01:59 658000 -- (-2481.322) (-2477.712) [-2473.132] (-2479.063) * (-2472.890) [-2471.955] (-2468.729) (-2478.334) -- 0:01:59 658500 -- (-2486.467) [-2474.546] (-2470.698) (-2464.880) * [-2470.371] (-2480.625) (-2476.437) (-2479.422) -- 0:01:58 659000 -- (-2493.394) [-2472.810] (-2472.051) (-2474.690) * [-2468.568] (-2480.872) (-2474.844) (-2491.905) -- 0:01:58 659500 -- [-2470.299] (-2475.840) (-2481.266) (-2477.229) * (-2477.726) [-2466.076] (-2486.836) (-2473.547) -- 0:01:58 660000 -- (-2470.914) [-2474.412] (-2484.221) (-2480.832) * (-2495.039) [-2467.173] (-2473.494) (-2483.246) -- 0:01:57 Average standard deviation of split frequencies: 0.008613 660500 -- [-2474.088] (-2482.755) (-2483.751) (-2477.312) * (-2477.712) [-2476.653] (-2483.509) (-2487.419) -- 0:01:57 661000 -- (-2484.758) [-2468.418] (-2479.717) (-2471.939) * (-2473.577) (-2476.518) [-2466.208] (-2477.122) -- 0:01:57 661500 -- (-2476.691) (-2477.786) [-2473.148] (-2479.657) * (-2477.377) (-2481.179) [-2476.653] (-2469.739) -- 0:01:57 662000 -- (-2474.220) (-2476.771) (-2476.836) [-2476.815] * (-2476.719) [-2476.343] (-2482.811) (-2473.571) -- 0:01:57 662500 -- (-2483.003) (-2491.324) (-2475.008) [-2463.144] * (-2485.691) (-2490.526) [-2465.498] (-2484.169) -- 0:01:57 663000 -- (-2480.527) (-2472.888) (-2483.233) [-2471.663] * (-2485.522) (-2480.793) (-2472.793) [-2477.918] -- 0:01:56 663500 -- (-2465.365) [-2473.870] (-2475.411) (-2465.613) * (-2472.710) (-2475.601) [-2470.510] (-2481.343) -- 0:01:57 664000 -- (-2469.684) (-2474.607) (-2473.680) [-2472.936] * (-2475.707) (-2482.337) [-2469.799] (-2476.792) -- 0:01:56 664500 -- [-2474.641] (-2477.265) (-2478.497) (-2465.254) * [-2476.010] (-2474.915) (-2467.407) (-2478.267) -- 0:01:56 665000 -- (-2492.177) (-2476.970) (-2477.131) [-2474.404] * (-2472.592) (-2489.120) [-2472.706] (-2475.866) -- 0:01:56 Average standard deviation of split frequencies: 0.008352 665500 -- (-2476.116) [-2470.943] (-2474.337) (-2474.459) * [-2476.722] (-2488.439) (-2482.446) (-2480.409) -- 0:01:56 666000 -- (-2477.816) (-2476.495) (-2482.695) [-2470.898] * [-2474.450] (-2489.193) (-2483.317) (-2476.324) -- 0:01:56 666500 -- (-2475.110) [-2474.279] (-2481.169) (-2476.518) * [-2479.697] (-2479.038) (-2474.621) (-2473.700) -- 0:01:56 667000 -- (-2468.989) (-2484.176) (-2477.150) [-2468.502] * (-2493.382) (-2478.592) [-2483.883] (-2472.957) -- 0:01:55 667500 -- (-2476.181) (-2481.709) [-2473.724] (-2478.057) * [-2478.836] (-2481.174) (-2479.866) (-2474.257) -- 0:01:55 668000 -- (-2487.125) (-2474.334) [-2474.454] (-2475.574) * (-2479.522) (-2481.387) [-2471.651] (-2475.123) -- 0:01:55 668500 -- (-2485.818) (-2480.240) (-2479.873) [-2463.739] * (-2475.657) (-2473.108) [-2467.347] (-2469.839) -- 0:01:55 669000 -- [-2469.193] (-2476.295) (-2492.862) (-2481.163) * [-2480.302] (-2475.355) (-2477.484) (-2472.013) -- 0:01:55 669500 -- (-2478.865) (-2474.845) [-2481.066] (-2474.416) * (-2474.883) [-2468.255] (-2476.079) (-2480.286) -- 0:01:55 670000 -- (-2480.845) (-2473.678) (-2469.707) [-2479.479] * (-2474.707) (-2467.504) [-2477.650] (-2482.162) -- 0:01:54 Average standard deviation of split frequencies: 0.008482 670500 -- (-2481.238) [-2466.029] (-2474.755) (-2478.007) * [-2482.437] (-2475.711) (-2480.687) (-2482.197) -- 0:01:54 671000 -- (-2476.053) (-2475.727) (-2467.317) [-2480.310] * (-2475.064) (-2479.022) (-2477.908) [-2473.781] -- 0:01:54 671500 -- [-2478.393] (-2478.175) (-2476.288) (-2473.562) * [-2474.845] (-2484.036) (-2488.891) (-2473.908) -- 0:01:54 672000 -- [-2482.409] (-2476.472) (-2477.504) (-2480.391) * (-2480.437) (-2495.825) (-2473.539) [-2473.337] -- 0:01:54 672500 -- (-2476.816) [-2475.788] (-2483.557) (-2489.218) * [-2478.021] (-2488.427) (-2474.795) (-2481.584) -- 0:01:53 673000 -- (-2473.243) (-2478.774) (-2474.842) [-2471.092] * [-2477.243] (-2474.528) (-2470.635) (-2476.375) -- 0:01:54 673500 -- [-2482.149] (-2483.302) (-2483.542) (-2483.168) * (-2484.463) (-2478.482) [-2466.091] (-2474.742) -- 0:01:53 674000 -- (-2491.661) (-2483.327) (-2479.640) [-2471.426] * (-2470.041) (-2474.991) (-2479.226) [-2475.288] -- 0:01:53 674500 -- (-2486.935) (-2476.016) (-2481.628) [-2470.636] * [-2469.920] (-2475.217) (-2469.973) (-2480.705) -- 0:01:53 675000 -- (-2492.229) (-2482.135) [-2471.196] (-2471.223) * (-2488.288) (-2477.200) [-2473.528] (-2467.422) -- 0:01:53 Average standard deviation of split frequencies: 0.008694 675500 -- [-2475.685] (-2478.902) (-2474.771) (-2476.671) * (-2473.279) (-2473.329) (-2481.469) [-2471.385] -- 0:01:52 676000 -- (-2471.742) [-2479.021] (-2486.954) (-2471.167) * (-2476.182) [-2476.898] (-2481.473) (-2477.254) -- 0:01:53 676500 -- (-2475.330) (-2468.853) (-2471.646) [-2470.190] * (-2484.824) (-2466.715) [-2465.887] (-2476.310) -- 0:01:52 677000 -- (-2484.396) (-2478.292) [-2474.150] (-2476.012) * (-2473.431) (-2468.595) (-2478.746) [-2466.783] -- 0:01:52 677500 -- (-2465.586) [-2477.529] (-2482.810) (-2485.006) * (-2479.644) (-2473.119) (-2476.421) [-2471.103] -- 0:01:52 678000 -- (-2489.924) [-2470.169] (-2492.226) (-2476.502) * (-2478.730) [-2473.982] (-2471.489) (-2476.142) -- 0:01:52 678500 -- (-2477.101) [-2470.184] (-2473.320) (-2482.428) * (-2488.128) (-2485.832) [-2474.428] (-2475.618) -- 0:01:51 679000 -- (-2470.157) (-2490.971) (-2478.508) [-2470.081] * (-2471.664) (-2479.167) (-2468.779) [-2472.510] -- 0:01:52 679500 -- (-2482.166) [-2477.635] (-2483.697) (-2481.458) * (-2481.558) [-2471.600] (-2493.387) (-2473.877) -- 0:01:51 680000 -- (-2469.776) [-2482.359] (-2477.100) (-2492.299) * [-2469.685] (-2472.637) (-2480.573) (-2473.008) -- 0:01:51 Average standard deviation of split frequencies: 0.008080 680500 -- [-2477.630] (-2492.456) (-2490.314) (-2472.303) * (-2472.841) (-2479.788) [-2472.885] (-2475.370) -- 0:01:51 681000 -- (-2475.702) (-2473.464) [-2469.319] (-2479.281) * (-2472.437) (-2489.220) (-2475.789) [-2476.841] -- 0:01:51 681500 -- (-2473.303) (-2480.213) (-2475.501) [-2472.883] * (-2485.923) (-2475.787) (-2470.452) [-2467.308] -- 0:01:51 682000 -- (-2475.427) [-2471.903] (-2485.659) (-2473.925) * (-2482.541) (-2471.879) (-2467.094) [-2470.857] -- 0:01:50 682500 -- [-2488.304] (-2479.214) (-2486.359) (-2473.042) * [-2479.938] (-2472.244) (-2474.079) (-2475.092) -- 0:01:50 683000 -- (-2475.138) [-2482.863] (-2476.703) (-2477.114) * (-2486.863) (-2472.659) (-2479.154) [-2472.853] -- 0:01:50 683500 -- (-2489.306) (-2477.720) [-2475.385] (-2477.859) * (-2477.613) [-2464.338] (-2470.812) (-2485.950) -- 0:01:50 684000 -- (-2476.949) [-2465.765] (-2492.432) (-2479.099) * (-2480.474) [-2472.846] (-2468.016) (-2480.327) -- 0:01:49 684500 -- (-2492.895) (-2481.481) (-2481.554) [-2470.840] * (-2484.271) [-2474.731] (-2469.943) (-2468.816) -- 0:01:50 685000 -- (-2485.800) (-2475.304) (-2473.909) [-2478.843] * (-2473.356) [-2469.423] (-2475.960) (-2478.213) -- 0:01:49 Average standard deviation of split frequencies: 0.008109 685500 -- (-2480.713) (-2483.652) (-2476.175) [-2472.216] * (-2472.185) [-2472.437] (-2473.161) (-2481.312) -- 0:01:49 686000 -- [-2469.482] (-2477.528) (-2469.861) (-2481.496) * [-2473.515] (-2470.638) (-2470.332) (-2475.418) -- 0:01:49 686500 -- (-2486.800) [-2477.031] (-2469.871) (-2484.580) * (-2477.593) (-2500.685) [-2469.009] (-2480.376) -- 0:01:49 687000 -- (-2479.913) (-2471.029) (-2467.603) [-2476.912] * (-2484.980) (-2474.343) [-2461.785] (-2476.507) -- 0:01:49 687500 -- (-2475.527) [-2473.215] (-2463.233) (-2473.326) * (-2475.380) (-2488.812) [-2470.329] (-2475.625) -- 0:01:49 688000 -- (-2478.487) (-2491.951) (-2467.440) [-2474.792] * (-2480.433) [-2465.936] (-2474.155) (-2483.832) -- 0:01:48 688500 -- (-2475.689) (-2471.859) [-2466.561] (-2479.073) * [-2472.970] (-2470.509) (-2480.731) (-2487.184) -- 0:01:49 689000 -- (-2473.042) [-2477.663] (-2475.894) (-2480.136) * (-2470.608) (-2481.275) (-2476.996) [-2468.600] -- 0:01:48 689500 -- (-2472.438) (-2476.471) [-2470.644] (-2487.568) * (-2470.548) (-2492.940) (-2479.088) [-2470.007] -- 0:01:48 690000 -- (-2474.038) (-2482.311) [-2469.127] (-2470.255) * (-2479.068) (-2471.427) [-2472.974] (-2476.795) -- 0:01:48 Average standard deviation of split frequencies: 0.007781 690500 -- (-2485.315) (-2485.956) [-2479.900] (-2479.661) * (-2477.978) [-2470.239] (-2473.224) (-2481.307) -- 0:01:48 691000 -- (-2474.153) (-2472.167) (-2477.580) [-2468.143] * (-2473.725) (-2481.596) [-2479.682] (-2469.284) -- 0:01:47 691500 -- (-2474.586) (-2482.327) (-2470.183) [-2475.098] * (-2473.707) (-2490.963) (-2478.993) [-2470.099] -- 0:01:47 692000 -- (-2476.262) (-2465.603) (-2472.503) [-2475.437] * (-2475.144) [-2472.693] (-2477.952) (-2475.102) -- 0:01:47 692500 -- [-2465.954] (-2477.417) (-2474.591) (-2482.978) * (-2474.154) (-2480.909) (-2474.916) [-2464.976] -- 0:01:47 693000 -- (-2473.878) (-2476.167) [-2475.656] (-2487.995) * (-2468.668) (-2477.257) (-2474.896) [-2479.071] -- 0:01:47 693500 -- (-2485.954) (-2476.280) [-2471.347] (-2485.642) * (-2471.742) (-2475.207) [-2471.017] (-2477.654) -- 0:01:46 694000 -- (-2472.503) [-2473.382] (-2466.064) (-2489.701) * (-2488.112) (-2473.856) (-2487.462) [-2474.014] -- 0:01:46 694500 -- (-2484.554) [-2467.294] (-2473.662) (-2472.824) * (-2484.067) (-2480.216) (-2478.410) [-2479.461] -- 0:01:46 695000 -- (-2479.430) (-2486.628) [-2464.454] (-2474.072) * (-2486.008) (-2476.512) [-2477.105] (-2471.430) -- 0:01:46 Average standard deviation of split frequencies: 0.007721 695500 -- (-2473.675) (-2479.442) [-2465.001] (-2480.283) * [-2480.981] (-2481.383) (-2471.611) (-2471.521) -- 0:01:46 696000 -- [-2468.966] (-2486.500) (-2477.356) (-2478.448) * (-2480.144) (-2473.713) [-2475.675] (-2470.479) -- 0:01:46 696500 -- (-2471.491) [-2473.070] (-2479.202) (-2485.006) * (-2475.294) (-2467.957) (-2474.019) [-2478.832] -- 0:01:45 697000 -- [-2478.359] (-2468.968) (-2478.239) (-2475.735) * (-2475.186) (-2474.335) [-2476.126] (-2473.431) -- 0:01:46 697500 -- (-2470.342) [-2475.463] (-2476.112) (-2482.539) * (-2479.288) [-2475.803] (-2472.159) (-2480.111) -- 0:01:45 698000 -- (-2478.491) [-2470.655] (-2487.125) (-2477.091) * (-2480.302) (-2475.817) [-2478.147] (-2471.771) -- 0:01:45 698500 -- (-2464.137) (-2477.716) (-2472.520) [-2476.182] * (-2473.062) (-2479.913) (-2479.463) [-2479.420] -- 0:01:45 699000 -- (-2465.922) (-2481.103) [-2487.388] (-2477.731) * (-2474.541) (-2482.528) [-2466.674] (-2481.578) -- 0:01:45 699500 -- (-2479.950) (-2473.037) (-2474.528) [-2472.755] * (-2487.568) (-2478.839) [-2471.902] (-2489.724) -- 0:01:45 700000 -- [-2463.923] (-2476.647) (-2469.499) (-2484.873) * (-2472.393) [-2468.953] (-2487.076) (-2482.931) -- 0:01:45 Average standard deviation of split frequencies: 0.007535 700500 -- (-2470.851) [-2475.501] (-2469.958) (-2480.156) * [-2469.764] (-2476.702) (-2476.754) (-2489.083) -- 0:01:44 701000 -- (-2474.888) (-2477.517) (-2468.761) [-2480.056] * (-2473.145) [-2469.146] (-2486.353) (-2487.261) -- 0:01:44 701500 -- [-2477.586] (-2478.436) (-2472.325) (-2466.687) * [-2474.280] (-2472.214) (-2493.421) (-2482.384) -- 0:01:44 702000 -- (-2480.880) (-2482.414) [-2475.359] (-2473.708) * (-2481.994) (-2473.785) [-2469.579] (-2480.507) -- 0:01:44 702500 -- (-2475.591) (-2487.196) [-2473.299] (-2476.961) * [-2473.111] (-2478.978) (-2465.121) (-2476.449) -- 0:01:44 703000 -- [-2469.332] (-2473.750) (-2468.896) (-2487.948) * (-2476.196) (-2485.124) [-2478.597] (-2476.181) -- 0:01:44 703500 -- [-2468.356] (-2493.081) (-2476.039) (-2474.129) * [-2471.367] (-2466.542) (-2471.044) (-2488.787) -- 0:01:44 704000 -- (-2474.724) (-2480.783) [-2469.700] (-2470.749) * [-2475.840] (-2474.741) (-2467.718) (-2485.742) -- 0:01:43 704500 -- (-2475.447) (-2480.065) (-2471.630) [-2462.170] * [-2473.428] (-2470.869) (-2479.726) (-2477.398) -- 0:01:43 705000 -- (-2479.243) (-2479.016) (-2494.116) [-2465.307] * (-2483.778) [-2466.781] (-2475.423) (-2476.261) -- 0:01:43 Average standard deviation of split frequencies: 0.007478 705500 -- (-2488.193) (-2478.665) (-2482.586) [-2472.564] * [-2476.277] (-2483.381) (-2487.570) (-2474.634) -- 0:01:43 706000 -- [-2482.938] (-2472.926) (-2483.093) (-2475.255) * (-2477.467) (-2483.372) [-2474.099] (-2469.269) -- 0:01:43 706500 -- (-2501.969) [-2472.003] (-2477.784) (-2481.352) * (-2478.673) (-2479.666) [-2476.391] (-2471.363) -- 0:01:43 707000 -- (-2479.223) (-2478.279) [-2474.132] (-2480.055) * (-2490.869) [-2485.577] (-2487.462) (-2470.071) -- 0:01:42 707500 -- (-2479.664) (-2475.271) [-2475.422] (-2483.468) * [-2486.254] (-2487.910) (-2478.629) (-2469.114) -- 0:01:42 708000 -- [-2469.262] (-2477.021) (-2475.833) (-2479.140) * (-2480.224) [-2477.007] (-2474.077) (-2472.555) -- 0:01:42 708500 -- (-2491.076) [-2471.756] (-2478.881) (-2486.969) * (-2483.766) [-2475.075] (-2497.487) (-2476.271) -- 0:01:42 709000 -- (-2474.680) (-2480.614) [-2468.770] (-2483.266) * (-2479.699) (-2479.806) (-2478.444) [-2475.141] -- 0:01:42 709500 -- [-2466.033] (-2469.131) (-2473.913) (-2484.551) * (-2488.437) (-2478.606) [-2471.937] (-2472.426) -- 0:01:41 710000 -- (-2476.591) [-2471.396] (-2478.229) (-2483.982) * (-2490.726) (-2471.610) (-2476.266) [-2471.898] -- 0:01:41 Average standard deviation of split frequencies: 0.007031 710500 -- [-2472.884] (-2473.054) (-2476.409) (-2477.158) * (-2484.518) [-2477.972] (-2469.417) (-2475.195) -- 0:01:41 711000 -- (-2470.035) [-2468.600] (-2485.008) (-2475.182) * (-2481.703) (-2490.767) [-2475.108] (-2473.372) -- 0:01:41 711500 -- (-2478.911) [-2473.124] (-2473.341) (-2476.595) * (-2488.184) (-2474.676) (-2470.939) [-2479.293] -- 0:01:41 712000 -- [-2463.172] (-2467.220) (-2480.493) (-2476.972) * (-2484.350) [-2470.835] (-2476.164) (-2477.363) -- 0:01:41 712500 -- (-2473.778) (-2474.476) [-2479.722] (-2490.637) * [-2480.037] (-2469.543) (-2476.658) (-2478.914) -- 0:01:40 713000 -- (-2484.538) [-2474.306] (-2471.017) (-2471.838) * (-2480.096) [-2470.684] (-2479.494) (-2483.158) -- 0:01:40 713500 -- [-2470.642] (-2473.507) (-2491.176) (-2480.255) * (-2476.798) (-2479.377) (-2471.628) [-2476.706] -- 0:01:40 714000 -- (-2475.316) (-2478.926) (-2490.730) [-2466.318] * (-2478.429) (-2476.189) [-2463.022] (-2474.016) -- 0:01:40 714500 -- (-2471.553) [-2478.506] (-2480.840) (-2473.278) * (-2473.307) (-2475.019) [-2475.125] (-2482.680) -- 0:01:40 715000 -- [-2464.020] (-2483.778) (-2473.733) (-2475.543) * (-2479.904) (-2480.087) (-2472.684) [-2477.862] -- 0:01:40 Average standard deviation of split frequencies: 0.006759 715500 -- (-2471.856) [-2485.087] (-2475.217) (-2482.529) * (-2473.330) [-2474.689] (-2480.268) (-2477.268) -- 0:01:39 716000 -- (-2481.204) (-2484.999) (-2494.427) [-2490.285] * (-2482.072) (-2490.759) [-2470.389] (-2483.868) -- 0:01:39 716500 -- (-2486.521) [-2473.422] (-2485.753) (-2480.014) * (-2476.710) [-2477.357] (-2473.382) (-2490.688) -- 0:01:39 717000 -- (-2476.753) [-2469.163] (-2480.136) (-2499.882) * (-2481.217) (-2481.310) (-2476.599) [-2477.968] -- 0:01:39 717500 -- [-2473.823] (-2468.132) (-2473.448) (-2475.101) * (-2482.505) (-2473.460) (-2472.264) [-2475.269] -- 0:01:39 718000 -- (-2473.237) [-2466.610] (-2480.071) (-2476.947) * (-2482.206) (-2476.330) (-2486.221) [-2472.587] -- 0:01:38 718500 -- [-2480.854] (-2481.901) (-2471.062) (-2466.771) * (-2482.455) (-2471.035) [-2469.573] (-2484.467) -- 0:01:38 719000 -- (-2475.062) (-2473.262) [-2473.357] (-2470.656) * (-2478.934) [-2475.059] (-2480.000) (-2469.042) -- 0:01:38 719500 -- (-2479.694) (-2469.749) (-2471.999) [-2465.687] * (-2481.492) [-2477.472] (-2479.410) (-2468.616) -- 0:01:38 720000 -- (-2490.947) (-2474.482) (-2479.045) [-2469.650] * (-2484.818) (-2478.894) (-2481.140) [-2476.915] -- 0:01:38 Average standard deviation of split frequencies: 0.006716 720500 -- (-2487.630) (-2474.456) [-2472.166] (-2467.308) * (-2474.311) (-2472.814) [-2469.076] (-2474.636) -- 0:01:38 721000 -- (-2489.715) [-2471.617] (-2467.456) (-2470.756) * (-2472.108) [-2469.753] (-2483.057) (-2476.931) -- 0:01:37 721500 -- (-2504.597) (-2487.457) (-2485.574) [-2471.862] * (-2478.339) (-2479.521) (-2476.651) [-2467.708] -- 0:01:37 722000 -- (-2481.966) (-2468.030) (-2476.886) [-2472.523] * (-2478.747) (-2474.587) (-2485.338) [-2474.502] -- 0:01:37 722500 -- (-2486.599) [-2474.932] (-2476.555) (-2471.258) * (-2475.783) (-2482.931) [-2468.183] (-2476.809) -- 0:01:37 723000 -- (-2472.464) [-2469.124] (-2477.213) (-2480.176) * [-2483.396] (-2483.361) (-2468.698) (-2474.691) -- 0:01:36 723500 -- [-2477.811] (-2465.772) (-2479.204) (-2474.620) * (-2475.360) [-2481.997] (-2464.210) (-2476.853) -- 0:01:37 724000 -- (-2479.641) (-2474.121) (-2476.234) [-2481.613] * (-2479.977) (-2477.905) [-2466.703] (-2467.302) -- 0:01:36 724500 -- (-2475.291) (-2484.542) [-2474.677] (-2481.986) * (-2474.326) (-2482.766) (-2478.688) [-2473.094] -- 0:01:36 725000 -- (-2478.005) [-2473.011] (-2472.024) (-2484.488) * (-2474.394) (-2484.269) (-2472.622) [-2469.787] -- 0:01:36 Average standard deviation of split frequencies: 0.006320 725500 -- (-2467.899) (-2470.413) (-2477.686) [-2471.449] * (-2472.643) (-2484.439) (-2472.710) [-2481.886] -- 0:01:36 726000 -- (-2474.275) (-2480.426) (-2477.571) [-2466.498] * (-2476.483) (-2479.229) (-2468.457) [-2471.001] -- 0:01:35 726500 -- [-2472.820] (-2473.947) (-2479.119) (-2472.231) * (-2472.451) (-2476.311) [-2474.893] (-2485.982) -- 0:01:35 727000 -- (-2468.568) (-2471.838) (-2474.486) [-2469.684] * [-2470.769] (-2476.220) (-2471.420) (-2470.294) -- 0:01:35 727500 -- [-2469.270] (-2468.279) (-2502.301) (-2477.178) * (-2472.931) (-2474.170) [-2471.299] (-2483.139) -- 0:01:35 728000 -- (-2467.547) [-2472.351] (-2487.070) (-2494.290) * (-2473.486) [-2467.897] (-2477.826) (-2473.858) -- 0:01:35 728500 -- [-2479.861] (-2467.488) (-2485.717) (-2475.465) * [-2467.871] (-2476.100) (-2482.864) (-2467.609) -- 0:01:35 729000 -- (-2484.724) [-2463.797] (-2471.093) (-2478.304) * (-2486.029) (-2474.069) (-2475.860) [-2469.507] -- 0:01:35 729500 -- (-2470.192) (-2479.686) [-2467.450] (-2483.716) * (-2469.247) [-2468.437] (-2468.690) (-2470.231) -- 0:01:34 730000 -- (-2471.917) (-2470.970) (-2479.728) [-2474.512] * (-2467.253) [-2469.377] (-2468.408) (-2488.327) -- 0:01:34 Average standard deviation of split frequencies: 0.006280 730500 -- [-2471.214] (-2471.072) (-2475.525) (-2477.181) * (-2476.903) (-2476.717) [-2471.993] (-2493.933) -- 0:01:34 731000 -- (-2475.721) (-2481.927) (-2476.020) [-2475.140] * (-2482.477) [-2469.075] (-2477.415) (-2474.496) -- 0:01:34 731500 -- (-2472.296) (-2483.046) (-2472.991) [-2477.708] * (-2488.219) (-2479.997) [-2474.309] (-2479.023) -- 0:01:33 732000 -- [-2470.540] (-2492.544) (-2474.974) (-2472.685) * (-2473.841) (-2471.669) [-2472.570] (-2471.901) -- 0:01:34 732500 -- (-2473.286) (-2479.808) (-2472.135) [-2476.545] * (-2477.836) (-2478.380) (-2465.620) [-2478.058] -- 0:01:33 733000 -- [-2475.565] (-2484.819) (-2472.452) (-2484.510) * (-2470.392) [-2480.954] (-2470.411) (-2482.736) -- 0:01:33 733500 -- (-2472.369) [-2476.647] (-2469.944) (-2479.844) * (-2486.300) [-2474.078] (-2480.373) (-2477.085) -- 0:01:33 734000 -- (-2479.885) [-2473.948] (-2471.027) (-2477.559) * (-2475.061) (-2477.631) [-2468.389] (-2471.240) -- 0:01:33 734500 -- (-2476.422) [-2470.228] (-2474.304) (-2480.831) * (-2480.154) (-2496.508) [-2468.175] (-2469.829) -- 0:01:32 735000 -- [-2467.371] (-2484.999) (-2483.079) (-2481.591) * [-2471.651] (-2487.381) (-2487.526) (-2476.446) -- 0:01:33 Average standard deviation of split frequencies: 0.006277 735500 -- (-2473.124) (-2482.828) [-2473.741] (-2474.743) * (-2490.731) [-2471.901] (-2478.845) (-2479.104) -- 0:01:32 736000 -- (-2475.041) [-2463.225] (-2498.618) (-2473.972) * [-2471.908] (-2478.063) (-2473.955) (-2479.586) -- 0:01:32 736500 -- [-2476.324] (-2471.695) (-2478.179) (-2479.562) * (-2477.912) [-2468.297] (-2471.318) (-2475.725) -- 0:01:32 737000 -- (-2480.837) (-2474.128) (-2482.418) [-2465.690] * (-2482.580) (-2474.282) [-2471.894] (-2475.489) -- 0:01:32 737500 -- [-2473.284] (-2481.073) (-2473.749) (-2480.621) * (-2475.299) [-2461.891] (-2473.670) (-2473.478) -- 0:01:32 738000 -- (-2483.232) (-2476.711) (-2475.226) [-2478.031] * [-2473.257] (-2477.947) (-2477.596) (-2480.248) -- 0:01:31 738500 -- [-2477.223] (-2480.572) (-2471.785) (-2487.856) * [-2471.229] (-2480.442) (-2479.713) (-2485.760) -- 0:01:31 739000 -- (-2472.070) (-2476.432) (-2476.494) [-2468.641] * (-2471.745) (-2480.928) [-2472.589] (-2481.497) -- 0:01:31 739500 -- (-2472.355) (-2482.057) (-2473.363) [-2470.072] * [-2475.075] (-2482.148) (-2489.019) (-2487.009) -- 0:01:31 740000 -- (-2476.297) (-2473.138) [-2476.698] (-2469.889) * (-2476.190) [-2474.094] (-2480.632) (-2484.430) -- 0:01:31 Average standard deviation of split frequencies: 0.005983 740500 -- [-2471.708] (-2474.804) (-2475.263) (-2474.430) * (-2477.736) (-2473.449) [-2475.930] (-2474.285) -- 0:01:31 741000 -- [-2467.222] (-2473.969) (-2471.173) (-2474.628) * (-2481.145) [-2476.009] (-2488.192) (-2470.111) -- 0:01:30 741500 -- (-2471.200) (-2473.144) (-2472.386) [-2479.410] * (-2476.029) (-2477.813) (-2474.684) [-2474.717] -- 0:01:30 742000 -- (-2464.554) (-2473.195) (-2476.653) [-2477.411] * (-2468.523) (-2473.233) [-2468.032] (-2480.251) -- 0:01:30 742500 -- (-2466.323) (-2479.321) [-2473.588] (-2480.484) * (-2482.553) [-2470.187] (-2467.113) (-2473.463) -- 0:01:30 743000 -- (-2484.829) (-2472.964) [-2479.758] (-2479.791) * (-2479.573) [-2469.885] (-2488.698) (-2474.069) -- 0:01:29 743500 -- [-2472.767] (-2491.948) (-2476.122) (-2473.172) * [-2468.820] (-2468.217) (-2479.304) (-2479.728) -- 0:01:30 744000 -- (-2484.448) [-2474.810] (-2470.523) (-2483.078) * [-2476.569] (-2466.339) (-2479.999) (-2471.303) -- 0:01:29 744500 -- [-2472.446] (-2468.396) (-2476.410) (-2485.611) * [-2476.995] (-2483.566) (-2482.654) (-2465.040) -- 0:01:29 745000 -- (-2469.235) (-2466.942) [-2464.187] (-2478.613) * (-2477.345) [-2469.233] (-2482.788) (-2466.712) -- 0:01:29 Average standard deviation of split frequencies: 0.006108 745500 -- (-2475.416) (-2476.212) [-2465.921] (-2480.632) * (-2478.591) [-2466.090] (-2474.471) (-2478.397) -- 0:01:29 746000 -- (-2480.345) (-2480.581) (-2469.823) [-2483.231] * (-2471.140) (-2473.605) [-2474.559] (-2471.947) -- 0:01:29 746500 -- (-2477.412) (-2483.746) [-2470.374] (-2479.371) * [-2468.256] (-2472.240) (-2475.319) (-2475.146) -- 0:01:28 747000 -- (-2487.518) (-2474.936) [-2474.444] (-2472.593) * [-2467.836] (-2469.031) (-2479.828) (-2469.684) -- 0:01:28 747500 -- [-2468.369] (-2483.732) (-2479.546) (-2473.877) * (-2477.711) (-2484.915) [-2466.406] (-2471.059) -- 0:01:28 748000 -- [-2466.183] (-2473.434) (-2478.897) (-2482.998) * (-2481.032) (-2469.489) (-2470.465) [-2476.983] -- 0:01:28 748500 -- [-2477.809] (-2466.191) (-2474.845) (-2483.737) * (-2472.243) [-2472.844] (-2475.025) (-2481.833) -- 0:01:28 749000 -- [-2470.725] (-2472.362) (-2474.122) (-2470.836) * (-2474.393) (-2473.745) [-2477.848] (-2473.605) -- 0:01:28 749500 -- (-2477.444) (-2477.348) [-2474.448] (-2480.179) * (-2477.587) [-2469.674] (-2479.593) (-2470.980) -- 0:01:27 750000 -- (-2475.167) [-2471.557] (-2480.328) (-2472.098) * (-2473.426) (-2490.211) [-2476.470] (-2467.671) -- 0:01:27 Average standard deviation of split frequencies: 0.005694 750500 -- [-2476.476] (-2467.757) (-2471.604) (-2478.476) * (-2471.561) (-2486.235) [-2472.589] (-2486.854) -- 0:01:27 751000 -- (-2467.033) (-2475.567) [-2469.795] (-2484.808) * (-2472.834) (-2470.987) [-2478.541] (-2482.247) -- 0:01:27 751500 -- (-2477.004) (-2480.147) (-2483.644) [-2487.746] * [-2470.810] (-2481.394) (-2484.677) (-2473.650) -- 0:01:26 752000 -- [-2467.857] (-2483.302) (-2475.960) (-2479.180) * [-2468.769] (-2473.456) (-2481.742) (-2479.095) -- 0:01:26 752500 -- (-2475.306) (-2478.321) [-2468.373] (-2471.387) * (-2478.547) (-2476.978) [-2464.048] (-2485.241) -- 0:01:26 753000 -- [-2471.051] (-2477.966) (-2473.429) (-2476.349) * [-2469.787] (-2473.371) (-2494.568) (-2486.733) -- 0:01:26 753500 -- (-2475.135) (-2480.903) [-2482.887] (-2477.735) * (-2479.042) [-2475.693] (-2475.262) (-2469.971) -- 0:01:26 754000 -- (-2483.017) (-2478.612) [-2477.955] (-2474.316) * (-2490.116) (-2482.581) [-2465.425] (-2473.322) -- 0:01:26 754500 -- (-2484.192) (-2473.507) (-2474.998) [-2468.522] * (-2475.754) (-2473.488) [-2469.876] (-2490.557) -- 0:01:25 755000 -- (-2484.589) (-2472.546) [-2469.878] (-2476.261) * [-2465.083] (-2474.624) (-2470.764) (-2490.881) -- 0:01:25 Average standard deviation of split frequencies: 0.005487 755500 -- [-2480.218] (-2482.293) (-2478.107) (-2474.055) * (-2477.274) (-2481.289) (-2470.103) [-2472.495] -- 0:01:25 756000 -- (-2475.681) (-2481.969) [-2473.491] (-2464.194) * (-2477.789) [-2473.959] (-2479.029) (-2476.054) -- 0:01:25 756500 -- (-2485.472) [-2489.273] (-2472.534) (-2469.875) * (-2478.528) (-2478.696) (-2469.071) [-2475.337] -- 0:01:25 757000 -- (-2480.407) (-2482.996) (-2483.088) [-2472.026] * (-2478.872) (-2486.751) (-2464.754) [-2466.742] -- 0:01:25 757500 -- [-2469.142] (-2481.244) (-2484.289) (-2477.800) * (-2472.393) (-2479.648) [-2472.462] (-2474.094) -- 0:01:24 758000 -- (-2477.575) [-2465.292] (-2487.387) (-2476.270) * (-2475.622) [-2469.525] (-2470.066) (-2476.877) -- 0:01:24 758500 -- (-2480.494) [-2470.449] (-2482.549) (-2468.253) * (-2483.106) (-2470.730) [-2468.883] (-2486.269) -- 0:01:24 759000 -- [-2474.841] (-2479.878) (-2491.471) (-2470.454) * (-2494.014) (-2474.345) [-2477.611] (-2483.749) -- 0:01:24 759500 -- [-2467.895] (-2480.561) (-2484.977) (-2468.607) * (-2481.128) [-2479.885] (-2468.720) (-2484.629) -- 0:01:24 760000 -- (-2487.446) [-2475.919] (-2482.267) (-2463.207) * (-2473.815) (-2485.290) [-2473.385] (-2482.608) -- 0:01:24 Average standard deviation of split frequencies: 0.005578 760500 -- [-2475.694] (-2470.400) (-2477.125) (-2479.774) * (-2467.368) [-2476.997] (-2466.498) (-2479.868) -- 0:01:23 761000 -- (-2486.780) [-2474.057] (-2479.597) (-2469.337) * [-2478.662] (-2476.792) (-2481.684) (-2473.429) -- 0:01:23 761500 -- (-2471.846) (-2478.004) [-2467.919] (-2471.254) * [-2465.262] (-2472.485) (-2469.211) (-2483.678) -- 0:01:23 762000 -- (-2485.769) (-2475.846) [-2475.121] (-2480.830) * (-2470.223) (-2477.077) (-2475.337) [-2461.541] -- 0:01:23 762500 -- [-2478.764] (-2483.835) (-2477.772) (-2475.208) * [-2471.006] (-2474.932) (-2471.324) (-2471.719) -- 0:01:23 763000 -- (-2476.100) [-2480.824] (-2470.696) (-2483.751) * (-2477.479) (-2473.724) [-2476.412] (-2482.216) -- 0:01:22 763500 -- [-2477.568] (-2492.809) (-2469.069) (-2474.417) * (-2469.297) [-2472.024] (-2478.337) (-2472.134) -- 0:01:22 764000 -- (-2478.455) (-2476.581) [-2468.838] (-2471.776) * (-2481.251) [-2473.115] (-2481.463) (-2473.762) -- 0:01:22 764500 -- (-2484.315) [-2475.453] (-2474.059) (-2482.357) * [-2468.706] (-2480.674) (-2484.957) (-2480.346) -- 0:01:22 765000 -- (-2477.151) (-2474.227) [-2481.871] (-2482.657) * [-2472.490] (-2477.523) (-2480.149) (-2469.176) -- 0:01:22 Average standard deviation of split frequencies: 0.005457 765500 -- (-2471.595) (-2474.198) (-2464.000) [-2470.082] * (-2481.480) [-2474.684] (-2474.462) (-2478.185) -- 0:01:22 766000 -- (-2474.827) (-2478.461) (-2476.728) [-2468.771] * (-2471.114) [-2467.321] (-2478.205) (-2481.731) -- 0:01:21 766500 -- (-2467.477) (-2474.683) (-2480.257) [-2471.340] * (-2473.283) [-2470.736] (-2471.310) (-2474.688) -- 0:01:21 767000 -- (-2473.314) [-2471.892] (-2487.753) (-2471.657) * [-2477.348] (-2483.221) (-2478.373) (-2474.324) -- 0:01:21 767500 -- [-2473.091] (-2481.001) (-2477.501) (-2476.654) * (-2484.434) (-2480.687) [-2469.632] (-2481.090) -- 0:01:21 768000 -- [-2468.559] (-2474.421) (-2469.576) (-2483.974) * (-2480.678) (-2471.875) (-2482.499) [-2472.592] -- 0:01:21 768500 -- [-2478.165] (-2481.709) (-2468.954) (-2478.241) * [-2473.844] (-2470.859) (-2478.743) (-2474.450) -- 0:01:21 769000 -- (-2484.874) [-2480.841] (-2476.681) (-2478.830) * (-2477.990) [-2473.695] (-2475.746) (-2479.658) -- 0:01:20 769500 -- [-2477.687] (-2474.943) (-2480.196) (-2483.048) * [-2470.415] (-2482.172) (-2468.031) (-2477.420) -- 0:01:20 770000 -- (-2469.750) [-2467.063] (-2480.619) (-2479.707) * (-2471.651) (-2488.861) (-2471.133) [-2473.844] -- 0:01:20 Average standard deviation of split frequencies: 0.005587 770500 -- (-2470.641) (-2470.838) (-2475.072) [-2479.931] * (-2473.222) [-2478.676] (-2479.113) (-2470.756) -- 0:01:20 771000 -- [-2477.909] (-2477.942) (-2491.729) (-2472.970) * (-2473.136) (-2483.535) [-2478.177] (-2482.943) -- 0:01:20 771500 -- (-2475.490) (-2485.277) [-2474.387] (-2480.901) * (-2487.567) (-2479.963) [-2467.913] (-2483.069) -- 0:01:19 772000 -- [-2468.125] (-2472.142) (-2474.711) (-2480.501) * (-2501.367) (-2482.071) [-2468.104] (-2474.329) -- 0:01:19 772500 -- (-2479.774) [-2468.733] (-2469.969) (-2476.987) * (-2480.465) (-2485.221) (-2465.000) [-2468.202] -- 0:01:19 773000 -- (-2471.623) (-2463.501) [-2466.020] (-2490.418) * (-2479.669) (-2476.690) [-2468.563] (-2472.202) -- 0:01:19 773500 -- [-2475.669] (-2466.829) (-2476.132) (-2476.027) * [-2476.296] (-2472.073) (-2473.630) (-2486.466) -- 0:01:19 774000 -- [-2467.117] (-2475.854) (-2474.193) (-2490.718) * (-2473.037) (-2469.212) [-2466.680] (-2480.489) -- 0:01:19 774500 -- (-2476.530) (-2475.747) (-2471.258) [-2464.791] * (-2472.565) (-2480.965) (-2475.471) [-2469.404] -- 0:01:18 775000 -- (-2490.728) (-2475.411) [-2469.880] (-2475.453) * [-2472.018] (-2471.366) (-2475.183) (-2477.190) -- 0:01:18 Average standard deviation of split frequencies: 0.005386 775500 -- (-2485.235) (-2472.053) (-2468.041) [-2471.659] * (-2478.465) (-2476.044) (-2478.595) [-2470.577] -- 0:01:18 776000 -- (-2474.970) [-2469.499] (-2478.837) (-2469.959) * (-2478.568) [-2482.970] (-2485.690) (-2469.566) -- 0:01:18 776500 -- (-2470.804) [-2471.758] (-2480.568) (-2470.998) * (-2476.626) (-2473.562) (-2472.587) [-2472.239] -- 0:01:18 777000 -- (-2478.821) (-2475.332) (-2474.619) [-2475.171] * (-2479.830) (-2479.128) (-2480.374) [-2464.333] -- 0:01:18 777500 -- (-2471.063) (-2468.267) [-2474.786] (-2484.696) * (-2477.175) (-2480.019) [-2475.660] (-2472.191) -- 0:01:17 778000 -- (-2478.250) (-2481.800) [-2471.483] (-2481.605) * (-2482.097) (-2478.108) (-2481.456) [-2470.726] -- 0:01:17 778500 -- (-2479.484) [-2475.793] (-2479.944) (-2487.849) * [-2476.506] (-2480.798) (-2475.918) (-2482.496) -- 0:01:17 779000 -- (-2483.273) (-2470.628) [-2479.027] (-2484.823) * (-2473.758) (-2479.475) [-2469.546] (-2469.984) -- 0:01:17 779500 -- (-2475.076) [-2471.285] (-2491.230) (-2486.303) * [-2472.853] (-2478.694) (-2475.162) (-2471.583) -- 0:01:17 780000 -- (-2472.095) [-2467.607] (-2480.366) (-2484.526) * (-2478.193) (-2472.894) (-2476.665) [-2464.003] -- 0:01:17 Average standard deviation of split frequencies: 0.005072 780500 -- (-2481.889) (-2480.092) [-2481.293] (-2485.286) * [-2470.471] (-2498.557) (-2489.122) (-2464.748) -- 0:01:16 781000 -- [-2466.643] (-2481.801) (-2481.819) (-2470.076) * (-2467.198) (-2491.434) [-2475.415] (-2470.784) -- 0:01:16 781500 -- [-2468.065] (-2481.566) (-2471.284) (-2473.387) * (-2481.358) (-2481.207) (-2477.873) [-2468.759] -- 0:01:16 782000 -- (-2470.674) (-2475.491) (-2475.429) [-2468.490] * (-2480.803) (-2471.687) [-2473.949] (-2480.919) -- 0:01:16 782500 -- (-2483.264) [-2467.497] (-2479.789) (-2477.965) * (-2486.913) [-2473.513] (-2471.294) (-2466.481) -- 0:01:16 783000 -- (-2470.229) (-2479.250) [-2467.147] (-2476.753) * (-2485.415) (-2488.990) [-2470.342] (-2473.476) -- 0:01:15 783500 -- (-2480.276) [-2473.893] (-2469.018) (-2468.223) * (-2477.765) (-2475.758) (-2485.083) [-2471.639] -- 0:01:15 784000 -- (-2472.249) (-2486.078) (-2479.101) [-2466.447] * [-2477.556] (-2471.364) (-2473.631) (-2479.766) -- 0:01:15 784500 -- [-2470.659] (-2477.207) (-2483.259) (-2459.689) * (-2480.124) (-2476.959) [-2479.125] (-2472.862) -- 0:01:15 785000 -- (-2479.186) (-2473.622) (-2487.405) [-2477.701] * (-2483.363) (-2489.156) [-2470.419] (-2466.688) -- 0:01:15 Average standard deviation of split frequencies: 0.005078 785500 -- [-2475.574] (-2478.785) (-2483.394) (-2472.913) * (-2478.431) (-2479.965) (-2484.463) [-2472.700] -- 0:01:15 786000 -- (-2479.374) (-2478.771) [-2474.232] (-2480.393) * [-2462.236] (-2469.869) (-2481.444) (-2475.325) -- 0:01:14 786500 -- (-2478.643) (-2484.086) (-2472.209) [-2478.567] * (-2471.482) (-2475.943) [-2471.362] (-2473.313) -- 0:01:14 787000 -- [-2479.051] (-2477.089) (-2475.581) (-2485.932) * [-2473.024] (-2476.307) (-2483.790) (-2468.997) -- 0:01:14 787500 -- (-2470.593) (-2466.810) [-2475.384] (-2475.836) * (-2473.887) [-2464.782] (-2473.245) (-2482.314) -- 0:01:14 788000 -- (-2471.248) (-2475.941) (-2492.475) [-2475.760] * (-2471.162) (-2480.330) (-2479.931) [-2476.239] -- 0:01:14 788500 -- [-2472.570] (-2485.547) (-2465.761) (-2474.478) * (-2473.299) (-2481.270) [-2471.234] (-2472.820) -- 0:01:14 789000 -- (-2469.753) (-2482.155) (-2478.433) [-2489.994] * [-2464.098] (-2476.436) (-2475.998) (-2472.524) -- 0:01:13 789500 -- (-2475.036) (-2474.735) [-2462.325] (-2492.324) * (-2474.523) (-2483.045) (-2468.626) [-2459.931] -- 0:01:13 790000 -- (-2483.949) (-2479.478) (-2477.493) [-2470.422] * (-2477.673) (-2484.758) (-2472.210) [-2472.253] -- 0:01:13 Average standard deviation of split frequencies: 0.004809 790500 -- (-2472.988) [-2471.601] (-2486.260) (-2476.746) * (-2479.908) (-2477.507) [-2475.245] (-2480.561) -- 0:01:13 791000 -- [-2477.463] (-2480.560) (-2484.558) (-2486.533) * (-2469.008) (-2478.689) (-2481.953) [-2467.593] -- 0:01:13 791500 -- (-2487.040) [-2464.965] (-2485.776) (-2488.856) * (-2464.061) [-2478.992] (-2476.128) (-2475.536) -- 0:01:12 792000 -- [-2476.047] (-2480.183) (-2493.433) (-2484.522) * [-2470.844] (-2475.367) (-2483.558) (-2488.116) -- 0:01:13 792500 -- (-2480.447) (-2475.756) [-2475.570] (-2488.114) * [-2465.593] (-2483.926) (-2481.041) (-2469.243) -- 0:01:12 793000 -- [-2474.681] (-2467.665) (-2482.329) (-2468.069) * [-2467.747] (-2474.365) (-2479.980) (-2476.221) -- 0:01:12 793500 -- [-2474.663] (-2468.328) (-2484.725) (-2478.200) * (-2468.538) [-2461.843] (-2470.215) (-2468.814) -- 0:01:12 794000 -- (-2475.866) (-2475.448) (-2488.085) [-2473.948] * (-2470.569) (-2480.856) [-2460.491] (-2475.809) -- 0:01:12 794500 -- (-2481.535) (-2483.096) [-2471.149] (-2475.731) * (-2469.106) (-2472.452) [-2475.058] (-2466.795) -- 0:01:12 795000 -- [-2472.841] (-2468.190) (-2478.985) (-2476.785) * (-2478.776) (-2478.983) (-2488.752) [-2474.063] -- 0:01:11 Average standard deviation of split frequencies: 0.004501 795500 -- (-2481.871) (-2469.980) (-2474.613) [-2470.069] * (-2478.240) [-2476.844] (-2479.218) (-2468.784) -- 0:01:11 796000 -- (-2483.423) (-2476.294) (-2482.817) [-2475.790] * (-2476.619) (-2468.226) [-2475.035] (-2475.516) -- 0:01:11 796500 -- (-2465.031) (-2468.242) (-2478.856) [-2477.896] * (-2470.914) (-2463.292) [-2478.879] (-2475.881) -- 0:01:11 797000 -- (-2473.226) (-2471.652) [-2469.203] (-2474.168) * (-2477.010) [-2465.349] (-2483.586) (-2478.001) -- 0:01:11 797500 -- (-2481.892) (-2477.348) [-2473.989] (-2471.205) * (-2484.243) (-2471.538) [-2471.834] (-2468.526) -- 0:01:11 798000 -- (-2484.013) (-2484.440) (-2468.429) [-2475.725] * (-2479.690) [-2466.691] (-2475.673) (-2469.284) -- 0:01:10 798500 -- (-2488.055) (-2468.186) [-2475.758] (-2479.311) * (-2481.194) [-2471.736] (-2479.161) (-2475.236) -- 0:01:10 799000 -- (-2488.317) (-2479.380) [-2474.326] (-2479.688) * (-2467.755) [-2468.803] (-2474.580) (-2479.647) -- 0:01:10 799500 -- (-2489.888) [-2476.129] (-2476.465) (-2475.544) * [-2468.367] (-2480.834) (-2483.850) (-2490.823) -- 0:01:10 800000 -- (-2473.669) [-2484.344] (-2479.446) (-2480.265) * (-2471.996) (-2473.635) [-2473.127] (-2484.897) -- 0:01:10 Average standard deviation of split frequencies: 0.004592 800500 -- (-2480.019) (-2471.577) (-2472.631) [-2472.204] * (-2482.777) (-2473.944) (-2486.703) [-2482.180] -- 0:01:10 801000 -- (-2483.619) (-2474.088) [-2469.993] (-2477.667) * (-2482.238) [-2466.486] (-2481.835) (-2476.873) -- 0:01:09 801500 -- (-2469.623) (-2473.279) [-2472.468] (-2470.308) * (-2474.363) (-2483.886) (-2477.106) [-2475.923] -- 0:01:09 802000 -- (-2486.635) (-2474.581) (-2471.059) [-2469.857] * (-2472.215) (-2472.163) [-2480.889] (-2483.278) -- 0:01:09 802500 -- (-2481.524) [-2466.680] (-2472.431) (-2486.957) * [-2467.495] (-2478.166) (-2477.298) (-2474.254) -- 0:01:09 803000 -- (-2480.978) (-2471.143) [-2474.618] (-2473.159) * (-2476.274) (-2485.773) [-2466.764] (-2476.157) -- 0:01:08 803500 -- (-2476.902) (-2473.221) (-2476.671) [-2473.305] * (-2474.709) (-2475.937) (-2480.887) [-2473.179] -- 0:01:08 804000 -- (-2478.936) (-2468.345) (-2480.970) [-2471.672] * [-2471.090] (-2480.754) (-2468.934) (-2480.428) -- 0:01:08 804500 -- [-2464.755] (-2467.473) (-2469.508) (-2476.031) * (-2480.398) (-2479.197) [-2475.486] (-2481.526) -- 0:01:08 805000 -- (-2472.363) [-2473.664] (-2475.444) (-2482.036) * (-2473.498) (-2481.760) (-2474.150) [-2470.179] -- 0:01:08 Average standard deviation of split frequencies: 0.004757 805500 -- [-2465.900] (-2473.841) (-2477.886) (-2479.705) * [-2465.043] (-2471.144) (-2483.973) (-2485.371) -- 0:01:08 806000 -- (-2489.933) [-2468.325] (-2477.891) (-2477.187) * [-2467.889] (-2477.004) (-2475.341) (-2480.911) -- 0:01:07 806500 -- (-2483.163) [-2472.646] (-2479.932) (-2476.802) * [-2464.758] (-2475.351) (-2474.826) (-2485.388) -- 0:01:07 807000 -- (-2486.650) [-2479.913] (-2470.328) (-2476.754) * [-2469.368] (-2472.299) (-2479.426) (-2487.297) -- 0:01:07 807500 -- (-2474.980) (-2480.031) (-2469.178) [-2478.768] * [-2482.224] (-2488.317) (-2467.379) (-2477.976) -- 0:01:07 808000 -- (-2484.120) (-2480.189) [-2477.853] (-2469.701) * (-2469.668) (-2479.775) (-2486.626) [-2468.661] -- 0:01:07 808500 -- (-2475.832) (-2476.221) (-2469.682) [-2476.164] * (-2479.350) (-2477.429) (-2469.654) [-2476.215] -- 0:01:07 809000 -- (-2472.037) (-2473.966) [-2477.698] (-2480.748) * (-2473.058) (-2482.029) [-2477.328] (-2476.014) -- 0:01:06 809500 -- [-2478.833] (-2477.836) (-2476.105) (-2482.651) * [-2470.070] (-2469.280) (-2477.101) (-2471.049) -- 0:01:06 810000 -- (-2475.239) [-2469.992] (-2471.576) (-2479.370) * (-2474.514) [-2471.437] (-2472.101) (-2474.457) -- 0:01:06 Average standard deviation of split frequencies: 0.004768 810500 -- [-2472.099] (-2471.265) (-2480.011) (-2468.822) * (-2474.900) [-2469.720] (-2484.917) (-2494.576) -- 0:01:06 811000 -- (-2477.095) [-2470.912] (-2473.041) (-2469.079) * (-2477.360) (-2481.720) (-2482.595) [-2467.245] -- 0:01:06 811500 -- (-2477.579) [-2471.740] (-2475.914) (-2467.658) * [-2467.068] (-2478.805) (-2475.956) (-2465.756) -- 0:01:05 812000 -- (-2481.299) (-2478.201) [-2471.524] (-2479.508) * (-2473.943) (-2476.117) (-2478.979) [-2466.735] -- 0:01:05 812500 -- (-2476.831) [-2472.408] (-2477.890) (-2480.993) * (-2471.757) (-2477.565) (-2474.734) [-2473.166] -- 0:01:05 813000 -- [-2474.119] (-2474.210) (-2471.526) (-2489.497) * (-2477.987) (-2470.050) [-2482.089] (-2481.385) -- 0:01:05 813500 -- (-2475.899) (-2470.924) [-2471.294] (-2506.920) * (-2475.708) (-2466.882) [-2473.639] (-2476.312) -- 0:01:05 814000 -- [-2468.501] (-2472.000) (-2475.657) (-2473.450) * (-2477.321) (-2477.382) (-2484.301) [-2473.690] -- 0:01:05 814500 -- (-2473.553) (-2471.158) [-2471.460] (-2474.868) * (-2480.843) (-2487.464) (-2472.903) [-2469.685] -- 0:01:04 815000 -- (-2472.504) [-2472.101] (-2474.658) (-2477.776) * (-2470.439) (-2485.969) (-2471.586) [-2464.935] -- 0:01:04 Average standard deviation of split frequencies: 0.004853 815500 -- (-2473.120) (-2479.802) (-2469.594) [-2475.429] * (-2485.101) (-2476.282) [-2472.145] (-2478.153) -- 0:01:04 816000 -- (-2495.849) [-2485.352] (-2481.038) (-2471.226) * (-2484.368) (-2471.869) (-2473.675) [-2468.274] -- 0:01:04 816500 -- (-2479.419) (-2471.339) (-2472.132) [-2468.714] * (-2477.923) (-2474.489) (-2485.081) [-2471.179] -- 0:01:04 817000 -- (-2474.673) (-2487.496) [-2472.986] (-2476.466) * (-2475.083) (-2484.143) (-2488.668) [-2471.403] -- 0:01:04 817500 -- (-2480.438) [-2466.097] (-2478.534) (-2478.494) * (-2470.593) [-2469.910] (-2475.441) (-2472.932) -- 0:01:03 818000 -- [-2475.623] (-2482.818) (-2464.614) (-2464.713) * (-2473.521) (-2479.477) [-2474.735] (-2473.316) -- 0:01:03 818500 -- [-2472.148] (-2466.745) (-2469.659) (-2468.814) * (-2471.019) [-2476.764] (-2476.452) (-2474.815) -- 0:01:03 819000 -- (-2482.985) (-2472.166) [-2471.932] (-2475.263) * (-2476.642) [-2467.970] (-2476.451) (-2469.527) -- 0:01:03 819500 -- (-2478.238) [-2470.610] (-2471.217) (-2475.360) * (-2471.596) [-2476.871] (-2469.645) (-2475.035) -- 0:01:03 820000 -- (-2464.833) (-2469.947) (-2475.856) [-2482.192] * (-2468.788) (-2483.658) (-2480.769) [-2481.300] -- 0:01:03 Average standard deviation of split frequencies: 0.004863 820500 -- (-2472.446) [-2470.015] (-2479.027) (-2472.472) * (-2465.377) (-2474.282) (-2483.459) [-2481.204] -- 0:01:02 821000 -- (-2472.859) [-2472.427] (-2485.096) (-2477.689) * [-2472.497] (-2474.736) (-2477.355) (-2478.222) -- 0:01:02 821500 -- (-2469.794) [-2475.090] (-2474.457) (-2474.274) * (-2480.960) (-2494.537) [-2477.022] (-2479.627) -- 0:01:02 822000 -- (-2476.281) [-2475.144] (-2485.109) (-2489.802) * (-2473.910) (-2476.079) (-2467.913) [-2464.024] -- 0:01:02 822500 -- [-2469.128] (-2470.991) (-2480.792) (-2472.197) * (-2474.764) (-2478.700) (-2477.478) [-2471.392] -- 0:01:01 823000 -- (-2472.741) [-2477.539] (-2480.505) (-2472.301) * [-2473.099] (-2486.459) (-2474.028) (-2470.841) -- 0:01:01 823500 -- [-2468.635] (-2469.414) (-2473.714) (-2470.487) * (-2475.472) [-2481.282] (-2471.481) (-2485.907) -- 0:01:01 824000 -- (-2477.250) (-2468.448) (-2482.140) [-2472.299] * (-2485.656) [-2474.936] (-2468.747) (-2473.933) -- 0:01:01 824500 -- (-2476.056) [-2460.578] (-2483.133) (-2475.842) * [-2480.030] (-2475.188) (-2472.408) (-2484.391) -- 0:01:01 825000 -- (-2479.775) [-2468.575] (-2486.163) (-2475.884) * (-2484.040) [-2465.717] (-2479.610) (-2473.936) -- 0:01:01 Average standard deviation of split frequencies: 0.005821 825500 -- (-2476.320) [-2469.736] (-2476.521) (-2490.770) * (-2475.890) [-2468.278] (-2472.660) (-2473.508) -- 0:01:00 826000 -- (-2471.264) [-2471.201] (-2470.516) (-2479.152) * (-2474.970) [-2467.538] (-2479.911) (-2475.921) -- 0:01:00 826500 -- (-2469.383) (-2471.570) [-2470.859] (-2495.205) * (-2472.355) [-2465.956] (-2493.521) (-2467.471) -- 0:01:00 827000 -- (-2478.835) (-2476.874) (-2463.168) [-2478.473] * (-2465.471) [-2474.946] (-2493.882) (-2468.631) -- 0:01:00 827500 -- (-2480.569) (-2484.502) [-2468.328] (-2478.464) * (-2479.673) (-2476.138) [-2483.682] (-2471.789) -- 0:01:00 828000 -- (-2477.860) (-2473.240) (-2474.173) [-2478.079] * (-2472.221) (-2480.975) [-2477.738] (-2484.271) -- 0:01:00 828500 -- (-2485.212) (-2470.827) (-2467.442) [-2476.363] * (-2468.885) (-2480.368) [-2478.400] (-2476.528) -- 0:00:59 829000 -- [-2464.453] (-2467.404) (-2472.406) (-2484.810) * (-2482.698) [-2472.596] (-2484.831) (-2481.659) -- 0:00:59 829500 -- (-2471.855) (-2470.384) (-2478.996) [-2469.945] * (-2470.242) (-2471.309) [-2481.347] (-2477.547) -- 0:00:59 830000 -- (-2478.949) [-2472.368] (-2468.520) (-2475.566) * (-2487.765) (-2479.289) (-2475.776) [-2472.357] -- 0:00:59 Average standard deviation of split frequencies: 0.006318 830500 -- (-2481.656) [-2476.687] (-2487.027) (-2468.893) * (-2485.739) [-2471.083] (-2478.666) (-2480.915) -- 0:00:59 831000 -- (-2475.019) (-2470.983) (-2474.014) [-2473.464] * (-2475.063) (-2488.032) [-2471.169] (-2481.571) -- 0:00:58 831500 -- (-2471.989) (-2471.529) (-2468.733) [-2473.508] * (-2473.610) (-2484.833) (-2477.512) [-2472.502] -- 0:00:58 832000 -- (-2473.918) [-2470.605] (-2471.701) (-2469.522) * [-2473.499] (-2481.507) (-2474.703) (-2477.624) -- 0:00:58 832500 -- (-2468.638) (-2475.708) [-2478.432] (-2475.004) * (-2480.621) [-2470.513] (-2474.410) (-2483.510) -- 0:00:58 833000 -- (-2473.743) [-2470.750] (-2470.192) (-2465.383) * (-2486.747) [-2466.521] (-2477.969) (-2486.450) -- 0:00:58 833500 -- (-2479.319) (-2483.039) (-2478.426) [-2471.638] * (-2492.284) [-2474.952] (-2467.005) (-2476.945) -- 0:00:58 834000 -- (-2480.873) (-2478.466) [-2465.519] (-2468.899) * (-2483.403) (-2475.765) (-2487.023) [-2463.997] -- 0:00:57 834500 -- (-2482.458) [-2476.377] (-2479.170) (-2470.425) * [-2472.487] (-2481.738) (-2478.246) (-2478.532) -- 0:00:57 835000 -- (-2473.592) (-2483.094) (-2468.263) [-2473.704] * (-2479.181) (-2478.530) (-2474.987) [-2469.356] -- 0:00:57 Average standard deviation of split frequencies: 0.006428 835500 -- (-2464.399) [-2471.755] (-2476.560) (-2481.236) * [-2474.484] (-2473.425) (-2483.411) (-2470.010) -- 0:00:57 836000 -- [-2467.558] (-2474.599) (-2481.295) (-2476.549) * (-2482.089) [-2479.943] (-2475.190) (-2469.489) -- 0:00:57 836500 -- [-2474.996] (-2469.379) (-2482.751) (-2476.828) * (-2484.885) (-2475.558) (-2476.355) [-2471.527] -- 0:00:57 837000 -- (-2468.258) (-2470.650) [-2474.760] (-2480.146) * (-2480.148) [-2469.736] (-2481.241) (-2465.700) -- 0:00:56 837500 -- (-2471.073) (-2478.447) [-2468.135] (-2469.249) * (-2470.607) (-2473.199) (-2469.841) [-2476.820] -- 0:00:56 838000 -- (-2475.753) (-2490.772) (-2469.369) [-2482.468] * (-2486.201) [-2473.797] (-2479.313) (-2472.525) -- 0:00:56 838500 -- (-2474.057) [-2469.886] (-2478.806) (-2475.106) * (-2483.425) [-2465.328] (-2472.877) (-2468.111) -- 0:00:56 839000 -- (-2483.432) (-2473.502) (-2481.911) [-2469.281] * (-2472.389) (-2470.857) (-2473.532) [-2467.970] -- 0:00:56 839500 -- (-2478.554) (-2477.470) (-2476.734) [-2468.487] * (-2476.739) [-2488.159] (-2485.411) (-2468.736) -- 0:00:56 840000 -- (-2471.519) (-2481.437) (-2474.739) [-2480.509] * (-2471.650) (-2475.688) [-2478.427] (-2463.253) -- 0:00:55 Average standard deviation of split frequencies: 0.006467 840500 -- (-2483.019) [-2472.925] (-2485.593) (-2477.090) * (-2481.185) (-2481.276) (-2469.764) [-2469.811] -- 0:00:55 841000 -- (-2477.639) [-2476.702] (-2474.464) (-2485.657) * (-2478.209) (-2483.466) [-2474.696] (-2472.325) -- 0:00:55 841500 -- (-2477.702) [-2477.514] (-2479.339) (-2482.057) * (-2480.245) (-2476.625) (-2463.799) [-2481.086] -- 0:00:55 842000 -- (-2470.535) (-2475.653) (-2476.732) [-2470.590] * (-2483.942) (-2478.841) [-2462.271] (-2471.228) -- 0:00:55 842500 -- (-2475.977) (-2471.686) [-2475.413] (-2486.459) * (-2473.631) [-2470.220] (-2483.546) (-2477.705) -- 0:00:54 843000 -- (-2478.238) [-2474.877] (-2480.333) (-2474.117) * [-2470.454] (-2474.204) (-2473.152) (-2481.771) -- 0:00:54 843500 -- (-2475.937) (-2475.017) (-2477.059) [-2474.800] * [-2471.635] (-2486.228) (-2477.728) (-2479.370) -- 0:00:54 844000 -- (-2489.044) (-2476.110) (-2480.420) [-2475.699] * [-2470.622] (-2474.623) (-2477.979) (-2469.773) -- 0:00:54 844500 -- (-2488.145) [-2478.772] (-2477.659) (-2484.394) * (-2474.544) [-2469.155] (-2474.081) (-2486.716) -- 0:00:54 845000 -- [-2488.751] (-2473.218) (-2474.292) (-2490.205) * (-2479.057) [-2479.127] (-2480.277) (-2478.574) -- 0:00:53 Average standard deviation of split frequencies: 0.005981 845500 -- [-2473.798] (-2477.861) (-2473.404) (-2499.950) * (-2481.039) [-2478.117] (-2471.911) (-2476.636) -- 0:00:53 846000 -- (-2467.868) [-2464.186] (-2476.312) (-2487.159) * (-2474.533) (-2480.234) [-2465.651] (-2478.428) -- 0:00:53 846500 -- [-2466.288] (-2470.962) (-2492.457) (-2490.532) * (-2474.152) [-2475.685] (-2472.410) (-2475.670) -- 0:00:53 847000 -- (-2471.197) [-2475.813] (-2484.317) (-2474.570) * [-2469.633] (-2488.266) (-2478.641) (-2481.601) -- 0:00:53 847500 -- (-2468.847) (-2476.644) (-2484.370) [-2476.708] * [-2466.476] (-2470.501) (-2484.248) (-2480.706) -- 0:00:53 848000 -- (-2483.850) [-2470.631] (-2470.971) (-2465.704) * (-2483.818) (-2479.858) [-2479.274] (-2475.564) -- 0:00:52 848500 -- (-2483.395) (-2468.545) (-2482.465) [-2473.202] * (-2479.580) (-2490.284) [-2469.713] (-2483.678) -- 0:00:52 849000 -- [-2477.155] (-2471.623) (-2476.227) (-2485.087) * (-2491.078) (-2486.309) [-2464.815] (-2479.000) -- 0:00:52 849500 -- (-2471.419) [-2469.669] (-2479.911) (-2469.859) * (-2484.623) (-2477.201) (-2470.475) [-2472.717] -- 0:00:52 850000 -- [-2472.503] (-2470.220) (-2475.448) (-2479.487) * (-2478.558) [-2473.092] (-2479.199) (-2474.384) -- 0:00:52 Average standard deviation of split frequencies: 0.005837 850500 -- (-2478.153) (-2479.425) (-2467.022) [-2467.170] * (-2484.099) [-2472.662] (-2480.359) (-2475.121) -- 0:00:52 851000 -- [-2473.909] (-2481.127) (-2483.031) (-2476.914) * (-2473.469) [-2478.114] (-2482.352) (-2474.572) -- 0:00:51 851500 -- [-2478.059] (-2472.271) (-2478.253) (-2469.905) * (-2475.400) (-2479.775) (-2485.855) [-2475.520] -- 0:00:51 852000 -- (-2471.470) (-2478.914) (-2474.490) [-2475.057] * (-2477.345) (-2473.060) (-2474.709) [-2472.636] -- 0:00:51 852500 -- (-2479.658) (-2476.864) (-2477.740) [-2477.856] * (-2469.763) [-2477.794] (-2488.405) (-2481.827) -- 0:00:51 853000 -- (-2483.395) (-2487.887) (-2475.926) [-2468.522] * (-2474.854) (-2477.220) [-2474.791] (-2468.549) -- 0:00:51 853500 -- (-2482.430) (-2471.919) [-2464.826] (-2464.854) * (-2488.717) (-2478.251) (-2469.814) [-2476.952] -- 0:00:50 854000 -- (-2475.378) (-2483.333) (-2475.073) [-2465.873] * (-2478.391) [-2478.177] (-2478.800) (-2471.015) -- 0:00:50 854500 -- (-2484.901) [-2474.146] (-2472.697) (-2489.680) * (-2471.557) [-2469.291] (-2479.530) (-2475.911) -- 0:00:50 855000 -- (-2485.163) (-2473.220) (-2470.863) [-2473.953] * (-2482.922) (-2480.128) (-2480.795) [-2467.203] -- 0:00:50 Average standard deviation of split frequencies: 0.005470 855500 -- (-2468.736) (-2489.831) [-2472.752] (-2477.674) * [-2471.505] (-2474.864) (-2471.209) (-2484.111) -- 0:00:50 856000 -- (-2467.976) (-2477.607) [-2468.814] (-2483.165) * (-2473.841) (-2477.180) (-2472.573) [-2472.538] -- 0:00:50 856500 -- [-2468.108] (-2477.278) (-2475.695) (-2483.317) * [-2468.631] (-2468.498) (-2480.778) (-2472.058) -- 0:00:49 857000 -- [-2471.259] (-2476.605) (-2482.408) (-2473.824) * [-2463.371] (-2480.676) (-2478.967) (-2473.303) -- 0:00:49 857500 -- (-2468.672) (-2474.483) [-2471.193] (-2476.611) * [-2474.359] (-2470.231) (-2467.824) (-2470.865) -- 0:00:49 858000 -- (-2468.307) [-2470.374] (-2480.152) (-2490.878) * (-2474.385) (-2484.094) [-2476.359] (-2490.616) -- 0:00:49 858500 -- [-2473.284] (-2490.691) (-2480.716) (-2476.635) * [-2478.093] (-2483.365) (-2481.206) (-2479.897) -- 0:00:49 859000 -- (-2473.151) (-2481.956) (-2484.579) [-2469.539] * (-2487.278) [-2475.114] (-2473.858) (-2482.046) -- 0:00:49 859500 -- [-2467.316] (-2474.988) (-2487.480) (-2486.124) * (-2478.785) (-2477.269) (-2481.431) [-2472.785] -- 0:00:48 860000 -- (-2480.750) [-2479.412] (-2477.458) (-2477.712) * (-2485.148) (-2473.007) [-2466.839] (-2470.846) -- 0:00:48 Average standard deviation of split frequencies: 0.005149 860500 -- (-2478.130) [-2477.692] (-2486.459) (-2477.901) * (-2479.586) (-2478.428) (-2479.383) [-2474.420] -- 0:00:48 861000 -- [-2475.526] (-2487.531) (-2478.298) (-2468.531) * (-2475.611) (-2480.515) (-2483.497) [-2469.835] -- 0:00:48 861500 -- (-2480.738) [-2468.819] (-2473.976) (-2478.306) * [-2462.854] (-2471.709) (-2478.726) (-2476.453) -- 0:00:48 862000 -- [-2471.385] (-2476.378) (-2484.658) (-2468.995) * (-2475.512) (-2476.937) (-2482.781) [-2474.752] -- 0:00:48 862500 -- (-2478.577) (-2482.990) (-2479.259) [-2483.742] * (-2478.021) (-2483.469) [-2471.343] (-2465.350) -- 0:00:47 863000 -- (-2490.584) [-2471.979] (-2472.862) (-2480.004) * (-2476.333) [-2483.365] (-2490.602) (-2489.978) -- 0:00:47 863500 -- (-2499.410) (-2478.215) [-2471.885] (-2468.290) * (-2471.213) [-2465.965] (-2475.164) (-2477.383) -- 0:00:47 864000 -- (-2496.360) (-2482.957) (-2478.939) [-2462.451] * [-2499.068] (-2471.662) (-2471.498) (-2482.869) -- 0:00:47 864500 -- (-2468.765) (-2483.057) (-2470.418) [-2471.201] * [-2478.847] (-2471.255) (-2475.061) (-2477.812) -- 0:00:47 865000 -- (-2473.637) (-2477.246) [-2467.906] (-2484.178) * (-2483.475) [-2469.054] (-2471.935) (-2476.123) -- 0:00:46 Average standard deviation of split frequencies: 0.005371 865500 -- (-2476.683) (-2484.837) [-2468.657] (-2473.030) * (-2497.933) (-2471.588) (-2478.994) [-2468.615] -- 0:00:46 866000 -- (-2475.783) [-2474.621] (-2474.620) (-2465.386) * (-2481.076) (-2473.194) (-2474.388) [-2471.339] -- 0:00:46 866500 -- (-2482.728) [-2467.339] (-2477.312) (-2492.364) * (-2477.024) [-2474.289] (-2473.026) (-2478.323) -- 0:00:46 867000 -- (-2476.921) [-2475.600] (-2473.958) (-2481.008) * (-2478.474) (-2485.173) [-2471.646] (-2475.061) -- 0:00:46 867500 -- (-2474.704) (-2478.522) (-2480.651) [-2478.300] * (-2479.813) [-2475.622] (-2477.997) (-2472.955) -- 0:00:46 868000 -- (-2498.105) [-2470.204] (-2482.904) (-2470.451) * [-2473.891] (-2482.774) (-2482.192) (-2466.163) -- 0:00:45 868500 -- (-2477.153) (-2482.457) [-2469.987] (-2472.306) * (-2474.555) [-2467.728] (-2476.700) (-2479.602) -- 0:00:45 869000 -- (-2483.358) (-2476.040) [-2482.764] (-2480.705) * (-2477.531) (-2474.922) (-2494.024) [-2481.471] -- 0:00:45 869500 -- [-2465.602] (-2477.896) (-2478.748) (-2482.752) * (-2467.633) [-2477.428] (-2479.083) (-2487.232) -- 0:00:45 870000 -- [-2466.642] (-2488.948) (-2475.009) (-2477.468) * (-2468.901) (-2485.787) [-2475.471] (-2470.855) -- 0:00:45 Average standard deviation of split frequencies: 0.004981 870500 -- (-2485.009) (-2483.862) [-2479.300] (-2476.027) * [-2473.346] (-2475.179) (-2482.386) (-2483.599) -- 0:00:45 871000 -- (-2489.085) (-2473.714) [-2473.947] (-2488.936) * (-2486.223) [-2474.995] (-2470.637) (-2476.413) -- 0:00:44 871500 -- (-2477.970) [-2481.971] (-2486.057) (-2484.456) * (-2479.653) [-2476.282] (-2472.340) (-2469.362) -- 0:00:44 872000 -- (-2492.260) [-2477.887] (-2478.112) (-2485.402) * (-2477.976) (-2476.377) [-2467.794] (-2477.819) -- 0:00:44 872500 -- [-2469.281] (-2479.670) (-2477.000) (-2493.422) * (-2484.356) [-2472.358] (-2483.287) (-2468.432) -- 0:00:44 873000 -- (-2477.654) [-2473.746] (-2491.507) (-2478.425) * (-2481.525) (-2479.058) (-2473.769) [-2476.904] -- 0:00:44 873500 -- [-2472.806] (-2471.241) (-2479.427) (-2469.368) * (-2488.867) [-2469.767] (-2473.397) (-2483.816) -- 0:00:44 874000 -- [-2475.985] (-2478.403) (-2470.531) (-2475.480) * [-2477.124] (-2472.807) (-2477.108) (-2479.830) -- 0:00:43 874500 -- (-2483.457) (-2468.999) (-2474.769) [-2466.919] * (-2473.283) (-2476.969) [-2476.680] (-2466.807) -- 0:00:43 875000 -- (-2483.519) (-2478.412) (-2472.954) [-2473.333] * (-2482.463) [-2468.913] (-2469.810) (-2482.412) -- 0:00:43 Average standard deviation of split frequencies: 0.004771 875500 -- (-2477.363) [-2471.368] (-2478.175) (-2471.204) * (-2481.938) [-2482.358] (-2475.639) (-2474.105) -- 0:00:43 876000 -- (-2483.492) (-2472.579) (-2467.471) [-2473.493] * (-2481.355) (-2480.551) (-2473.601) [-2474.186] -- 0:00:43 876500 -- [-2474.310] (-2472.679) (-2474.495) (-2470.862) * [-2482.378] (-2470.232) (-2482.359) (-2477.980) -- 0:00:42 877000 -- [-2479.709] (-2466.850) (-2476.110) (-2474.693) * [-2487.677] (-2478.430) (-2476.913) (-2485.117) -- 0:00:42 877500 -- (-2487.509) (-2479.102) [-2472.865] (-2480.788) * [-2478.077] (-2479.960) (-2476.631) (-2477.131) -- 0:00:42 878000 -- [-2477.144] (-2477.619) (-2477.192) (-2480.422) * (-2477.177) [-2474.168] (-2485.106) (-2479.748) -- 0:00:42 878500 -- [-2469.773] (-2473.178) (-2487.295) (-2481.554) * (-2490.673) (-2479.346) [-2472.079] (-2485.825) -- 0:00:42 879000 -- [-2478.723] (-2478.363) (-2486.249) (-2478.633) * (-2472.587) (-2488.388) [-2463.014] (-2466.866) -- 0:00:42 879500 -- (-2477.891) (-2471.944) (-2482.548) [-2476.923] * (-2478.459) (-2473.168) [-2467.738] (-2471.404) -- 0:00:41 880000 -- (-2479.180) (-2476.080) [-2475.868] (-2481.108) * (-2483.222) (-2484.140) [-2472.946] (-2475.974) -- 0:00:41 Average standard deviation of split frequencies: 0.004746 880500 -- [-2480.324] (-2474.348) (-2483.623) (-2473.135) * [-2471.800] (-2487.769) (-2477.319) (-2470.468) -- 0:00:41 881000 -- (-2485.441) (-2479.753) (-2473.277) [-2481.398] * (-2477.614) (-2475.550) [-2470.867] (-2477.936) -- 0:00:41 881500 -- [-2471.877] (-2470.945) (-2484.873) (-2480.012) * (-2488.359) (-2472.797) [-2468.213] (-2478.620) -- 0:00:41 882000 -- (-2469.252) (-2474.976) (-2485.726) [-2465.761] * (-2474.431) (-2479.153) (-2475.370) [-2480.343] -- 0:00:41 882500 -- [-2476.289] (-2477.766) (-2478.783) (-2483.031) * (-2478.626) [-2465.927] (-2465.093) (-2488.010) -- 0:00:41 883000 -- (-2471.013) [-2476.183] (-2479.482) (-2481.133) * [-2474.845] (-2484.796) (-2478.212) (-2478.294) -- 0:00:40 883500 -- (-2467.841) [-2463.957] (-2480.090) (-2473.816) * (-2479.473) (-2474.512) [-2474.231] (-2493.653) -- 0:00:40 884000 -- (-2480.101) (-2478.082) [-2476.332] (-2485.742) * (-2472.509) (-2478.788) [-2471.603] (-2482.883) -- 0:00:40 884500 -- [-2479.432] (-2472.281) (-2465.921) (-2483.274) * (-2483.528) (-2476.210) (-2471.893) [-2473.725] -- 0:00:40 885000 -- (-2485.338) (-2478.398) [-2473.788] (-2483.358) * [-2473.194] (-2472.213) (-2478.887) (-2478.659) -- 0:00:40 Average standard deviation of split frequencies: 0.004718 885500 -- [-2480.168] (-2480.382) (-2491.462) (-2479.757) * [-2466.763] (-2474.443) (-2472.325) (-2479.805) -- 0:00:39 886000 -- (-2484.303) (-2470.029) [-2473.437] (-2478.386) * (-2485.273) (-2476.840) (-2479.703) [-2466.442] -- 0:00:39 886500 -- (-2480.283) (-2481.010) (-2479.034) [-2475.385] * (-2477.218) (-2476.669) (-2474.783) [-2475.599] -- 0:00:39 887000 -- [-2468.615] (-2470.479) (-2474.413) (-2482.264) * (-2482.580) (-2469.878) (-2477.046) [-2477.269] -- 0:00:39 887500 -- (-2461.476) (-2472.664) (-2471.569) [-2472.312] * (-2477.274) (-2484.112) [-2470.491] (-2475.526) -- 0:00:39 888000 -- (-2478.225) (-2484.452) (-2486.617) [-2462.940] * (-2478.422) (-2479.534) [-2468.924] (-2473.480) -- 0:00:38 888500 -- (-2483.526) [-2472.795] (-2485.771) (-2472.470) * [-2470.445] (-2470.203) (-2476.018) (-2472.346) -- 0:00:38 889000 -- (-2478.417) [-2480.171] (-2476.319) (-2473.118) * (-2477.581) [-2469.575] (-2477.147) (-2485.707) -- 0:00:38 889500 -- [-2471.348] (-2479.021) (-2479.257) (-2474.606) * [-2474.580] (-2481.302) (-2492.808) (-2491.029) -- 0:00:38 890000 -- (-2474.199) (-2487.397) [-2478.604] (-2470.796) * (-2476.950) [-2476.850] (-2485.959) (-2479.263) -- 0:00:38 Average standard deviation of split frequencies: 0.004799 890500 -- [-2468.709] (-2471.709) (-2475.101) (-2470.918) * (-2484.373) (-2475.391) [-2475.427] (-2481.934) -- 0:00:38 891000 -- [-2475.606] (-2480.648) (-2482.242) (-2472.934) * (-2485.859) [-2476.902] (-2487.250) (-2468.044) -- 0:00:38 891500 -- (-2473.153) [-2472.922] (-2468.630) (-2468.940) * (-2482.072) (-2486.476) [-2480.199] (-2475.411) -- 0:00:37 892000 -- (-2473.509) [-2476.064] (-2486.587) (-2472.223) * [-2472.237] (-2465.608) (-2479.148) (-2479.104) -- 0:00:37 892500 -- (-2476.483) [-2474.848] (-2469.314) (-2481.178) * (-2480.780) [-2474.177] (-2477.001) (-2478.524) -- 0:00:37 893000 -- [-2468.948] (-2488.524) (-2478.341) (-2471.818) * (-2498.360) (-2470.241) [-2467.650] (-2473.864) -- 0:00:37 893500 -- (-2485.142) (-2469.772) [-2469.911] (-2483.959) * (-2477.387) (-2497.909) [-2474.932] (-2477.845) -- 0:00:37 894000 -- (-2472.846) (-2472.369) [-2469.908] (-2478.126) * (-2477.208) (-2470.667) [-2466.581] (-2478.047) -- 0:00:36 894500 -- (-2476.820) (-2475.743) [-2466.075] (-2485.141) * (-2474.422) (-2476.802) (-2470.194) [-2482.307] -- 0:00:36 895000 -- [-2464.940] (-2486.218) (-2481.906) (-2482.108) * (-2497.981) (-2483.218) [-2469.529] (-2477.437) -- 0:00:36 Average standard deviation of split frequencies: 0.004595 895500 -- (-2472.677) (-2490.110) (-2472.265) [-2481.678] * (-2473.782) (-2481.591) [-2473.089] (-2483.067) -- 0:00:36 896000 -- (-2476.656) [-2479.204] (-2470.691) (-2489.078) * (-2468.457) [-2466.849] (-2472.820) (-2477.778) -- 0:00:36 896500 -- (-2478.842) (-2479.326) [-2473.150] (-2476.707) * (-2473.104) (-2470.961) (-2467.070) [-2467.072] -- 0:00:36 897000 -- [-2479.550] (-2480.304) (-2476.575) (-2474.394) * (-2483.283) [-2466.741] (-2476.868) (-2472.602) -- 0:00:35 897500 -- (-2487.736) (-2476.566) [-2464.656] (-2469.419) * (-2480.861) [-2465.192] (-2472.574) (-2466.983) -- 0:00:35 898000 -- (-2480.295) (-2471.324) [-2467.505] (-2466.811) * [-2471.749] (-2471.578) (-2476.459) (-2490.930) -- 0:00:35 898500 -- (-2480.027) (-2480.929) (-2472.607) [-2468.176] * (-2488.159) (-2469.129) [-2469.586] (-2482.052) -- 0:00:35 899000 -- (-2496.039) (-2471.003) (-2482.925) [-2474.978] * (-2478.334) (-2470.093) [-2470.541] (-2472.406) -- 0:00:35 899500 -- [-2469.701] (-2478.150) (-2479.791) (-2478.770) * (-2479.106) (-2473.100) (-2477.617) [-2468.175] -- 0:00:34 900000 -- [-2469.159] (-2473.500) (-2470.916) (-2473.724) * [-2473.329] (-2481.856) (-2474.702) (-2477.808) -- 0:00:34 Average standard deviation of split frequencies: 0.004711 900500 -- (-2475.505) (-2477.924) [-2475.425] (-2481.616) * (-2471.094) [-2469.848] (-2473.968) (-2473.678) -- 0:00:34 901000 -- [-2476.631] (-2474.707) (-2472.905) (-2479.188) * (-2488.603) (-2473.319) (-2480.228) [-2481.257] -- 0:00:34 901500 -- [-2469.602] (-2475.357) (-2481.235) (-2473.020) * (-2482.362) [-2473.240] (-2474.732) (-2477.789) -- 0:00:34 902000 -- (-2485.083) [-2464.414] (-2470.530) (-2480.582) * [-2475.410] (-2487.249) (-2488.974) (-2468.347) -- 0:00:34 902500 -- (-2476.688) (-2479.325) [-2471.707] (-2478.424) * (-2481.641) (-2487.449) [-2472.333] (-2490.761) -- 0:00:33 903000 -- (-2477.580) (-2472.137) (-2470.856) [-2470.188] * (-2483.939) [-2471.219] (-2481.430) (-2480.537) -- 0:00:33 903500 -- (-2475.758) (-2470.470) (-2479.248) [-2475.471] * (-2476.048) (-2480.809) (-2482.226) [-2474.408] -- 0:00:33 904000 -- [-2467.792] (-2471.977) (-2490.128) (-2476.818) * [-2480.048] (-2474.923) (-2482.810) (-2468.717) -- 0:00:33 904500 -- (-2484.007) (-2476.847) (-2481.351) [-2482.266] * [-2469.054] (-2489.062) (-2487.537) (-2476.402) -- 0:00:33 905000 -- (-2478.525) [-2474.270] (-2479.542) (-2481.051) * (-2484.273) [-2475.929] (-2480.547) (-2479.342) -- 0:00:33 Average standard deviation of split frequencies: 0.004822 905500 -- [-2471.015] (-2485.002) (-2478.792) (-2471.062) * (-2471.140) [-2467.309] (-2485.963) (-2479.432) -- 0:00:32 906000 -- (-2468.884) (-2472.692) [-2475.133] (-2468.631) * (-2475.856) [-2467.879] (-2480.884) (-2482.342) -- 0:00:32 906500 -- (-2487.801) (-2471.965) [-2474.050] (-2479.750) * (-2478.879) (-2470.952) (-2468.081) [-2476.037] -- 0:00:32 907000 -- (-2481.169) (-2468.193) (-2480.439) [-2475.647] * (-2475.695) (-2472.798) (-2474.535) [-2469.957] -- 0:00:32 907500 -- (-2476.085) [-2477.640] (-2490.793) (-2473.047) * (-2468.898) [-2475.364] (-2481.166) (-2479.267) -- 0:00:32 908000 -- (-2481.177) (-2477.726) (-2481.059) [-2477.294] * (-2475.521) (-2473.455) [-2470.763] (-2475.339) -- 0:00:32 908500 -- (-2473.985) [-2479.650] (-2484.869) (-2481.562) * (-2484.610) (-2480.349) [-2472.538] (-2476.220) -- 0:00:31 909000 -- (-2471.232) [-2468.129] (-2480.679) (-2472.661) * (-2479.853) (-2481.641) [-2474.291] (-2486.966) -- 0:00:31 909500 -- (-2487.964) (-2470.156) (-2483.056) [-2471.632] * (-2484.604) (-2472.512) (-2470.166) [-2471.856] -- 0:00:31 910000 -- (-2488.465) [-2464.439] (-2478.653) (-2467.184) * (-2469.819) (-2477.511) [-2468.238] (-2488.809) -- 0:00:31 Average standard deviation of split frequencies: 0.004624 910500 -- (-2466.192) [-2479.853] (-2475.019) (-2488.639) * (-2476.660) (-2475.895) (-2474.197) [-2472.844] -- 0:00:31 911000 -- (-2469.224) (-2473.632) (-2471.010) [-2466.694] * [-2467.178] (-2472.758) (-2491.135) (-2475.396) -- 0:00:30 911500 -- (-2484.474) (-2482.022) (-2479.662) [-2477.118] * (-2468.657) [-2477.488] (-2471.550) (-2476.224) -- 0:00:30 912000 -- (-2478.288) (-2491.113) (-2471.680) [-2474.451] * (-2475.678) [-2472.607] (-2470.571) (-2475.607) -- 0:00:30 912500 -- (-2481.323) (-2481.741) (-2482.780) [-2466.260] * (-2484.227) (-2485.399) (-2472.478) [-2471.090] -- 0:00:30 913000 -- (-2490.158) (-2477.809) (-2482.776) [-2471.406] * (-2476.355) (-2490.922) (-2477.408) [-2473.676] -- 0:00:30 913500 -- (-2475.711) [-2472.712] (-2477.068) (-2470.587) * (-2480.625) (-2478.598) [-2470.190] (-2474.194) -- 0:00:30 914000 -- (-2475.423) (-2472.617) [-2480.152] (-2467.248) * (-2477.926) (-2489.232) (-2472.230) [-2473.517] -- 0:00:29 914500 -- (-2490.369) [-2469.841] (-2481.327) (-2478.091) * [-2467.703] (-2467.633) (-2474.977) (-2475.742) -- 0:00:29 915000 -- [-2485.833] (-2472.206) (-2486.617) (-2478.885) * (-2477.395) [-2476.901] (-2478.861) (-2470.993) -- 0:00:29 Average standard deviation of split frequencies: 0.004700 915500 -- [-2475.205] (-2473.296) (-2481.278) (-2476.424) * (-2476.650) (-2477.128) (-2464.922) [-2476.387] -- 0:00:29 916000 -- (-2468.954) [-2470.233] (-2482.351) (-2478.420) * [-2479.298] (-2471.793) (-2486.844) (-2485.132) -- 0:00:29 916500 -- [-2470.176] (-2475.035) (-2466.919) (-2481.162) * (-2474.289) (-2470.954) (-2475.813) [-2477.962] -- 0:00:29 917000 -- (-2478.209) (-2479.246) (-2473.991) [-2469.717] * (-2480.270) (-2482.978) (-2476.552) [-2471.199] -- 0:00:28 917500 -- [-2473.756] (-2482.391) (-2475.811) (-2476.844) * (-2471.744) (-2468.156) [-2465.035] (-2466.092) -- 0:00:28 918000 -- (-2470.561) (-2471.449) [-2473.782] (-2479.863) * (-2486.389) (-2474.186) [-2467.777] (-2471.932) -- 0:00:28 918500 -- (-2467.740) [-2475.246] (-2479.221) (-2471.463) * (-2475.891) (-2473.433) [-2468.250] (-2484.765) -- 0:00:28 919000 -- [-2471.660] (-2484.199) (-2478.893) (-2487.055) * (-2475.597) [-2471.495] (-2483.828) (-2478.834) -- 0:00:28 919500 -- (-2476.155) (-2479.676) (-2471.855) [-2472.121] * [-2466.884] (-2467.910) (-2478.037) (-2470.132) -- 0:00:28 920000 -- (-2476.354) [-2471.828] (-2477.483) (-2467.586) * [-2472.429] (-2478.771) (-2478.824) (-2476.364) -- 0:00:27 Average standard deviation of split frequencies: 0.004506 920500 -- (-2473.611) [-2479.658] (-2470.423) (-2489.730) * (-2467.381) (-2475.618) (-2475.815) [-2468.479] -- 0:00:27 921000 -- (-2474.994) (-2480.533) [-2463.750] (-2476.756) * (-2480.130) (-2470.803) [-2469.339] (-2473.397) -- 0:00:27 921500 -- (-2484.507) (-2477.246) [-2472.098] (-2476.756) * (-2474.865) (-2489.806) [-2470.135] (-2474.654) -- 0:00:27 922000 -- [-2475.267] (-2481.245) (-2473.114) (-2489.901) * (-2475.416) (-2473.116) [-2472.236] (-2478.578) -- 0:00:27 922500 -- (-2476.267) (-2485.649) [-2479.608] (-2476.522) * (-2488.650) [-2476.610] (-2473.930) (-2472.944) -- 0:00:26 923000 -- [-2469.710] (-2492.932) (-2475.105) (-2479.386) * (-2475.910) [-2477.252] (-2477.370) (-2481.720) -- 0:00:26 923500 -- (-2474.408) (-2484.657) [-2474.827] (-2481.393) * [-2474.946] (-2484.073) (-2483.784) (-2478.007) -- 0:00:26 924000 -- (-2479.137) [-2471.406] (-2477.431) (-2478.529) * (-2476.291) (-2482.507) [-2477.222] (-2480.335) -- 0:00:26 924500 -- (-2481.788) (-2472.791) (-2471.427) [-2477.789] * [-2475.200] (-2474.159) (-2486.408) (-2480.887) -- 0:00:26 925000 -- [-2470.620] (-2479.347) (-2479.994) (-2473.637) * [-2472.673] (-2470.987) (-2475.356) (-2472.166) -- 0:00:26 Average standard deviation of split frequencies: 0.004412 925500 -- [-2470.363] (-2486.059) (-2480.401) (-2475.881) * [-2473.668] (-2467.988) (-2472.582) (-2471.006) -- 0:00:25 926000 -- [-2470.749] (-2479.645) (-2475.014) (-2495.209) * (-2482.468) (-2476.603) (-2477.128) [-2468.092] -- 0:00:25 926500 -- (-2469.521) (-2481.451) [-2473.660] (-2484.475) * [-2475.186] (-2475.373) (-2465.778) (-2476.893) -- 0:00:25 927000 -- [-2473.675] (-2470.978) (-2479.827) (-2475.340) * [-2468.083] (-2474.846) (-2470.306) (-2476.482) -- 0:00:25 927500 -- (-2484.065) (-2478.592) (-2469.780) [-2474.819] * [-2467.249] (-2482.742) (-2474.747) (-2496.425) -- 0:00:25 928000 -- [-2482.184] (-2479.918) (-2489.490) (-2477.388) * [-2475.361] (-2467.484) (-2477.666) (-2476.013) -- 0:00:25 928500 -- (-2484.639) [-2473.232] (-2468.832) (-2492.868) * (-2473.579) [-2469.120] (-2472.862) (-2477.366) -- 0:00:24 929000 -- (-2481.845) (-2486.012) (-2474.926) [-2477.682] * [-2464.861] (-2470.986) (-2471.299) (-2483.164) -- 0:00:24 929500 -- (-2483.443) (-2475.459) (-2469.820) [-2478.695] * (-2470.219) [-2475.384] (-2477.217) (-2478.463) -- 0:00:24 930000 -- (-2490.418) [-2468.201] (-2471.048) (-2466.089) * [-2471.960] (-2477.796) (-2470.965) (-2473.018) -- 0:00:24 Average standard deviation of split frequencies: 0.004660 930500 -- [-2478.213] (-2476.654) (-2483.722) (-2480.249) * (-2473.237) [-2478.648] (-2474.454) (-2481.222) -- 0:00:24 931000 -- [-2476.809] (-2475.588) (-2473.883) (-2478.819) * (-2480.128) (-2490.534) (-2479.263) [-2471.079] -- 0:00:24 931500 -- (-2477.122) (-2475.629) (-2486.500) [-2467.916] * (-2473.898) (-2479.870) [-2469.493] (-2475.650) -- 0:00:23 932000 -- [-2470.296] (-2471.707) (-2471.910) (-2481.751) * (-2481.700) [-2470.173] (-2482.792) (-2483.644) -- 0:00:23 932500 -- (-2472.554) (-2481.149) [-2466.208] (-2476.769) * (-2483.332) [-2481.944] (-2481.165) (-2486.713) -- 0:00:23 933000 -- (-2486.458) [-2478.387] (-2473.462) (-2495.038) * (-2475.829) (-2474.775) [-2475.730] (-2479.203) -- 0:00:23 933500 -- (-2478.000) [-2463.216] (-2484.929) (-2487.851) * (-2470.391) (-2466.072) (-2490.145) [-2470.664] -- 0:00:23 934000 -- (-2478.840) (-2480.671) [-2472.542] (-2480.364) * (-2480.218) (-2475.431) (-2484.586) [-2479.276] -- 0:00:22 934500 -- (-2481.479) (-2482.787) [-2466.488] (-2477.773) * [-2476.345] (-2474.222) (-2475.981) (-2482.367) -- 0:00:22 935000 -- [-2471.928] (-2481.018) (-2478.980) (-2480.842) * (-2475.058) (-2475.884) [-2474.753] (-2483.259) -- 0:00:22 Average standard deviation of split frequencies: 0.004969 935500 -- (-2474.582) (-2472.963) [-2478.712] (-2485.570) * [-2472.765] (-2488.080) (-2474.695) (-2496.419) -- 0:00:22 936000 -- (-2472.743) [-2467.901] (-2485.700) (-2482.899) * [-2472.158] (-2482.929) (-2478.801) (-2471.569) -- 0:00:22 936500 -- [-2483.304] (-2470.711) (-2492.430) (-2480.296) * [-2467.949] (-2478.485) (-2491.175) (-2469.068) -- 0:00:22 937000 -- (-2476.155) [-2471.064] (-2470.009) (-2479.089) * (-2473.417) (-2478.154) (-2472.729) [-2483.889] -- 0:00:21 937500 -- (-2476.145) [-2468.615] (-2477.741) (-2478.519) * [-2471.957] (-2473.157) (-2481.046) (-2473.484) -- 0:00:21 938000 -- [-2471.535] (-2481.576) (-2473.857) (-2486.125) * (-2475.381) (-2477.926) [-2473.589] (-2474.592) -- 0:00:21 938500 -- (-2473.111) [-2468.227] (-2469.916) (-2469.729) * [-2474.945] (-2468.604) (-2486.216) (-2490.043) -- 0:00:21 939000 -- (-2476.226) (-2480.680) (-2466.464) [-2474.697] * (-2478.359) (-2476.999) (-2484.917) [-2474.278] -- 0:00:21 939500 -- (-2484.441) (-2469.146) [-2473.145] (-2473.180) * (-2489.411) (-2468.677) (-2485.194) [-2473.979] -- 0:00:21 940000 -- [-2473.903] (-2484.112) (-2474.473) (-2488.484) * (-2483.500) (-2470.561) [-2472.488] (-2481.763) -- 0:00:20 Average standard deviation of split frequencies: 0.005011 940500 -- (-2474.469) (-2474.768) (-2479.541) [-2471.942] * [-2474.241] (-2476.133) (-2477.703) (-2482.785) -- 0:00:20 941000 -- (-2485.416) (-2475.673) [-2469.178] (-2474.787) * (-2467.913) (-2470.245) (-2475.009) [-2481.843] -- 0:00:20 941500 -- (-2475.346) [-2465.221] (-2473.650) (-2473.558) * (-2481.457) (-2472.851) (-2478.572) [-2471.272] -- 0:00:20 942000 -- (-2482.765) [-2468.984] (-2487.387) (-2481.730) * [-2472.067] (-2479.953) (-2479.681) (-2473.157) -- 0:00:20 942500 -- (-2470.093) [-2473.227] (-2478.309) (-2476.899) * [-2480.587] (-2480.683) (-2484.247) (-2495.326) -- 0:00:20 943000 -- (-2480.292) [-2469.742] (-2475.590) (-2476.019) * (-2481.569) (-2495.176) (-2480.917) [-2480.682] -- 0:00:19 943500 -- (-2472.339) [-2483.076] (-2475.464) (-2495.681) * [-2463.756] (-2490.303) (-2485.666) (-2481.396) -- 0:00:19 944000 -- (-2475.665) [-2473.592] (-2477.491) (-2483.252) * (-2475.974) (-2493.128) [-2472.945] (-2473.618) -- 0:00:19 944500 -- [-2467.690] (-2479.011) (-2481.601) (-2479.079) * (-2480.491) (-2474.931) (-2475.873) [-2471.590] -- 0:00:19 945000 -- (-2469.208) (-2484.100) [-2483.247] (-2486.587) * (-2485.873) (-2469.837) [-2477.712] (-2482.601) -- 0:00:19 Average standard deviation of split frequencies: 0.005016 945500 -- [-2480.326] (-2488.503) (-2467.619) (-2479.408) * [-2471.045] (-2491.444) (-2473.370) (-2480.806) -- 0:00:18 946000 -- (-2466.066) (-2490.262) [-2466.803] (-2480.901) * (-2486.583) (-2482.701) [-2467.360] (-2483.158) -- 0:00:18 946500 -- [-2466.230] (-2487.204) (-2470.088) (-2471.975) * (-2483.225) [-2475.467] (-2475.877) (-2486.964) -- 0:00:18 947000 -- [-2466.796] (-2480.345) (-2468.100) (-2473.099) * (-2483.752) (-2466.549) (-2479.921) [-2477.852] -- 0:00:18 947500 -- (-2477.463) (-2465.293) (-2470.100) [-2469.688] * (-2478.638) [-2469.595] (-2490.431) (-2477.399) -- 0:00:18 948000 -- (-2466.626) (-2473.892) (-2480.343) [-2469.122] * (-2476.933) (-2479.283) (-2480.801) [-2475.967] -- 0:00:18 948500 -- (-2472.575) (-2472.951) (-2478.528) [-2467.662] * (-2467.900) (-2475.441) [-2477.413] (-2474.783) -- 0:00:17 949000 -- (-2485.025) (-2468.845) (-2483.604) [-2475.477] * [-2478.230] (-2478.050) (-2478.166) (-2474.341) -- 0:00:17 949500 -- (-2480.994) [-2473.432] (-2469.742) (-2474.312) * (-2476.103) [-2476.874] (-2477.538) (-2479.494) -- 0:00:17 950000 -- [-2473.241] (-2470.248) (-2470.085) (-2470.674) * (-2473.555) [-2471.218] (-2470.063) (-2484.294) -- 0:00:17 Average standard deviation of split frequencies: 0.005091 950500 -- (-2479.014) [-2474.165] (-2471.629) (-2465.589) * (-2470.406) [-2469.292] (-2473.691) (-2484.286) -- 0:00:17 951000 -- [-2471.514] (-2474.841) (-2474.859) (-2470.968) * (-2484.861) (-2479.213) [-2469.654] (-2484.363) -- 0:00:17 951500 -- (-2471.607) [-2483.394] (-2478.095) (-2468.509) * (-2491.224) [-2472.366] (-2472.301) (-2480.097) -- 0:00:16 952000 -- (-2474.744) [-2471.653] (-2477.730) (-2471.575) * [-2482.372] (-2481.892) (-2473.494) (-2477.140) -- 0:00:16 952500 -- (-2483.232) (-2476.176) (-2487.370) [-2479.882] * (-2487.694) (-2473.135) (-2476.182) [-2467.881] -- 0:00:16 953000 -- [-2478.188] (-2465.045) (-2480.676) (-2478.522) * (-2481.419) [-2485.064] (-2471.272) (-2473.864) -- 0:00:16 953500 -- (-2476.263) (-2471.512) [-2476.179] (-2480.644) * (-2489.807) [-2473.502] (-2483.807) (-2478.327) -- 0:00:16 954000 -- (-2484.931) [-2469.780] (-2478.417) (-2479.264) * [-2480.680] (-2479.519) (-2477.335) (-2476.884) -- 0:00:16 954500 -- (-2468.013) [-2475.927] (-2473.324) (-2480.039) * (-2479.120) (-2470.184) (-2474.127) [-2468.190] -- 0:00:15 955000 -- (-2488.312) [-2474.898] (-2469.047) (-2473.586) * (-2476.361) [-2468.419] (-2472.313) (-2481.031) -- 0:00:15 Average standard deviation of split frequencies: 0.004865 955500 -- (-2481.426) (-2480.110) [-2472.952] (-2480.099) * [-2469.666] (-2482.601) (-2477.698) (-2468.667) -- 0:00:15 956000 -- (-2469.774) (-2490.975) (-2487.622) [-2479.740] * [-2473.252] (-2476.790) (-2480.625) (-2466.197) -- 0:00:15 956500 -- [-2470.002] (-2488.107) (-2481.249) (-2485.539) * [-2467.204] (-2469.100) (-2472.450) (-2474.947) -- 0:00:15 957000 -- [-2472.547] (-2472.862) (-2481.961) (-2480.357) * (-2479.065) (-2486.140) [-2467.538] (-2473.595) -- 0:00:14 957500 -- [-2472.799] (-2496.084) (-2477.107) (-2469.697) * [-2472.524] (-2488.673) (-2476.377) (-2467.881) -- 0:00:14 958000 -- (-2474.560) (-2469.265) (-2474.830) [-2469.383] * (-2473.614) (-2474.005) (-2473.554) [-2475.802] -- 0:00:14 958500 -- (-2472.488) [-2470.810] (-2478.031) (-2471.188) * (-2492.205) (-2475.968) [-2482.719] (-2468.169) -- 0:00:14 959000 -- (-2471.348) [-2473.418] (-2480.665) (-2471.485) * (-2495.611) (-2484.476) (-2475.021) [-2478.950] -- 0:00:14 959500 -- [-2473.599] (-2476.569) (-2465.285) (-2478.040) * (-2474.613) (-2472.320) [-2475.918] (-2482.607) -- 0:00:14 960000 -- (-2477.471) (-2476.651) [-2472.098] (-2486.130) * (-2475.822) (-2480.887) (-2476.190) [-2478.055] -- 0:00:13 Average standard deviation of split frequencies: 0.004613 960500 -- (-2486.148) (-2472.534) (-2482.300) [-2473.091] * [-2470.522] (-2470.767) (-2486.852) (-2482.587) -- 0:00:13 961000 -- (-2495.036) (-2480.088) (-2481.496) [-2481.659] * (-2469.889) [-2476.946] (-2471.723) (-2475.274) -- 0:00:13 961500 -- (-2472.663) (-2470.259) [-2477.014] (-2490.921) * (-2474.744) (-2479.131) (-2475.145) [-2468.530] -- 0:00:13 962000 -- (-2484.224) [-2482.607] (-2475.052) (-2481.793) * (-2470.721) [-2471.990] (-2477.241) (-2467.538) -- 0:00:13 962500 -- (-2481.278) (-2477.426) (-2476.877) [-2476.141] * [-2478.405] (-2477.326) (-2485.607) (-2472.281) -- 0:00:13 963000 -- (-2496.316) (-2477.461) [-2471.964] (-2473.174) * (-2476.872) (-2489.460) (-2500.309) [-2473.396] -- 0:00:12 963500 -- (-2491.311) (-2471.684) (-2479.256) [-2465.611] * [-2467.006] (-2492.450) (-2482.107) (-2470.058) -- 0:00:12 964000 -- (-2479.940) (-2469.123) [-2470.181] (-2472.157) * [-2473.167] (-2478.181) (-2485.381) (-2480.772) -- 0:00:12 964500 -- (-2482.253) [-2470.288] (-2475.093) (-2474.130) * [-2472.560] (-2478.464) (-2474.617) (-2472.476) -- 0:00:12 965000 -- (-2483.036) [-2477.158] (-2471.014) (-2475.691) * (-2485.974) (-2473.201) [-2479.889] (-2486.161) -- 0:00:12 Average standard deviation of split frequencies: 0.004815 965500 -- [-2468.138] (-2474.127) (-2473.213) (-2473.045) * (-2471.127) (-2476.579) (-2475.990) [-2473.516] -- 0:00:12 966000 -- (-2476.935) [-2467.144] (-2467.246) (-2480.514) * (-2473.886) [-2471.848] (-2477.132) (-2480.023) -- 0:00:11 966500 -- [-2472.733] (-2473.922) (-2476.611) (-2487.962) * (-2472.359) [-2481.166] (-2473.927) (-2489.584) -- 0:00:11 967000 -- [-2475.866] (-2471.000) (-2484.001) (-2485.915) * (-2480.891) [-2475.911] (-2475.414) (-2475.534) -- 0:00:11 967500 -- [-2485.816] (-2474.095) (-2472.085) (-2484.653) * (-2477.889) (-2475.830) (-2484.104) [-2472.041] -- 0:00:11 968000 -- (-2470.897) (-2474.893) (-2465.628) [-2472.845] * [-2468.193] (-2483.882) (-2470.717) (-2482.553) -- 0:00:11 968500 -- (-2472.384) [-2475.531] (-2480.568) (-2480.550) * (-2479.039) [-2468.704] (-2470.026) (-2473.536) -- 0:00:10 969000 -- (-2480.839) (-2462.661) [-2473.485] (-2482.799) * (-2475.604) [-2472.161] (-2480.565) (-2482.672) -- 0:00:10 969500 -- (-2480.412) (-2472.361) (-2478.457) [-2482.810] * (-2482.313) (-2484.321) (-2476.620) [-2480.122] -- 0:00:10 970000 -- (-2476.969) [-2467.558] (-2476.214) (-2482.302) * (-2475.361) [-2475.929] (-2471.538) (-2497.350) -- 0:00:10 Average standard deviation of split frequencies: 0.004597 970500 -- [-2477.020] (-2471.404) (-2465.765) (-2480.762) * [-2469.562] (-2479.673) (-2483.892) (-2471.370) -- 0:00:10 971000 -- (-2469.571) (-2476.347) (-2478.038) [-2470.582] * [-2468.033] (-2484.283) (-2487.286) (-2469.614) -- 0:00:10 971500 -- [-2473.374] (-2476.324) (-2471.040) (-2479.487) * (-2482.829) (-2478.589) (-2476.472) [-2468.808] -- 0:00:09 972000 -- (-2467.706) [-2474.026] (-2476.747) (-2478.982) * [-2478.386] (-2471.794) (-2476.097) (-2465.804) -- 0:00:09 972500 -- (-2473.130) (-2471.320) (-2473.074) [-2470.821] * (-2486.221) (-2472.834) [-2472.884] (-2475.886) -- 0:00:09 973000 -- (-2485.745) [-2471.464] (-2469.984) (-2468.077) * (-2473.268) [-2474.061] (-2479.484) (-2476.497) -- 0:00:09 973500 -- (-2477.783) [-2473.689] (-2486.969) (-2465.910) * [-2477.475] (-2476.130) (-2474.040) (-2469.213) -- 0:00:09 974000 -- (-2474.793) (-2481.467) (-2474.280) [-2472.320] * (-2483.346) [-2477.184] (-2471.898) (-2480.177) -- 0:00:09 974500 -- (-2471.800) (-2476.781) [-2472.338] (-2477.573) * (-2476.825) [-2470.748] (-2483.043) (-2478.312) -- 0:00:08 975000 -- (-2480.694) (-2465.727) [-2473.826] (-2491.792) * [-2475.624] (-2475.750) (-2471.357) (-2480.162) -- 0:00:08 Average standard deviation of split frequencies: 0.004315 975500 -- (-2481.437) [-2469.072] (-2482.282) (-2481.707) * [-2469.946] (-2474.596) (-2473.315) (-2483.565) -- 0:00:08 976000 -- (-2485.893) (-2472.753) (-2486.026) [-2468.410] * (-2474.721) (-2480.649) [-2466.485] (-2490.497) -- 0:00:08 976500 -- [-2468.813] (-2463.903) (-2478.163) (-2472.372) * (-2470.828) (-2474.229) [-2479.166] (-2477.927) -- 0:00:08 977000 -- [-2476.732] (-2479.842) (-2474.465) (-2483.221) * (-2477.831) (-2482.425) (-2473.083) [-2468.867] -- 0:00:07 977500 -- (-2467.732) [-2471.635] (-2484.618) (-2470.632) * (-2473.330) (-2477.736) [-2476.493] (-2476.622) -- 0:00:07 978000 -- (-2476.180) (-2469.226) (-2478.433) [-2470.577] * (-2496.592) (-2483.553) (-2479.142) [-2469.524] -- 0:00:07 978500 -- [-2475.730] (-2486.634) (-2477.534) (-2473.313) * (-2466.760) [-2476.838] (-2481.529) (-2480.441) -- 0:00:07 979000 -- (-2485.090) (-2473.010) (-2478.561) [-2484.701] * [-2467.132] (-2477.747) (-2485.625) (-2478.603) -- 0:00:07 979500 -- (-2491.181) [-2470.627] (-2470.651) (-2482.208) * (-2489.203) (-2489.542) (-2482.252) [-2478.760] -- 0:00:07 980000 -- (-2478.727) (-2473.858) (-2483.620) [-2468.663] * [-2474.656] (-2484.355) (-2477.228) (-2484.421) -- 0:00:06 Average standard deviation of split frequencies: 0.004390 980500 -- [-2482.061] (-2475.975) (-2470.857) (-2478.113) * [-2465.995] (-2485.483) (-2485.087) (-2478.836) -- 0:00:06 981000 -- [-2475.988] (-2481.945) (-2472.794) (-2474.485) * (-2469.655) (-2470.716) [-2476.102] (-2477.030) -- 0:00:06 981500 -- [-2473.767] (-2473.176) (-2489.360) (-2488.224) * (-2466.951) [-2476.399] (-2477.373) (-2473.519) -- 0:00:06 982000 -- [-2474.917] (-2485.483) (-2477.046) (-2487.285) * (-2468.026) [-2473.058] (-2475.966) (-2484.751) -- 0:00:06 982500 -- (-2478.251) [-2478.441] (-2476.864) (-2472.885) * (-2478.385) (-2491.019) [-2464.702] (-2476.704) -- 0:00:06 983000 -- (-2464.205) (-2481.524) (-2482.622) [-2473.220] * (-2482.540) (-2482.381) [-2470.223] (-2480.466) -- 0:00:05 983500 -- [-2484.550] (-2481.128) (-2475.935) (-2497.486) * (-2471.190) (-2471.394) [-2471.939] (-2467.166) -- 0:00:05 984000 -- (-2474.803) [-2470.634] (-2480.286) (-2474.430) * (-2474.081) [-2475.691] (-2470.613) (-2478.732) -- 0:00:05 984500 -- (-2478.748) [-2470.489] (-2469.588) (-2485.276) * (-2471.232) [-2472.582] (-2468.051) (-2477.769) -- 0:00:05 985000 -- (-2473.278) [-2466.860] (-2486.921) (-2476.597) * [-2474.665] (-2476.380) (-2468.695) (-2488.591) -- 0:00:05 Average standard deviation of split frequencies: 0.004558 985500 -- (-2466.696) (-2475.526) [-2476.875] (-2490.142) * (-2470.545) [-2479.946] (-2477.202) (-2482.317) -- 0:00:05 986000 -- (-2475.464) (-2481.426) [-2476.679] (-2477.914) * (-2482.393) (-2473.509) (-2475.122) [-2470.111] -- 0:00:04 986500 -- [-2466.894] (-2485.651) (-2479.252) (-2476.555) * (-2473.910) (-2483.863) (-2478.299) [-2479.550] -- 0:00:04 987000 -- (-2476.200) (-2483.206) [-2476.776] (-2487.411) * [-2473.788] (-2472.527) (-2477.175) (-2469.753) -- 0:00:04 987500 -- [-2467.615] (-2480.955) (-2468.972) (-2487.560) * (-2482.410) (-2474.445) (-2487.840) [-2467.252] -- 0:00:04 988000 -- (-2471.079) (-2499.172) [-2469.684] (-2482.012) * (-2478.322) (-2485.288) [-2470.438] (-2479.254) -- 0:00:04 988500 -- (-2474.341) [-2467.370] (-2474.233) (-2485.485) * [-2468.458] (-2476.937) (-2477.404) (-2477.243) -- 0:00:03 989000 -- (-2476.809) [-2473.187] (-2484.364) (-2476.786) * [-2469.134] (-2476.318) (-2485.544) (-2474.954) -- 0:00:03 989500 -- (-2465.316) [-2474.299] (-2475.134) (-2479.077) * (-2475.689) (-2472.829) (-2473.949) [-2472.556] -- 0:00:03 990000 -- (-2479.299) (-2473.814) [-2470.732] (-2482.087) * (-2478.392) [-2465.348] (-2473.582) (-2470.472) -- 0:00:03 Average standard deviation of split frequencies: 0.004505 990500 -- (-2489.021) (-2479.375) [-2480.198] (-2489.034) * [-2479.579] (-2470.153) (-2471.960) (-2473.371) -- 0:00:03 991000 -- [-2472.610] (-2466.827) (-2465.064) (-2473.703) * (-2480.222) [-2469.626] (-2477.008) (-2475.120) -- 0:00:03 991500 -- [-2473.439] (-2487.639) (-2470.364) (-2484.456) * (-2473.288) (-2477.078) (-2480.673) [-2481.026] -- 0:00:02 992000 -- [-2491.469] (-2473.593) (-2472.471) (-2475.853) * (-2475.783) [-2472.960] (-2477.814) (-2482.906) -- 0:00:02 992500 -- (-2482.732) (-2478.003) (-2470.853) [-2474.655] * (-2473.657) (-2475.201) (-2481.295) [-2473.581] -- 0:00:02 993000 -- (-2489.696) (-2477.960) (-2480.068) [-2469.302] * (-2475.666) (-2492.042) [-2473.917] (-2482.827) -- 0:00:02 993500 -- (-2477.922) (-2481.731) (-2473.728) [-2471.278] * (-2479.760) (-2467.241) [-2475.251] (-2482.299) -- 0:00:02 994000 -- (-2489.878) (-2485.093) (-2473.820) [-2474.833] * (-2476.531) [-2469.758] (-2470.409) (-2468.898) -- 0:00:02 994500 -- (-2482.440) (-2479.898) [-2473.534] (-2479.381) * [-2469.063] (-2485.004) (-2470.233) (-2474.663) -- 0:00:01 995000 -- (-2471.625) (-2474.209) [-2468.677] (-2468.622) * [-2465.787] (-2476.517) (-2477.642) (-2474.501) -- 0:00:01 Average standard deviation of split frequencies: 0.004796 995500 -- (-2485.790) (-2477.817) (-2479.725) [-2486.087] * (-2474.285) (-2479.642) (-2472.574) [-2474.044] -- 0:00:01 996000 -- (-2490.921) [-2470.030] (-2479.302) (-2491.557) * (-2477.346) (-2469.750) [-2468.134] (-2477.769) -- 0:00:01 996500 -- (-2490.758) (-2466.621) (-2475.585) [-2472.813] * (-2472.304) (-2481.495) (-2475.392) [-2465.074] -- 0:00:01 997000 -- (-2477.387) (-2476.985) [-2476.227] (-2480.607) * (-2465.083) (-2474.356) (-2487.129) [-2474.611] -- 0:00:01 997500 -- [-2481.340] (-2482.127) (-2478.665) (-2468.161) * (-2485.465) (-2472.951) (-2470.854) [-2474.252] -- 0:00:00 998000 -- (-2484.611) (-2476.889) (-2473.603) [-2473.460] * (-2476.175) (-2470.834) (-2466.641) [-2473.552] -- 0:00:00 998500 -- [-2474.088] (-2470.813) (-2477.127) (-2488.862) * (-2483.042) [-2468.014] (-2472.115) (-2477.377) -- 0:00:00 999000 -- (-2478.396) [-2473.689] (-2479.583) (-2487.173) * [-2475.456] (-2477.594) (-2477.738) (-2481.764) -- 0:00:00 999500 -- [-2468.164] (-2481.524) (-2485.336) (-2481.566) * (-2490.445) (-2482.644) (-2475.702) [-2470.559] -- 0:00:00 1000000 -- (-2470.427) (-2481.120) [-2476.235] (-2486.211) * (-2475.155) (-2482.339) [-2471.681] (-2471.278) -- 0:00:00 Average standard deviation of split frequencies: 0.004899 Final log likelihoods and log prior probs for run 1 (stored and calculated): Chain 1 -- -2470.426806 -- 26.640069 Chain 1 -- -2470.426807 -- 26.640069 Chain 2 -- -2481.120199 -- 28.319881 Chain 2 -- -2481.120213 -- 28.319881 Chain 3 -- -2476.234862 -- 27.069151 Chain 3 -- -2476.234862 -- 27.069151 Chain 4 -- -2486.210553 -- 26.019468 Chain 4 -- -2486.210562 -- 26.019468 Final log likelihoods and log prior probs for run 2 (stored and calculated): Chain 1 -- -2475.155332 -- 21.808227 Chain 1 -- -2475.155317 -- 21.808227 Chain 2 -- -2482.339097 -- 27.003316 Chain 2 -- -2482.339100 -- 27.003316 Chain 3 -- -2471.680995 -- 26.200282 Chain 3 -- -2471.681003 -- 26.200282 Chain 4 -- -2471.278128 -- 23.407422 Chain 4 -- -2471.278125 -- 23.407422 Analysis completed in 5 mins 47 seconds Analysis used 346.31 seconds of CPU time Likelihood of best state for "cold" chain of run 1 was -2457.65 Likelihood of best state for "cold" chain of run 2 was -2457.46 Acceptance rates for the moves in the "cold" chain of run 1: With prob. (last 100) chain accepted proposals by move 47.0 % ( 36 %) Dirichlet(Revmat{all}) 62.0 % ( 47 %) Slider(Revmat{all}) 24.3 % ( 20 %) Dirichlet(Pi{all}) 26.9 % ( 28 %) Slider(Pi{all}) 32.2 % ( 31 %) Multiplier(Alpha{1,2}) 45.0 % ( 30 %) Multiplier(Alpha{3}) 35.5 % ( 23 %) Slider(Pinvar{all}) 15.5 % ( 12 %) ExtSPR(Tau{all},V{all}) 4.8 % ( 5 %) ExtTBR(Tau{all},V{all}) 21.2 % ( 24 %) NNI(Tau{all},V{all}) 18.5 % ( 14 %) ParsSPR(Tau{all},V{all}) 26.7 % ( 23 %) Multiplier(V{all}) 42.8 % ( 42 %) Nodeslider(V{all}) 26.1 % ( 27 %) TLMultiplier(V{all}) Acceptance rates for the moves in the "cold" chain of run 2: With prob. (last 100) chain accepted proposals by move 46.4 % ( 43 %) Dirichlet(Revmat{all}) 62.9 % ( 48 %) Slider(Revmat{all}) 24.2 % ( 22 %) Dirichlet(Pi{all}) 26.8 % ( 21 %) Slider(Pi{all}) 32.0 % ( 24 %) Multiplier(Alpha{1,2}) 44.8 % ( 30 %) Multiplier(Alpha{3}) 36.3 % ( 25 %) Slider(Pinvar{all}) 15.3 % ( 14 %) ExtSPR(Tau{all},V{all}) 4.6 % ( 4 %) ExtTBR(Tau{all},V{all}) 21.2 % ( 21 %) NNI(Tau{all},V{all}) 18.4 % ( 17 %) ParsSPR(Tau{all},V{all}) 26.7 % ( 25 %) Multiplier(V{all}) 42.8 % ( 53 %) Nodeslider(V{all}) 25.9 % ( 35 %) TLMultiplier(V{all}) Chain swap information for run 1: 1 2 3 4 ---------------------------------- 1 | 0.73 0.51 0.34 2 | 166240 0.75 0.54 3 | 167357 167306 0.77 4 | 166310 166638 166149 Chain swap information for run 2: 1 2 3 4 ---------------------------------- 1 | 0.74 0.51 0.35 2 | 167085 0.75 0.54 3 | 166563 167184 0.77 4 | 166609 166370 166189 Upper diagonal: Proportion of successful state exchanges between chains Lower diagonal: Number of attempted state exchanges between chains Chain information: ID -- Heat ----------- 1 -- 1.00 (cold chain) 2 -- 0.91 3 -- 0.83 4 -- 0.77 Heat = 1 / (1 + T * (ID - 1)) (where T = 0.10 is the temperature and ID is the chain number) Setting burn-in to 2500 Summarizing parameters in files /opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p Writing summary statistics to file /opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples Below are rough plots of the generation (x-axis) versus the log probability of observing the data (y-axis). You can use these graphs to determine what the burn in for your analysis should be. When the log probability starts to plateau you may be at station- arity. Sample trees and parameters after the log probability plateaus. Of course, this is not a guarantee that you are at sta- tionarity. Also examine the convergence diagnostics provided by the 'sump' and 'sumt' commands for all the parameters in your model. Remember that the burn in is the number of samples to dis- card. There are a total of ngen / samplefreq samples taken during a MCMC analysis. Overlay plot for both runs: (1 = Run number 1; 2 = Run number 2; * = Both runs) +------------------------------------------------------------+ -2469.98 | 2 2 | | 2 | | 1 | | 2 2 2 1 2 2 2 1 2| | 121 2 1 1 1 2 **2 *2 22 1 | | 22 1 1 2 2 * 1 1*2 1 2 | | 12 1 11 12 1 22 1 1 1 21 2 | |12 2 1 1 2 2 2 11 1 1 1 2 11* 12 | | 22 * 2 2 1 2 1 2 22 | |2 1 2 1 1 2 11 * 1 1 11| | 112 2 2 2 | | 1 21 1 | | | | | | 1 | +------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2476.35 ^ ^ 250000 1000000 Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2466.01 -2484.91 2 -2465.92 -2491.75 -------------------------------------- TOTAL -2465.97 -2491.06 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.405539 0.004198 0.287953 0.537082 0.399629 1151.96 1285.41 1.000 r(A<->C){all} 0.135157 0.001324 0.065472 0.205019 0.132245 877.62 912.21 1.003 r(A<->G){all} 0.206237 0.002191 0.117848 0.294669 0.203357 583.12 664.68 1.000 r(A<->T){all} 0.133072 0.001700 0.058529 0.215591 0.130242 669.94 793.30 1.003 r(C<->G){all} 0.055255 0.000306 0.023688 0.089028 0.053444 1026.52 1064.14 1.001 r(C<->T){all} 0.460926 0.003745 0.334927 0.575895 0.460106 605.01 629.37 1.000 r(G<->T){all} 0.009354 0.000077 0.000002 0.027146 0.006739 1150.86 1162.94 1.001 pi(A){all} 0.238435 0.000155 0.214425 0.262464 0.238015 1259.68 1344.98 1.001 pi(C){all} 0.304132 0.000167 0.278019 0.327796 0.303839 1147.97 1263.61 1.000 pi(G){all} 0.266757 0.000166 0.242084 0.292463 0.266671 965.01 1073.51 1.001 pi(T){all} 0.190677 0.000114 0.171532 0.212362 0.190658 1110.73 1157.09 1.000 alpha{1,2} 0.114328 0.000420 0.076541 0.151545 0.112923 1317.52 1381.32 1.000 alpha{3} 2.162042 0.600672 0.844509 3.652757 2.026815 1261.18 1302.66 1.001 pinvar{all} 0.743327 0.000778 0.683516 0.790727 0.744759 1393.53 1412.02 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple Setting urn-in to 2500 Summarizing trees in files "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t" Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees Writing statistics to files /opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con> Examining first file ... Found one tree block in file "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block Expecting the same number of trees in the last tree block of all files Tree reading status: 0 10 20 30 40 50 60 70 80 90 100 v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v ********************************************************************************* Read a total of 4002 trees in 2 files (sampling 3002 of them) (Each file contained 2001 trees of which 1501 were sampled) General explanation: In an unrooted tree, a taxon bipartition (split) is specified by removing a branch, thereby dividing the species into those to the left and those to the right of the branch. Here, taxa to one side of the removed branch are denoted '.' and those to the other side are denoted '*'. Specifically, the '.' symbol is used for the taxa on the same side as the outgroup. In a rooted or clock tree, the tree is rooted using the model and not by reference to an outgroup. Each bipartition therefore corresponds to a clade, that is, a group that includes all the descendants of a particular branch in the tree. Taxa that are included in each clade are denoted using '*', and taxa that are not included are denoted using the '.' symbol. The output first includes a key to all the bipartitions with frequency larger or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to sumt command and currently it is set to 0.10. This is followed by a table with statistics for the informative bipartitions (those including at least two taxa), sorted from highest to lowest probability. For each bipartition, the table gives the number of times the partition or split was observed in all runs (#obs) and the posterior probability of the bipartition (Probab.), which is the same as the split frequency. If several runs are summarized, this is followed by the minimum split frequency (Min(s)), the maximum frequency (Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs. The latter value should approach 0 for all bipartitions as MCMC runs converge. This is followed by a table summarizing branch lengths, node heights (if a clock model was used) and relaxed clock parameters (if a relaxed clock model was used). The mean, variance, and 95 % credible interval are given for each of these parameters. If several runs are summarized, the potential scale reduction factor (PSRF) is also given; it should approach 1 as runs converge. Node heights will take calibration points into account, if such points were used in the analysis. Note that Stddev may be unreliable if the partition is not present in all runs (the last column indicates the number of runs that sampled the partition if more than one run is summarized). The PSRF is not calculated at all if the partition is not present in all runs.The PSRF is also sensitive to small sample sizes and it should only be considered a rough guide to convergence since some of the assumptions allowing one to interpret it as a true potential scale reduction factor are violated in MrBayes. List of taxa in bipartitions: 1 -- C1 2 -- C2 3 -- C3 4 -- C4 5 -- C5 6 -- C6 7 -- C7 8 -- C8 9 -- C9 10 -- C10 11 -- C11 Key to taxon bipartitions (saved to file "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"): ID -- Partition ----------------- 1 -- .********** 2 -- .*......... 3 -- ..*........ 4 -- ...*....... 5 -- ....*...... 6 -- .....*..... 7 -- ......*.... 8 -- .......*... 9 -- ........*.. 10 -- .........*. 11 -- ..........* 12 -- ...******** 13 -- ....******* 14 -- .........** 15 -- .....**.... 16 -- ..********* 17 -- .....**.*** 18 -- ........*** 19 -- .....**..** 20 -- ....*..*... 21 -- .....****** 22 -- ....***.*** 23 -- ....****.** 24 -- .....***.** 25 -- .**........ 26 -- .*.******** ----------------- Summary statistics for informative taxon bipartitions (saved to file "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"): ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns ---------------------------------------------------------------- 12 3001 0.999667 0.000471 0.999334 1.000000 2 13 2996 0.998001 0.000000 0.998001 0.998001 2 14 2991 0.996336 0.003298 0.994004 0.998668 2 15 2447 0.815123 0.008009 0.809460 0.820786 2 16 2368 0.788807 0.003769 0.786143 0.791472 2 17 2094 0.697535 0.012248 0.688874 0.706196 2 18 1467 0.488674 0.004240 0.485676 0.491672 2 19 1018 0.339107 0.006595 0.334444 0.343771 2 20 963 0.320786 0.008009 0.315123 0.326449 2 21 837 0.278814 0.006124 0.274484 0.283145 2 22 663 0.220853 0.000471 0.220520 0.221186 2 23 644 0.214524 0.012248 0.205863 0.223185 2 24 343 0.114257 0.004240 0.111259 0.117255 2 25 329 0.109594 0.000471 0.109260 0.109927 2 26 305 0.101599 0.003298 0.099267 0.103931 2 ---------------------------------------------------------------- + Convergence diagnostic (standard deviation of split frequencies) should approach 0.0 as runs converge. Summary statistics for branch and node parameters (saved to file "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"): 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median PSRF+ Nruns ------------------------------------------------------------------------------------------- length{all}[1] 0.015569 0.000035 0.005266 0.026905 0.014756 1.000 2 length{all}[2] 0.003378 0.000006 0.000003 0.008157 0.002788 1.000 2 length{all}[3] 0.001733 0.000003 0.000001 0.005141 0.001220 1.000 2 length{all}[4] 0.004383 0.000009 0.000006 0.010128 0.003744 1.000 2 length{all}[5] 0.025284 0.000076 0.009201 0.042498 0.024174 1.000 2 length{all}[6] 0.016895 0.000043 0.005571 0.030145 0.016040 1.000 2 length{all}[7] 0.006133 0.000015 0.000341 0.013401 0.005327 1.000 2 length{all}[8] 0.070962 0.000326 0.040374 0.108792 0.068866 1.000 2 length{all}[9] 0.144801 0.001345 0.084744 0.221708 0.139437 1.000 2 length{all}[10] 0.007875 0.000020 0.000253 0.016408 0.007186 1.000 2 length{all}[11] 0.014819 0.000037 0.004494 0.027000 0.013976 1.000 2 length{all}[12] 0.009042 0.000018 0.002022 0.017581 0.008365 1.000 2 length{all}[13] 0.028336 0.000127 0.005764 0.049363 0.027601 1.000 2 length{all}[14] 0.022293 0.000092 0.004415 0.040521 0.021309 1.000 2 length{all}[15] 0.006508 0.000022 0.000004 0.015475 0.005520 1.000 2 length{all}[16] 0.003077 0.000006 0.000022 0.007591 0.002522 1.000 2 length{all}[17] 0.010444 0.000031 0.001389 0.020990 0.009572 1.000 2 length{all}[18] 0.010001 0.000050 0.000159 0.023691 0.008653 1.000 2 length{all}[19] 0.008871 0.000039 0.000017 0.020619 0.007780 1.000 2 length{all}[20] 0.004500 0.000015 0.000011 0.011846 0.003494 0.999 2 length{all}[21] 0.005781 0.000027 0.000009 0.015272 0.004475 1.001 2 length{all}[22] 0.005275 0.000026 0.000001 0.015031 0.004019 0.999 2 length{all}[23] 0.014474 0.000082 0.000051 0.030704 0.012806 1.000 2 length{all}[24] 0.006168 0.000028 0.000007 0.016175 0.004733 1.001 2 length{all}[25] 0.001804 0.000003 0.000002 0.004804 0.001359 0.998 2 length{all}[26] 0.001713 0.000004 0.000007 0.005548 0.001152 0.998 2 ------------------------------------------------------------------------------------------- + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when deviation of parameter values within all runs is 0 or when a parameter value (a branch length, for instance) is not sampled in all runs. Summary statistics for partitions with frequency >= 0.10 in at least one run: Average standard deviation of split frequencies = 0.004899 Maximum standard deviation of split frequencies = 0.012248 Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000 Maximum PSRF for parameter values = 1.001 Clade credibility values: /---------------------------------------------------------------------- C1 (1) | |---------------------------------------------------------------------- C2 (2) | + /---------------------------------------------------------- C3 (3) | | | | /----------------------------------------------- C4 (4) \-----79----+ | | | /----------------------------------- C5 (5) | | | \----100---+ | /------------ C6 (6) | | /----82----+ | | | \------------ C7 (7) | | | \----100----+-----70----+----------------------- C9 (9) | | | | /------------ C10 (10) | \----100---+ | \------------ C11 (11) | \----------------------------------- C8 (8) Phylogram (based on average branch lengths): /------ C1 (1) | |- C2 (2) | +/ C3 (3) || || /-- C4 (4) \+ | | | /--------- C5 (5) | | | \--+ | /------ C6 (6) | | /--+ | | | \-- C7 (7) | | | \----------+--+------------------------------------------------------ C9 (9) | | | | /-- C10 (10) | \--------+ | \----- C11 (11) | \-------------------------- C8 (8) |------------------| 0.050 expected changes per site Calculating tree probabilities... Credible sets of trees (259 trees sampled): 50 % credible set contains 8 trees 90 % credible set contains 81 trees 95 % credible set contains 132 trees 99 % credible set contains 229 trees Exiting mrbayes block Reached end of file Tasks completed, exiting program because mode is noninteractive To return control to the command line after completion of file processing, set mode to interactive with 'mb -i <filename>' (i is for interactive) or use 'set mode=interactive' MrBayes output code: 0 CODONML in paml version 4.8, March 2014 ---------------------------------------------- Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT TTC | TCC | TAC | TGC Leu L TTA | TCA | *** * TAA | *** * TGA TTG | TCG | TAG | Trp W TGG ---------------------------------------------- Leu L CTT | Pro P CCT | His H CAT | Arg R CGT CTC | CCC | CAC | CGC CTA | CCA | Gln Q CAA | CGA CTG | CCG | CAG | CGG ---------------------------------------------- Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT ATC | ACC | AAC | AGC ATA | ACA | Lys K AAA | Arg R AGA Met M ATG | ACG | AAG | AGG ---------------------------------------------- Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT GTC | GCC | GAC | GGC GTA | GCA | Glu E GAA | GGA GTG | GCG | GAG | GGG ---------------------------------------------- Nice code, uuh? NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8 seq file is not paml/phylip format. Trying nexus format. ns = 11 ls = 1164 Reading sequences, sequential format.. Reading seq # 1: C1 Reading seq # 2: C2 Reading seq # 3: C3 Reading seq # 4: C4 Reading seq # 5: C5 Reading seq # 6: C6 Reading seq # 7: C7 Reading seq # 8: C8 Reading seq # 9: C9 Reading seq #10: C10 Reading seq #11: C11 Sites with gaps or missing data are removed. 3 ambiguity characters in seq. 1 3 ambiguity characters in seq. 2 3 ambiguity characters in seq. 3 3 ambiguity characters in seq. 4 3 ambiguity characters in seq. 5 3 ambiguity characters in seq. 6 3 ambiguity characters in seq. 7 3 ambiguity characters in seq. 8 6 ambiguity characters in seq. 9 3 ambiguity characters in seq. 10 3 ambiguity characters in seq. 11 2 sites are removed. 46 388 Sequences read.. Counting site patterns.. 0:00 147 patterns at 386 / 386 sites (100.0%), 0:00 Counting codons.. NG distances for seqs.: 1 2 3 4 5 6 7 8 9 10 11 440 bytes for distance 143472 bytes for conP 19992 bytes for fhK 5000000 bytes for space Model 0: one-ratio TREE # 1 (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 502152 bytes for conP, adjusted 0.019445 0.004398 0.001674 0.000929 0.009864 0.005590 0.035025 0.033625 0.006665 0.006270 0.019670 0.009617 0.113525 0.027349 0.012212 0.017079 0.075941 0.300000 1.300000 ntime & nrate & np: 17 2 19 Bounds (np=19): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000 np = 19 lnL0 = -2689.969352 Iterating by ming2 Initial: fx= 2689.969352 x= 0.01945 0.00440 0.00167 0.00093 0.00986 0.00559 0.03502 0.03362 0.00666 0.00627 0.01967 0.00962 0.11352 0.02735 0.01221 0.01708 0.07594 0.30000 1.30000 1 h-m-p 0.0000 0.0000 640.9780 ++ 2689.044128 m 0.0000 24 | 1/19 2 h-m-p 0.0000 0.0000 955.4745 +YYCYC 2687.491226 4 0.0000 52 | 1/19 3 h-m-p 0.0000 0.0000 672.7330 +YYYCCC 2684.588118 5 0.0000 82 | 1/19 4 h-m-p 0.0000 0.0002 1978.0328 +YCCYC 2654.296711 4 0.0001 112 | 1/19 5 h-m-p 0.0000 0.0000 3536.8578 +YYYCC 2649.187552 4 0.0000 140 | 1/19 6 h-m-p 0.0000 0.0001 1670.1067 +YYYYYCCCC 2634.241912 8 0.0001 174 | 1/19 7 h-m-p 0.0000 0.0000 5653.1636 +YYCCCC 2620.452052 5 0.0000 205 | 1/19 8 h-m-p 0.0000 0.0000 2059.8604 +YCYCCC 2613.476086 5 0.0000 236 | 1/19 9 h-m-p 0.0000 0.0001 721.7889 +YYCCCC 2608.624427 5 0.0001 267 | 1/19 10 h-m-p 0.0001 0.0003 720.3647 YCCCC 2599.984999 4 0.0001 296 | 1/19 11 h-m-p 0.0000 0.0001 2499.9596 CYCCC 2593.043908 4 0.0000 325 | 1/19 12 h-m-p 0.0001 0.0005 341.3429 CCC 2590.803453 2 0.0001 351 | 1/19 13 h-m-p 0.0001 0.0003 563.6965 +YYYCCC 2582.229869 5 0.0002 381 | 1/19 14 h-m-p 0.0000 0.0001 11251.9666 +YYYYCC 2551.697840 5 0.0000 410 | 1/19 15 h-m-p 0.0000 0.0000 9507.5253 +YYYYYYCCCC 2522.766115 10 0.0000 446 | 1/19 16 h-m-p 0.0000 0.0000 4185.9817 CYCCCCY 2521.801367 6 0.0000 479 | 1/19 17 h-m-p 0.0000 0.0000 2924.5972 YC 2521.795501 1 0.0000 502 | 1/19 18 h-m-p 0.0002 0.0053 6.4005 CCC 2521.763301 2 0.0003 528 | 1/19 19 h-m-p 0.0005 0.0151 3.9362 ++CYCYYCYYYY 2517.580034 9 0.0096 564 | 1/19 20 h-m-p 0.0124 0.0620 2.3462 +YYCYCC a 0.040449 0.040942 0.041000 0.040952 f 2500.247993 2500.241087 2500.241148 2500.241154 4.044879e-02 2500.247993 4.047636e-02 2500.247308 4.050393e-02 2500.246752 4.053150e-02 2500.246176 4.055907e-02 2500.245853 4.058664e-02 2500.245138 4.061421e-02 2500.244729 4.064178e-02 2500.244235 4.066935e-02 2500.243652 4.069692e-02 2500.243507 4.072449e-02 2500.243150 4.075206e-02 2500.242731 4.077963e-02 2500.242446 4.080720e-02 2500.242237 4.083477e-02 2500.241934 4.086234e-02 2500.241626 4.088991e-02 2500.241486 4.091748e-02 2500.241291 4.094505e-02 2500.241015 4.097262e-02 2500.241079 4.100019e-02 2500.241169 Linesearch2 a4: multiple optima? CYY a 0.040924 0.040942 0.040947 0.040935 f 2500.241206 2500.241087 2500.241239 2500.241233 4.092423e-02 2500.241206 4.092536e-02 2500.241429 4.092648e-02 2500.241121 4.092761e-02 2500.241327 4.092873e-02 2500.241327 4.092986e-02 2500.241322 4.093099e-02 2500.241264 4.093211e-02 2500.241315 4.093324e-02 2500.241268 4.093436e-02 2500.241265 4.093549e-02 2500.241245 4.093661e-02 2500.241379 4.093774e-02 2500.241219 4.093886e-02 2500.241238 4.093999e-02 2500.241272 4.094111e-02 2500.241165 4.094224e-02 2500.241329 4.094336e-02 2500.241207 4.094449e-02 2500.241196 4.094561e-02 2500.241331 4.094674e-02 2500.241142 Linesearch2 a4: multiple optima? C a 0.040935 0.040942 0.040947 0.040941 f 2500.241233 2500.241087 2500.241239 2500.241329 4.093504e-02 2500.241233 4.093562e-02 2500.241198 4.093621e-02 2500.241354 4.093679e-02 2500.241211 4.093738e-02 2500.241242 4.093796e-02 2500.241223 4.093855e-02 2500.241289 4.093913e-02 2500.241139 4.093972e-02 2500.241180 4.094030e-02 2500.241259 4.094089e-02 2500.240949 4.094147e-02 2500.241207 4.094206e-02 2500.241248 4.094264e-02 2500.241230 4.094323e-02 2500.241349 4.094381e-02 2500.241239 4.094440e-02 2500.241089 4.094498e-02 2500.241175 4.094557e-02 2500.241192 4.094615e-02 2500.241169 Linesearch2 a4: multiple optima? 2500.241087 10 0.0409 663 | 1/19 21 h-m-p 0.0229 0.1145 0.4430 +YYYCCC 2488.173071 5 0.0839 693 | 1/19 22 h-m-p 0.0341 0.1707 0.1758 +CYCCCC 2476.163034 5 0.1550 743 | 1/19 23 h-m-p 0.0308 0.1540 0.4162 +YYCCCC 2464.436510 5 0.0992 792 | 1/19 24 h-m-p 0.0802 0.4012 0.1096 +YYYCCC 2458.253853 5 0.2940 840 | 1/19 25 h-m-p 0.1197 0.5984 0.1134 YCCCC 2454.579937 4 0.2118 887 | 1/19 26 h-m-p 0.3879 1.9723 0.0619 YCCC 2444.268113 3 0.9851 932 | 1/19 27 h-m-p 0.3948 1.9741 0.0671 YCCCC 2434.603805 4 0.9326 979 | 1/19 28 h-m-p 0.6712 3.3561 0.0236 +YYYYCC 2419.702888 5 2.6397 1026 | 1/19 29 h-m-p 0.3066 1.5328 0.0614 YCCC 2414.385891 3 0.7249 1071 | 1/19 30 h-m-p 0.6878 3.4391 0.0189 +YCYCCC 2407.587262 5 1.9297 1120 | 1/19 31 h-m-p 1.6000 8.0000 0.0165 YCCC 2402.878759 3 2.9591 1165 | 1/19 32 h-m-p 0.7019 3.5094 0.0240 +YYYCCCC 2397.263304 6 2.8243 1215 | 1/19 33 h-m-p 0.7198 3.5991 0.0159 YCCC 2395.630159 3 1.7098 1260 | 1/19 34 h-m-p 1.0709 5.3547 0.0187 CCCC 2394.378031 3 1.2547 1306 | 1/19 35 h-m-p 0.7941 3.9703 0.0097 YCYCCC 2393.359378 5 1.9734 1354 | 1/19 36 h-m-p 1.6000 8.0000 0.0096 CCCC 2392.313713 3 2.5129 1400 | 1/19 37 h-m-p 1.2581 7.9444 0.0192 CCCC 2391.672158 3 2.0713 1446 | 1/19 38 h-m-p 1.1045 5.5226 0.0145 CC 2391.022218 1 1.5423 1488 | 1/19 39 h-m-p 0.8084 8.0000 0.0277 +CCCC 2389.527196 3 3.5882 1535 | 1/19 40 h-m-p 1.5410 7.7051 0.0426 CCCC 2387.974999 3 1.9814 1581 | 1/19 41 h-m-p 1.5423 7.7117 0.0075 CCCC 2387.258529 3 1.6401 1627 | 1/19 42 h-m-p 1.3367 6.6837 0.0080 CCCC 2387.060868 3 1.5750 1673 | 1/19 43 h-m-p 1.6000 8.0000 0.0021 CC 2387.002783 1 1.9750 1715 | 1/19 44 h-m-p 0.3486 8.0000 0.0121 +CC 2386.962333 1 1.6744 1758 | 1/19 45 h-m-p 1.6000 8.0000 0.0007 CC 2386.940965 1 2.5167 1800 | 1/19 46 h-m-p 1.3503 8.0000 0.0013 YC 2386.923770 1 2.5994 1841 | 1/19 47 h-m-p 1.6000 8.0000 0.0013 YC 2386.912131 1 2.7814 1882 | 1/19 48 h-m-p 1.6000 8.0000 0.0004 C 2386.908287 0 1.6000 1922 | 1/19 49 h-m-p 1.5103 8.0000 0.0004 +CC 2386.904370 1 5.5758 1965 | 1/19 50 h-m-p 1.6000 8.0000 0.0008 +YC 2386.895705 1 4.3277 2007 | 1/19 51 h-m-p 0.9597 8.0000 0.0034 ++ 2386.865616 m 8.0000 2047 | 1/19 52 h-m-p 1.6000 8.0000 0.0079 ++ 2386.693121 m 8.0000 2087 | 1/19 53 h-m-p 1.3451 8.0000 0.0467 YCC 2386.517632 2 2.7815 2130 | 1/19 54 h-m-p 1.6000 8.0000 0.0166 CCC 2386.455430 2 1.7097 2174 | 1/19 55 h-m-p 1.6000 8.0000 0.0028 CC 2386.446188 1 1.9180 2216 | 1/19 56 h-m-p 1.6000 8.0000 0.0029 CC 2386.441191 1 2.4429 2258 | 1/19 57 h-m-p 1.6000 8.0000 0.0003 C 2386.440611 0 1.7195 2298 | 1/19 58 h-m-p 1.6000 8.0000 0.0001 C 2386.440456 0 1.7602 2338 | 1/19 59 h-m-p 1.3788 8.0000 0.0002 Y 2386.440435 0 2.3670 2378 | 1/19 60 h-m-p 1.6000 8.0000 0.0001 C 2386.440429 0 1.7018 2418 | 1/19 61 h-m-p 1.6000 8.0000 0.0001 C 2386.440429 0 1.6000 2458 | 1/19 62 h-m-p 1.6000 8.0000 0.0000 Y 2386.440429 0 1.6000 2498 | 1/19 63 h-m-p 1.6000 8.0000 0.0000 Y 2386.440429 0 2.8428 2538 | 1/19 64 h-m-p 1.6000 8.0000 0.0000 Y 2386.440429 0 1.6000 2578 | 1/19 65 h-m-p 1.6000 8.0000 0.0000 ----Y 2386.440429 0 0.0016 2622 Out.. lnL = -2386.440429 2623 lfun, 2623 eigenQcodon, 44591 P(t) Time used: 0:15 Model 1: NearlyNeutral TREE # 1 (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 0.019445 0.004398 0.001674 0.000929 0.009864 0.005590 0.035025 0.033625 0.006665 0.006270 0.019670 0.009617 0.113525 0.027349 0.012212 0.017079 0.075941 1.914323 0.718247 0.265678 ntime & nrate & np: 17 2 20 Bounds (np=20): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000 Qfactor_NS = 8.069271 np = 20 lnL0 = -2481.108471 Iterating by ming2 Initial: fx= 2481.108471 x= 0.01945 0.00440 0.00167 0.00093 0.00986 0.00559 0.03502 0.03362 0.00666 0.00627 0.01967 0.00962 0.11352 0.02735 0.01221 0.01708 0.07594 1.91432 0.71825 0.26568 1 h-m-p 0.0000 0.0000 628.3381 ++ 2480.167008 m 0.0000 25 | 1/20 2 h-m-p 0.0000 0.0000 760.6977 +YYCYC 2478.842528 4 0.0000 54 | 1/20 3 h-m-p 0.0000 0.0000 501.4317 +YYYCCC 2475.933113 5 0.0000 85 | 1/20 4 h-m-p 0.0000 0.0001 1822.7034 ++ 2462.481717 m 0.0001 108 | 1/20 5 h-m-p 0.0000 0.0000 30866.4049 ++ 2440.278092 m 0.0000 131 | 1/20 6 h-m-p 0.0000 0.0000 70076.7681 +YCYCCC 2430.665235 5 0.0000 163 | 1/20 7 h-m-p 0.0000 0.0000 460.2772 +YYCC 2430.355287 3 0.0000 191 | 1/20 8 h-m-p 0.0000 0.0001 119.7500 ++ 2429.686072 m 0.0001 214 | 1/20 9 h-m-p 0.0000 0.0000 182.2499 h-m-p: 2.99483900e-22 1.49741950e-21 1.82249932e+02 2429.686072 .. | 1/20 10 h-m-p 0.0000 0.0000 11190.1681 YCYYCCC 2415.559160 6 0.0000 266 | 1/20 11 h-m-p 0.0000 0.0000 617.2965 ++ 2409.067816 m 0.0000 289 | 1/20 12 h-m-p 0.0000 0.0000 3760.4258 +YCYYCC 2396.078995 5 0.0000 321 | 1/20 13 h-m-p 0.0000 0.0000 1288.8740 +YCCCC 2391.204332 4 0.0000 352 | 1/20 14 h-m-p 0.0000 0.0000 2221.3928 ++ 2390.329259 m 0.0000 375 | 2/20 15 h-m-p 0.0000 0.0000 1617.8455 +YYYCCC 2378.552885 5 0.0000 406 | 2/20 16 h-m-p 0.0000 0.0001 846.2278 CCCC 2375.515504 3 0.0000 435 | 2/20 17 h-m-p 0.0000 0.0001 412.1339 YCYCCC 2372.380616 5 0.0001 466 | 2/20 18 h-m-p 0.0001 0.0003 231.1915 CCCC 2370.974823 3 0.0001 495 | 2/20 19 h-m-p 0.0000 0.0001 311.4066 YCCCC 2370.128957 4 0.0000 525 | 2/20 20 h-m-p 0.0001 0.0016 110.0261 YCCC 2369.334716 3 0.0002 553 | 1/20 21 h-m-p 0.0001 0.0008 237.9035 YCCC 2369.219690 3 0.0000 581 | 1/20 22 h-m-p 0.0000 0.0001 131.0883 +CC 2368.930566 1 0.0001 607 | 1/20 23 h-m-p 0.0001 0.0004 43.5203 CCC 2368.872594 2 0.0001 634 | 1/20 24 h-m-p 0.0002 0.0042 23.7685 CC 2368.845192 1 0.0001 659 | 1/20 25 h-m-p 0.0005 0.0072 6.4221 YC 2368.843403 1 0.0001 683 | 1/20 26 h-m-p 0.0004 0.0311 1.3287 YC 2368.842677 1 0.0002 707 | 1/20 27 h-m-p 0.0001 0.0296 2.0602 +CC 2368.833866 1 0.0008 733 | 1/20 28 h-m-p 0.0001 0.0211 12.0673 +++CYCCC 2367.414434 4 0.0120 766 | 1/20 29 h-m-p 0.0001 0.0005 365.7605 YYC 2367.150815 2 0.0001 791 | 1/20 30 h-m-p 0.0175 0.2780 1.7617 +CC 2366.874111 1 0.1089 817 | 1/20 31 h-m-p 0.1577 0.7883 0.0255 ++ 2366.462782 m 0.7883 840 | 2/20 32 h-m-p 0.3535 4.8995 0.0569 YCCC 2366.262391 3 0.7737 887 | 1/20 33 h-m-p 0.0001 0.0006 421.9625 -YC 2366.261797 1 0.0000 930 | 1/20 34 h-m-p 0.0185 0.2937 0.1101 ++ 2366.165406 m 0.2937 953 | 2/20 35 h-m-p 0.8843 8.0000 0.0366 CCC 2366.098145 2 1.0897 999 | 1/20 36 h-m-p 0.0001 0.0006 796.1771 -YC 2366.098034 1 0.0000 1042 | 1/20 37 h-m-p 1.4656 8.0000 0.0011 YCC 2366.080580 2 0.9652 1068 | 1/20 38 h-m-p 0.0150 0.0750 0.0342 ++ 2366.079870 m 0.0750 1110 | 2/20 39 h-m-p 0.1290 8.0000 0.0199 +YC 2366.070908 1 1.2210 1154 | 2/20 40 h-m-p 1.6000 8.0000 0.0063 CY 2366.062705 1 1.4790 1197 | 1/20 41 h-m-p 0.0006 0.0082 16.4963 --C 2366.062650 0 0.0000 1240 | 1/20 42 h-m-p 0.0346 3.2661 0.0057 ++++ 2366.042534 m 3.2661 1265 | 2/20 43 h-m-p 1.6000 8.0000 0.0067 YC 2366.025979 1 1.2406 1308 | 2/20 44 h-m-p 1.6000 8.0000 0.0042 C 2366.017699 0 1.6000 1349 | 1/20 45 h-m-p 0.0007 0.0163 10.2034 --C 2366.017682 0 0.0000 1392 | 1/20 46 h-m-p 0.0576 0.5254 0.0025 ++ 2366.016644 m 0.5254 1415 | 2/20 47 h-m-p 0.8756 8.0000 0.0015 C 2366.016157 0 0.9227 1457 | 2/20 48 h-m-p 1.6000 8.0000 0.0001 Y 2366.016142 0 0.7296 1498 | 2/20 49 h-m-p 1.6000 8.0000 0.0000 Y 2366.016141 0 1.1479 1539 | 2/20 50 h-m-p 1.6000 8.0000 0.0000 Y 2366.016141 0 0.7452 1580 | 2/20 51 h-m-p 1.6000 8.0000 0.0000 Y 2366.016141 0 0.8722 1621 | 2/20 52 h-m-p 0.7379 8.0000 0.0000 Y 2366.016141 0 1.8379 1662 | 2/20 53 h-m-p 1.6000 8.0000 0.0000 -C 2366.016141 0 0.1000 1704 | 2/20 54 h-m-p 0.0338 8.0000 0.0000 --------------.. | 2/20 55 h-m-p 0.0051 2.5571 0.0032 --Y 2366.016141 0 0.0001 1800 | 2/20 56 h-m-p 0.0160 8.0000 0.0027 ------Y 2366.016141 0 0.0000 1847 | 2/20 57 h-m-p 0.0160 8.0000 0.0011 --Y 2366.016141 0 0.0005 1890 | 2/20 58 h-m-p 0.0160 8.0000 0.0006 -----Y 2366.016141 0 0.0000 1936 Out.. lnL = -2366.016141 1937 lfun, 5811 eigenQcodon, 65858 P(t) Time used: 0:35 Model 2: PositiveSelection TREE # 1 (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 initial w for M2:NSpselection reset. 0.019445 0.004398 0.001674 0.000929 0.009864 0.005590 0.035025 0.033625 0.006665 0.006270 0.019670 0.009617 0.113525 0.027349 0.012212 0.017079 0.075941 1.914636 1.659473 0.574115 0.238709 2.403915 ntime & nrate & np: 17 3 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000 Qfactor_NS = 6.429817 np = 22 lnL0 = -2503.048600 Iterating by ming2 Initial: fx= 2503.048600 x= 0.01945 0.00440 0.00167 0.00093 0.00986 0.00559 0.03502 0.03362 0.00666 0.00627 0.01967 0.00962 0.11352 0.02735 0.01221 0.01708 0.07594 1.91464 1.65947 0.57412 0.23871 2.40392 1 h-m-p 0.0000 0.0000 654.4316 ++ 2501.950136 m 0.0000 27 | 1/22 2 h-m-p 0.0000 0.0000 743.1955 +YYCYC 2500.497069 4 0.0000 58 | 1/22 3 h-m-p 0.0000 0.0001 447.0306 +YYYYC 2497.159316 4 0.0001 88 | 1/22 4 h-m-p 0.0000 0.0001 1064.7520 YCCC 2493.746436 3 0.0000 118 | 1/22 5 h-m-p 0.0000 0.0001 702.3352 +YYYCCC 2489.426895 5 0.0001 151 | 1/22 6 h-m-p 0.0000 0.0000 4586.5024 +YYYCCC 2483.127509 5 0.0000 184 | 1/22 7 h-m-p 0.0000 0.0000 5676.3759 ++ 2456.912592 m 0.0000 209 | 2/22 8 h-m-p 0.0000 0.0000 713.1809 CCC 2456.712581 2 0.0000 238 | 2/22 9 h-m-p 0.0001 0.0008 193.3622 +YCCCCC 2454.843439 5 0.0003 273 | 2/22 10 h-m-p 0.0000 0.0002 349.8823 +YCYCC 2452.010195 4 0.0001 305 | 2/22 11 h-m-p 0.0000 0.0002 872.6903 CCCC 2450.926553 3 0.0000 336 | 2/22 12 h-m-p 0.0001 0.0005 293.9263 CCCC 2448.590800 3 0.0001 367 | 2/22 13 h-m-p 0.0002 0.0009 223.7889 YCCCC 2442.920815 4 0.0004 399 | 2/22 14 h-m-p 0.0001 0.0003 713.2122 +YCYCCC 2437.100514 5 0.0001 433 | 2/22 15 h-m-p 0.0001 0.0003 921.9522 YCCCCC 2432.842334 5 0.0001 467 | 2/22 16 h-m-p 0.0001 0.0010 725.1491 +YYCYCCC 2417.230793 6 0.0006 502 | 2/22 17 h-m-p 0.0000 0.0002 3628.6932 YCCCC 2406.990915 4 0.0001 534 | 2/22 18 h-m-p 0.0006 0.0030 57.1374 CC 2406.627286 1 0.0006 561 | 2/22 19 h-m-p 0.0027 0.2835 12.1149 +++YCCCC 2390.659766 4 0.1270 596 | 2/22 20 h-m-p 0.0271 0.1353 1.1642 +YCYYYCC 2384.015139 6 0.1207 630 | 2/22 21 h-m-p 0.0219 0.6047 6.4168 +YCCC 2375.519104 3 0.1485 661 | 2/22 22 h-m-p 0.1609 0.8044 3.1467 CYCCCC 2373.418770 5 0.2256 695 | 2/22 23 h-m-p 0.1524 0.7619 1.2184 +CYC 2370.085649 2 0.5704 724 | 2/22 24 h-m-p 0.4359 2.1796 0.3261 YCCC 2368.800290 3 0.7927 754 | 2/22 25 h-m-p 0.3986 3.2169 0.6484 YCCC 2367.769057 3 0.7876 804 | 1/22 26 h-m-p 0.0001 0.0005 3247.0902 -YCCC 2367.715423 3 0.0000 855 | 1/22 27 h-m-p 0.0864 2.9771 0.4024 ++YYCC 2366.548278 3 1.1519 886 | 1/22 28 h-m-p 1.2582 6.2909 0.2357 YYCC 2366.002436 3 0.9412 936 | 1/22 29 h-m-p 1.1130 8.0000 0.1994 CCC 2365.688223 2 1.6202 986 | 1/22 30 h-m-p 1.6000 8.0000 0.1152 YCCC 2365.494033 3 1.0902 1037 | 1/22 31 h-m-p 0.8669 8.0000 0.1449 CYC 2365.400166 2 0.8357 1086 | 1/22 32 h-m-p 0.9879 8.0000 0.1225 CC 2365.338972 1 1.5422 1134 | 1/22 33 h-m-p 1.1824 8.0000 0.1598 +YCCC 2365.236327 3 3.2843 1186 | 1/22 34 h-m-p 1.6000 8.0000 0.3098 YYC 2365.176897 2 1.3176 1234 | 1/22 35 h-m-p 1.6000 8.0000 0.0545 CC 2365.134985 1 1.3543 1282 | 1/22 36 h-m-p 0.4162 8.0000 0.1772 +YC 2365.079205 1 3.0518 1330 | 1/22 37 h-m-p 1.6000 8.0000 0.0814 CYC 2365.042749 2 1.7037 1379 | 1/22 38 h-m-p 0.5986 8.0000 0.2318 +CYC 2365.012483 2 2.2339 1429 | 1/22 39 h-m-p 1.6000 8.0000 0.0882 CC 2364.992348 1 2.2503 1477 | 1/22 40 h-m-p 1.4890 8.0000 0.1333 YC 2364.974962 1 2.5608 1524 | 1/22 41 h-m-p 1.6000 8.0000 0.0251 CC 2364.958658 1 2.3181 1572 | 1/22 42 h-m-p 0.4289 8.0000 0.1354 +CC 2364.949182 1 1.8132 1621 | 1/22 43 h-m-p 1.6000 8.0000 0.0896 YC 2364.939187 1 3.2356 1668 | 1/22 44 h-m-p 1.6000 8.0000 0.1708 YC 2364.925186 1 3.6697 1715 | 1/22 45 h-m-p 1.6000 8.0000 0.2100 YC 2364.913499 1 2.6888 1762 | 1/22 46 h-m-p 1.6000 8.0000 0.1541 YC 2364.904526 1 2.5606 1809 | 1/22 47 h-m-p 1.5871 8.0000 0.2486 C 2364.900429 0 1.5548 1855 | 1/22 48 h-m-p 1.6000 8.0000 0.0611 C 2364.898820 0 1.5053 1901 | 1/22 49 h-m-p 0.6776 8.0000 0.1357 +C 2364.897710 0 3.0457 1948 | 1/22 50 h-m-p 1.6000 8.0000 0.1643 YC 2364.896890 1 2.7283 1995 | 1/22 51 h-m-p 1.6000 8.0000 0.1788 +YC 2364.896006 1 4.2661 2043 | 1/22 52 h-m-p 1.6000 8.0000 0.2356 YC 2364.895358 1 2.8101 2090 | 1/22 53 h-m-p 1.6000 8.0000 0.2621 YC 2364.894986 1 2.8279 2137 | 1/22 54 h-m-p 1.6000 8.0000 0.2399 C 2364.894847 0 2.3038 2183 | 1/22 55 h-m-p 1.6000 8.0000 0.1899 Y 2364.894803 0 2.6054 2229 | 1/22 56 h-m-p 1.6000 8.0000 0.2603 Y 2364.894758 0 3.6896 2275 | 1/22 57 h-m-p 1.6000 8.0000 0.3422 C 2364.894741 0 2.1654 2321 | 1/22 58 h-m-p 1.6000 8.0000 0.3475 Y 2364.894733 0 2.7580 2367 | 1/22 59 h-m-p 1.6000 8.0000 0.3294 C 2364.894730 0 2.3179 2413 | 1/22 60 h-m-p 1.6000 8.0000 0.3538 Y 2364.894728 0 2.9240 2459 | 1/22 61 h-m-p 1.6000 8.0000 0.3223 C 2364.894728 0 2.0909 2505 | 1/22 62 h-m-p 1.6000 8.0000 0.3603 Y 2364.894728 0 3.4841 2551 | 1/22 63 h-m-p 1.6000 8.0000 0.3126 C 2364.894728 0 1.8714 2597 | 1/22 64 h-m-p 1.6000 8.0000 0.2251 Y 2364.894727 0 2.7672 2643 | 1/22 65 h-m-p 0.6256 8.0000 0.9958 Y 2364.894727 0 1.4694 2689 | 1/22 66 h-m-p 1.6000 8.0000 0.1286 C 2364.894727 0 1.4478 2735 | 1/22 67 h-m-p 0.1950 8.0000 0.9551 Y 2364.894727 0 0.1950 2781 | 1/22 68 h-m-p 1.6000 8.0000 0.0711 ----------------.. | 1/22 69 h-m-p 0.0160 8.0000 0.0027 ------------- | 1/22 70 h-m-p 0.0160 8.0000 0.0027 ------------- Out.. lnL = -2364.894727 2956 lfun, 11824 eigenQcodon, 150756 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 21 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2398.325567 S = -2349.282546 -40.691895 Calculating f(w|X), posterior probabilities of site classes. did 10 / 147 patterns 1:22 did 20 / 147 patterns 1:22 did 30 / 147 patterns 1:22 did 40 / 147 patterns 1:22 did 50 / 147 patterns 1:22 did 60 / 147 patterns 1:22 did 70 / 147 patterns 1:22 did 80 / 147 patterns 1:22 did 90 / 147 patterns 1:23 did 100 / 147 patterns 1:23 did 110 / 147 patterns 1:23 did 120 / 147 patterns 1:23 did 130 / 147 patterns 1:23 did 140 / 147 patterns 1:23 did 147 / 147 patterns 1:23 Time used: 1:23 Model 3: discrete TREE # 1 (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 0.019445 0.004398 0.001674 0.000929 0.009864 0.005590 0.035025 0.033625 0.006665 0.006270 0.019670 0.009617 0.113525 0.027349 0.012212 0.017079 0.075941 1.934913 0.339697 0.499728 0.013781 0.028975 0.056384 ntime & nrate & np: 17 4 23 Bounds (np=23): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000 Qfactor_NS = 17.913158 np = 23 lnL0 = -2388.732475 Iterating by ming2 Initial: fx= 2388.732475 x= 0.01945 0.00440 0.00167 0.00093 0.00986 0.00559 0.03502 0.03362 0.00666 0.00627 0.01967 0.00962 0.11352 0.02735 0.01221 0.01708 0.07594 1.93491 0.33970 0.49973 0.01378 0.02898 0.05638 1 h-m-p 0.0000 0.0000 603.4188 ++ 2387.880397 m 0.0000 51 | 1/23 2 h-m-p 0.0000 0.0000 628.2084 +YCYCC 2386.982508 4 0.0000 107 | 1/23 3 h-m-p 0.0000 0.0001 325.6578 +YCYCCC 2385.618185 5 0.0000 164 | 1/23 4 h-m-p 0.0000 0.0000 754.3661 ++ 2383.911593 m 0.0000 212 | 2/23 5 h-m-p 0.0000 0.0001 508.2007 ++ 2380.250588 m 0.0001 260 | 3/23 6 h-m-p 0.0000 0.0001 291.5244 CCCC 2379.877172 3 0.0000 313 | 3/23 7 h-m-p 0.0001 0.0003 141.5007 YCCC 2379.765303 3 0.0000 364 | 3/23 8 h-m-p 0.0001 0.0006 75.3565 YC 2379.608134 1 0.0001 411 | 3/23 9 h-m-p 0.0000 0.0002 117.8264 YYC 2379.509975 2 0.0000 459 | 3/23 10 h-m-p 0.0001 0.0019 42.2675 YC 2379.291871 1 0.0002 506 | 3/23 11 h-m-p 0.0000 0.0002 155.9705 CCCC 2379.064945 3 0.0001 558 | 3/23 12 h-m-p 0.0001 0.0008 89.5565 CYC 2378.855160 2 0.0001 607 | 3/23 13 h-m-p 0.0001 0.0005 52.4746 YCC 2378.771034 2 0.0001 656 | 3/23 14 h-m-p 0.0001 0.0024 26.8034 CC 2378.710131 1 0.0002 704 | 3/23 15 h-m-p 0.0003 0.0029 16.6168 CC 2378.697449 1 0.0001 752 | 3/23 16 h-m-p 0.0002 0.0129 7.1314 CC 2378.691304 1 0.0002 800 | 3/23 17 h-m-p 0.0001 0.0251 11.1634 ++YC 2378.618343 1 0.0015 849 | 3/23 18 h-m-p 0.0006 0.0134 29.8691 YC 2378.461495 1 0.0013 896 | 3/23 19 h-m-p 0.0022 0.0109 10.8635 -YC 2378.455563 1 0.0002 944 | 3/23 20 h-m-p 0.0020 1.0211 9.7858 +++YCCC 2373.455525 3 0.2311 998 | 3/23 21 h-m-p 0.9894 4.9472 0.7655 YCCC 2372.652736 3 0.6343 1049 | 3/23 22 h-m-p 0.7028 3.8218 0.6909 YYCC 2371.984802 3 0.4985 1099 | 3/23 23 h-m-p 0.1641 2.6745 2.0991 YCCC 2371.201832 3 0.2462 1150 | 3/23 24 h-m-p 1.0038 5.0190 0.0666 +YCCCC 2369.211055 4 3.0212 1204 | 3/23 25 h-m-p 0.2707 8.0000 0.7433 +YCCC 2368.282065 3 0.6935 1256 | 3/23 26 h-m-p 1.6000 8.0000 0.2808 CCCC 2367.089305 3 2.2202 1308 | 2/23 27 h-m-p 0.0322 0.2739 19.3675 ----C 2367.089269 0 0.0000 1358 | 2/23 28 h-m-p 0.0007 0.2408 0.7960 +++++ 2366.742061 m 0.2408 1408 | 3/23 29 h-m-p 0.6234 5.6594 0.3075 YC 2365.945953 1 1.4148 1456 | 2/23 30 h-m-p 0.0000 0.0002 7007.5033 CC 2365.906877 1 0.0000 1504 | 2/23 31 h-m-p 0.3281 8.0000 0.2536 +YCCC 2365.401562 3 2.6500 1557 | 2/23 32 h-m-p 1.6000 8.0000 0.2668 CCC 2365.149979 2 1.4144 1608 | 2/23 33 h-m-p 1.1846 5.9228 0.0809 CCC 2365.031969 2 1.5080 1659 | 1/23 34 h-m-p 0.0830 0.4151 1.0946 C 2365.027650 0 0.0203 1706 | 1/23 35 h-m-p 0.0471 3.5875 0.4707 ++CC 2364.947643 1 0.7487 1758 | 1/23 36 h-m-p 1.6000 8.0000 0.1057 C 2364.908096 0 1.5655 1806 | 1/23 37 h-m-p 1.2094 6.0469 0.0455 YC 2364.897831 1 2.0788 1855 | 1/23 38 h-m-p 1.6000 8.0000 0.0200 C 2364.895592 0 1.5790 1903 | 1/23 39 h-m-p 1.0036 5.0181 0.0166 CC 2364.894804 1 1.2859 1953 | 1/23 40 h-m-p 1.6000 8.0000 0.0036 Y 2364.894733 0 1.2139 2001 | 1/23 41 h-m-p 1.6000 8.0000 0.0003 C 2364.894729 0 1.4838 2049 | 1/23 42 h-m-p 1.6000 8.0000 0.0001 C 2364.894728 0 2.4386 2097 | 1/23 43 h-m-p 1.6000 8.0000 0.0001 C 2364.894728 0 2.0732 2145 | 1/23 44 h-m-p 1.6000 8.0000 0.0001 C 2364.894727 0 1.6205 2193 | 1/23 45 h-m-p 1.6000 8.0000 0.0000 Y 2364.894727 0 1.2617 2241 | 1/23 46 h-m-p 1.6000 8.0000 0.0000 Y 2364.894727 0 3.5731 2289 | 1/23 47 h-m-p 1.4266 8.0000 0.0000 ---C 2364.894727 0 0.0056 2340 | 1/23 48 h-m-p 0.0160 8.0000 0.0000 -------------.. | 1/23 49 h-m-p 0.0021 1.0583 0.0137 ------------ Out.. lnL = -2364.894727 2458 lfun, 9832 eigenQcodon, 125358 P(t) Time used: 2:00 Model 7: beta TREE # 1 (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 0.019445 0.004398 0.001674 0.000929 0.009864 0.005590 0.035025 0.033625 0.006665 0.006270 0.019670 0.009617 0.113525 0.027349 0.012212 0.017079 0.075941 1.934911 0.309823 1.349954 ntime & nrate & np: 17 1 20 Bounds (np=20): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 Qfactor_NS = 12.543492 np = 20 lnL0 = -2415.816441 Iterating by ming2 Initial: fx= 2415.816441 x= 0.01945 0.00440 0.00167 0.00093 0.00986 0.00559 0.03502 0.03362 0.00666 0.00627 0.01967 0.00962 0.11352 0.02735 0.01221 0.01708 0.07594 1.93491 0.30982 1.34995 1 h-m-p 0.0000 0.0000 619.8081 ++ 2414.887006 m 0.0000 45 | 1/20 2 h-m-p 0.0000 0.0000 664.3711 +YYCCCC 2413.806872 5 0.0000 97 | 1/20 3 h-m-p 0.0000 0.0001 362.6845 +YYCCCC 2411.950945 5 0.0000 148 | 1/20 4 h-m-p 0.0000 0.0001 827.5354 +YYCC 2408.378566 3 0.0001 195 | 1/20 5 h-m-p 0.0000 0.0002 603.8517 +YYCCC 2402.862693 4 0.0001 244 | 1/20 6 h-m-p 0.0000 0.0000 2987.3130 +YCYCCC 2396.690342 5 0.0000 295 | 1/20 7 h-m-p 0.0000 0.0000 6574.4853 +YCCCC 2391.818383 4 0.0000 345 | 1/20 8 h-m-p 0.0000 0.0000 1953.3593 CYCCCC 2389.124129 5 0.0000 396 | 1/20 9 h-m-p 0.0000 0.0001 151.0577 CCCC 2388.918133 3 0.0000 444 | 1/20 10 h-m-p 0.0001 0.0004 72.5651 CC 2388.756301 1 0.0001 488 | 1/20 11 h-m-p 0.0001 0.0006 52.4258 CCCC 2388.649840 3 0.0001 536 | 1/20 12 h-m-p 0.0000 0.0009 175.1427 YCC 2388.462375 2 0.0001 581 | 1/20 13 h-m-p 0.0001 0.0005 130.1668 YC 2388.367288 1 0.0001 624 | 1/20 14 h-m-p 0.0001 0.0021 48.1351 YC 2388.315655 1 0.0001 667 | 1/20 15 h-m-p 0.0001 0.0020 60.1098 +YC 2388.197498 1 0.0002 711 | 1/20 16 h-m-p 0.0002 0.0043 81.5263 +YYC 2387.814148 2 0.0006 756 | 1/20 17 h-m-p 0.0003 0.0135 142.9240 ++CYCCCC 2379.807221 5 0.0065 809 | 1/20 18 h-m-p 0.0002 0.0009 738.0994 CCC 2378.799126 2 0.0002 855 | 1/20 19 h-m-p 0.0400 0.2000 1.3250 +YYCCCC 2377.963867 5 0.1236 906 | 1/20 20 h-m-p 0.1376 1.6626 1.1904 YCCC 2376.627963 3 0.2699 953 | 1/20 21 h-m-p 0.0961 0.4804 1.7446 YCCC 2375.408674 3 0.1754 1000 | 1/20 22 h-m-p 0.9546 4.7732 0.1435 YCYC 2374.932017 3 0.6333 1046 | 1/20 23 h-m-p 0.8172 8.0000 0.1112 YC 2374.741117 1 1.4871 1089 | 1/20 24 h-m-p 1.0860 6.8172 0.1522 YCCC 2374.423815 3 2.0604 1136 | 1/20 25 h-m-p 1.1099 7.1040 0.2826 +YYYYYYC 2373.370520 6 4.3959 1185 | 1/20 26 h-m-p 0.0755 0.3777 2.0149 YYCCCCC 2373.249807 6 0.0873 1237 | 1/20 27 h-m-p 0.1832 0.9159 0.5524 +YYCYCC 2372.595841 5 0.5914 1287 | 1/20 28 h-m-p 0.0599 0.2997 0.2614 YYYC 2372.422074 3 0.0523 1332 | 1/20 29 h-m-p 0.0907 2.2548 0.1508 +YCCC 2372.073383 3 0.6234 1380 | 1/20 30 h-m-p 1.2113 6.0565 0.0416 CYCCC 2371.881267 4 1.7610 1429 | 1/20 31 h-m-p 1.6000 8.0000 0.0071 CC 2371.829105 1 1.3427 1473 | 1/20 32 h-m-p 0.5191 8.0000 0.0183 +YC 2371.813507 1 1.4879 1517 | 1/20 33 h-m-p 1.6000 8.0000 0.0056 YC 2371.807051 1 1.1567 1560 | 1/20 34 h-m-p 0.4884 8.0000 0.0132 YC 2371.805854 1 0.9911 1603 | 1/20 35 h-m-p 1.6000 8.0000 0.0047 C 2371.805391 0 1.6000 1645 | 1/20 36 h-m-p 1.1134 8.0000 0.0068 YC 2371.804929 1 1.9803 1688 | 1/20 37 h-m-p 1.6000 8.0000 0.0026 C 2371.804709 0 1.4969 1730 | 1/20 38 h-m-p 1.6000 8.0000 0.0023 YC 2371.804566 1 2.9964 1773 | 1/20 39 h-m-p 1.6000 8.0000 0.0018 C 2371.804554 0 0.5362 1815 | 1/20 40 h-m-p 1.2777 8.0000 0.0008 Y 2371.804553 0 0.2544 1857 | 1/20 41 h-m-p 0.3670 8.0000 0.0005 Y 2371.804553 0 0.2921 1899 | 1/20 42 h-m-p 0.3536 8.0000 0.0004 Y 2371.804552 0 0.1586 1941 | 1/20 43 h-m-p 0.1760 8.0000 0.0004 C 2371.804552 0 0.2403 1983 | 1/20 44 h-m-p 0.2727 8.0000 0.0003 Y 2371.804552 0 0.2118 2025 | 1/20 45 h-m-p 0.2533 8.0000 0.0003 C 2371.804552 0 0.3065 2067 | 1/20 46 h-m-p 0.3908 8.0000 0.0002 C 2371.804551 0 0.3248 2109 | 1/20 47 h-m-p 0.4855 8.0000 0.0002 C 2371.804551 0 0.4855 2151 | 1/20 48 h-m-p 1.2273 8.0000 0.0001 Y 2371.804550 0 0.8581 2193 | 1/20 49 h-m-p 1.4433 8.0000 0.0000 Y 2371.804546 0 3.0575 2235 | 1/20 50 h-m-p 1.6000 8.0000 0.0000 C 2371.804544 0 1.9457 2277 | 1/20 51 h-m-p 1.6000 8.0000 0.0000 C 2371.804542 0 2.2631 2319 | 1/20 52 h-m-p 1.6000 8.0000 0.0000 Y 2371.804542 0 0.7069 2361 | 1/20 53 h-m-p 0.7959 8.0000 0.0000 +C 2371.804541 0 2.7762 2404 | 1/20 54 h-m-p 1.6000 8.0000 0.0000 -Y 2371.804541 0 0.1923 2447 | 1/20 55 h-m-p 0.2601 8.0000 0.0000 Y 2371.804541 0 0.1047 2489 | 1/20 56 h-m-p 0.0590 8.0000 0.0000 --C 2371.804541 0 0.0009 2533 Out.. lnL = -2371.804541 2534 lfun, 27874 eigenQcodon, 430780 P(t) Time used: 4:12 Model 8: beta&w>1 TREE # 1 (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 initial w for M8:NSbetaw>1 reset. 0.019445 0.004398 0.001674 0.000929 0.009864 0.005590 0.035025 0.033625 0.006665 0.006270 0.019670 0.009617 0.113525 0.027349 0.012212 0.017079 0.075941 1.924184 0.900000 0.966220 1.075304 2.140227 ntime & nrate & np: 17 2 22 Bounds (np=22): 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000 Qfactor_NS = 6.657870 np = 22 lnL0 = -2502.705685 Iterating by ming2 Initial: fx= 2502.705685 x= 0.01945 0.00440 0.00167 0.00093 0.00986 0.00559 0.03502 0.03362 0.00666 0.00627 0.01967 0.00962 0.11352 0.02735 0.01221 0.01708 0.07594 1.92418 0.90000 0.96622 1.07530 2.14023 1 h-m-p 0.0000 0.0000 650.2848 ++ 2501.659399 m 0.0000 49 | 1/22 2 h-m-p 0.0000 0.0000 816.8888 +YYCYC 2500.069506 4 0.0000 102 | 1/22 3 h-m-p 0.0000 0.0001 558.8365 +YYYCCC 2496.091196 5 0.0000 156 | 1/22 4 h-m-p 0.0000 0.0000 2007.7079 +YCCCC 2489.441960 4 0.0000 210 | 1/22 5 h-m-p 0.0000 0.0000 888.6341 ++ 2484.563696 m 0.0000 256 | 2/22 6 h-m-p 0.0000 0.0000 783.5814 CCC 2483.859588 2 0.0000 306 | 2/22 7 h-m-p 0.0000 0.0002 458.2525 +YYYC 2481.240152 3 0.0001 355 | 2/22 8 h-m-p 0.0000 0.0001 572.4535 YCYCCC 2479.730614 5 0.0000 408 | 2/22 9 h-m-p 0.0001 0.0005 353.5960 YCCC 2477.622006 3 0.0001 458 | 2/22 10 h-m-p 0.0000 0.0002 628.9327 YCCCC 2474.749722 4 0.0001 510 | 2/22 11 h-m-p 0.0001 0.0004 605.8466 YCYCCC 2469.024184 5 0.0002 563 | 2/22 12 h-m-p 0.0000 0.0001 2514.0963 +YYCCCC 2459.008066 5 0.0001 617 | 2/22 13 h-m-p 0.0000 0.0001 3162.8939 +YYCCC 2451.840608 4 0.0000 669 | 2/22 14 h-m-p 0.0000 0.0000 2659.8499 +YYYYCC 2448.040267 5 0.0000 721 | 2/22 15 h-m-p 0.0000 0.0001 584.5475 CCCCC 2447.276251 4 0.0000 774 | 2/22 16 h-m-p 0.0000 0.0002 813.2263 +YCCC 2445.264699 3 0.0001 825 | 2/22 17 h-m-p 0.0000 0.0001 1806.6098 ++ 2435.314794 m 0.0001 870 | 2/22 18 h-m-p -0.0000 -0.0000 6357.9408 h-m-p: -5.07302657e-22 -2.53651329e-21 6.35794083e+03 2435.314794 .. | 2/22 19 h-m-p 0.0000 0.0000 31646.8437 -YYCYYYCC 2424.046883 7 0.0000 967 | 2/22 20 h-m-p 0.0000 0.0000 1504.1795 +CYC 2400.806140 2 0.0000 1016 | 2/22 21 h-m-p 0.0000 0.0001 476.1015 +YYCYCCC 2392.205928 6 0.0001 1071 | 2/22 22 h-m-p 0.0000 0.0000 779.3567 +YCYCC 2391.503462 4 0.0000 1123 | 2/22 23 h-m-p 0.0000 0.0000 634.2349 YCYCCC 2390.182195 5 0.0000 1176 | 2/22 24 h-m-p 0.0000 0.0001 296.7170 +YYYCCC 2388.279097 5 0.0001 1229 | 2/22 25 h-m-p 0.0000 0.0000 2949.2749 CCCC 2386.512059 3 0.0000 1280 | 2/22 26 h-m-p 0.0000 0.0002 745.4090 +YYYCCC 2378.800455 5 0.0001 1333 | 1/22 27 h-m-p 0.0000 0.0000 5500.8291 +YYCYCCC 2373.818959 6 0.0000 1388 | 1/22 28 h-m-p 0.0000 0.0000 1202.5588 CCCCC 2373.192529 4 0.0000 1442 | 1/22 29 h-m-p 0.0001 0.0006 50.8353 CC 2373.149299 1 0.0000 1490 | 1/22 30 h-m-p 0.0000 0.0029 38.1548 +YC 2373.081800 1 0.0001 1538 | 1/22 31 h-m-p 0.0001 0.0023 53.2066 YC 2373.044459 1 0.0001 1585 | 1/22 32 h-m-p 0.0002 0.0051 17.5303 YC 2373.030710 1 0.0001 1632 | 1/22 33 h-m-p 0.0001 0.0205 42.6193 ++YCC 2372.905598 2 0.0005 1683 | 1/22 34 h-m-p 0.0001 0.0014 203.4827 +YYCCCCC 2372.271772 6 0.0005 1740 | 1/22 35 h-m-p 0.0001 0.0011 942.2641 +CYCCC 2368.455940 4 0.0006 1794 | 1/22 36 h-m-p 0.0000 0.0002 13562.8606 CC 2366.188047 1 0.0000 1842 | 1/22 37 h-m-p 0.0001 0.0003 285.0785 YYC 2366.103129 2 0.0001 1890 | 1/22 38 h-m-p 0.0095 1.4778 1.5278 ++CCCC 2365.830814 3 0.1632 1944 | 1/22 39 h-m-p 0.6754 8.0000 0.3692 CYC 2365.415561 2 0.8190 1993 | 1/22 40 h-m-p 1.6000 8.0000 0.1028 CCC 2365.198399 2 1.4662 2043 | 1/22 41 h-m-p 1.6000 8.0000 0.0296 YCC 2365.149634 2 0.8753 2092 | 1/22 42 h-m-p 1.3336 8.0000 0.0195 CC 2365.132821 1 2.0292 2140 | 1/22 43 h-m-p 1.6000 8.0000 0.0236 YC 2365.114733 1 3.6546 2187 | 1/22 44 h-m-p 1.6000 8.0000 0.0409 CC 2365.093277 1 2.2739 2235 | 1/22 45 h-m-p 1.6000 8.0000 0.0404 +YC 2365.032690 1 4.2452 2283 | 1/22 46 h-m-p 1.6000 8.0000 0.0197 CCC 2364.976089 2 2.2845 2333 | 1/22 47 h-m-p 1.1254 8.0000 0.0399 YC 2364.951426 1 1.8481 2380 | 1/22 48 h-m-p 1.6000 8.0000 0.0183 CC 2364.945186 1 1.4229 2428 | 1/22 49 h-m-p 1.6000 8.0000 0.0102 CC 2364.943628 1 2.1767 2476 | 1/22 50 h-m-p 1.6000 8.0000 0.0039 C 2364.943069 0 1.6094 2522 | 1/22 51 h-m-p 1.1838 8.0000 0.0053 C 2364.942922 0 1.4375 2568 | 1/22 52 h-m-p 1.6000 8.0000 0.0020 C 2364.942881 0 1.7074 2614 | 1/22 53 h-m-p 1.6000 8.0000 0.0005 C 2364.942876 0 1.4973 2660 | 1/22 54 h-m-p 1.6000 8.0000 0.0004 C 2364.942873 0 2.4079 2706 | 1/22 55 h-m-p 1.6000 8.0000 0.0005 +C 2364.942869 0 6.7183 2753 | 1/22 56 h-m-p 1.1872 8.0000 0.0026 ++ 2364.942835 m 8.0000 2799 | 1/22 57 h-m-p 0.4844 8.0000 0.0436 +C 2364.942762 0 2.2121 2846 | 1/22 58 h-m-p 1.6000 8.0000 0.0364 ++ 2364.942205 m 8.0000 2892 | 1/22 59 h-m-p 0.1194 8.0000 2.4422 +YC 2364.939514 1 1.0775 2940 | 1/22 60 h-m-p 1.6000 8.0000 0.8703 ++ 2364.931173 m 8.0000 2986 | 1/22 61 h-m-p 1.6000 8.0000 3.3243 CC 2364.923382 1 2.2657 3034 | 1/22 62 h-m-p 1.6000 8.0000 3.4082 YC 2364.920179 1 2.5923 3081 | 1/22 63 h-m-p 1.6000 8.0000 4.0234 YC 2364.918132 1 2.9498 3128 | 1/22 64 h-m-p 1.6000 8.0000 6.0174 YC 2364.916228 1 3.0125 3175 | 1/22 65 h-m-p 0.9874 4.9372 7.9718 +YC 2364.914916 1 3.2482 3223 | 1/22 66 h-m-p 0.2367 1.1834 11.3772 ++ 2364.914362 m 1.1834 3269 | 2/22 67 h-m-p 0.1477 8.0000 0.5218 ---------------.. | 2/22 68 h-m-p 0.0000 0.0015 2.2148 C 2364.914338 0 0.0000 3373 | 2/22 69 h-m-p 0.0000 0.0215 0.9090 C 2364.914323 0 0.0000 3418 | 2/22 70 h-m-p 0.0000 0.0127 0.8643 C 2364.914315 0 0.0000 3463 | 2/22 71 h-m-p 0.0000 0.0158 2.0308 C 2364.914299 0 0.0000 3508 | 2/22 72 h-m-p 0.0001 0.0404 3.3194 Y 2364.914257 0 0.0001 3553 | 2/22 73 h-m-p 0.0001 0.0279 3.5992 +Y 2364.914144 0 0.0002 3599 | 2/22 74 h-m-p 0.0001 0.0519 10.0802 C 2364.913869 0 0.0001 3644 | 2/22 75 h-m-p 0.0001 0.0288 17.4634 +YC 2364.913125 1 0.0002 3691 | 2/22 76 h-m-p 0.0001 0.0146 39.2719 YC 2364.912831 1 0.0000 3737 | 2/22 77 h-m-p 0.0000 0.0091 35.7115 YC 2364.912184 1 0.0001 3783 | 2/22 78 h-m-p 0.0001 0.0097 58.5644 +C 2364.909516 0 0.0002 3829 | 2/22 79 h-m-p 0.0001 0.0053 105.0739 YC 2364.907619 1 0.0001 3875 | 2/22 80 h-m-p 0.0001 0.0078 69.6856 YC 2364.906164 1 0.0001 3921 | 2/22 81 h-m-p 0.0002 0.0115 46.5862 CC 2364.904458 1 0.0002 3968 | 2/22 82 h-m-p 0.0004 0.0129 25.4783 C 2364.904020 0 0.0001 4013 | 2/22 83 h-m-p 0.0007 0.0536 3.2458 -Y 2364.903978 0 0.0001 4059 | 2/22 84 h-m-p 0.0006 0.1012 0.4163 Y 2364.903975 0 0.0001 4104 | 2/22 85 h-m-p 0.0027 1.3713 0.0929 -C 2364.903974 0 0.0001 4150 | 2/22 86 h-m-p 0.0160 8.0000 0.0660 +++YC 2364.902961 1 0.6597 4199 | 2/22 87 h-m-p 0.7575 8.0000 0.0575 YC 2364.902853 1 0.1198 4245 | 2/22 88 h-m-p 1.6000 8.0000 0.0003 Y 2364.902852 0 1.0105 4290 | 2/22 89 h-m-p 1.6000 8.0000 0.0000 Y 2364.902852 0 0.9540 4335 | 2/22 90 h-m-p 1.6000 8.0000 0.0000 -Y 2364.902852 0 0.1000 4381 Out.. lnL = -2364.902852 4382 lfun, 52584 eigenQcodon, 819434 P(t) BEBing (dim = 4). This may take several minutes. Calculating f(x_h|w): 10 categories 20 w sets. Calculating f(X), the marginal probability of data. log(fX) = -2407.458355 S = -2349.281216 -49.671722 Calculating f(w|X), posterior probabilities of site classes. did 10 / 147 patterns 8:24 did 20 / 147 patterns 8:24 did 30 / 147 patterns 8:24 did 40 / 147 patterns 8:24 did 50 / 147 patterns 8:24 did 60 / 147 patterns 8:24 did 70 / 147 patterns 8:24 did 80 / 147 patterns 8:25 did 90 / 147 patterns 8:25 did 100 / 147 patterns 8:25 did 110 / 147 patterns 8:25 did 120 / 147 patterns 8:25 did 130 / 147 patterns 8:25 did 140 / 147 patterns 8:26 did 147 / 147 patterns 8:26 Time used: 8:26 CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=388 D_melanogaster_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_sechellia_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_simulans_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_erecta_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_takahashii_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_biarmipes_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_suzukii_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_eugracilis_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_ficusphila_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIYT-HHLP D_rhopaloa_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD D_elegans_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD *******************************************: D_melanogaster_acj6-PG SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_sechellia_acj6-PG SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_simulans_acj6-PG SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_erecta_acj6-PG SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_takahashii_acj6-PG SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_biarmipes_acj6-PG SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_suzukii_acj6-PG SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_eugracilis_acj6-PG SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_ficusphila_acj6-PG SFQSRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_rhopaloa_acj6-PG SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA D_elegans_acj6-PG SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA *::*********************************************** D_melanogaster_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_sechellia_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_simulans_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_erecta_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_takahashii_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_biarmipes_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_suzukii_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_eugracilis_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_ficusphila_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_rhopaloa_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT D_elegans_acj6-PG QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT ************************************************** D_melanogaster_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_sechellia_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_simulans_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_erecta_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_takahashii_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_biarmipes_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_suzukii_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_eugracilis_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_ficusphila_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_rhopaloa_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH D_elegans_acj6-PG LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH ************************************************** D_melanogaster_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_sechellia_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_simulans_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_erecta_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_takahashii_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_biarmipes_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_suzukii_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_eugracilis_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_ficusphila_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_rhopaloa_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN D_elegans_acj6-PG PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN ************************************************** D_melanogaster_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_sechellia_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_simulans_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_erecta_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_takahashii_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_biarmipes_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_suzukii_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_eugracilis_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_ficusphila_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_rhopaloa_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR D_elegans_acj6-PG LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR ************************************************** D_melanogaster_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_sechellia_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_simulans_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_erecta_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_takahashii_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_biarmipes_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_suzukii_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_eugracilis_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_ficusphila_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_rhopaloa_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL D_elegans_acj6-PG DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL ************************************************** D_melanogaster_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_sechellia_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_simulans_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_erecta_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_takahashii_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_biarmipes_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_suzukii_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_eugracilis_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_ficusphila_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGYo D_rhopaloa_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- D_elegans_acj6-PG KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY- *************************************
>D_melanogaster_acj6-PG ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACGACGTCATGTA CCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA CTGGCGCCCATCTCGGAGTCGCCGCTAACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCATACGGGGGGACATCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCAGTGGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGATTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTTAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_sechellia_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCCCACAACAATATGATCGCCCTCAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_simulans_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACA CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTCAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_erecta_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA TCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTCGATGACCACA CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACATCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCCCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_takahashii_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT TCTCTCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG CTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTAGCTGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAGAGCACGATCTGTCGCTT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCCGAAAAGCGTTCTTTGGAAGCCTACTTTGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_biarmipes_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG CTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCGGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACAGA CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGCTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCGTCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_suzukii_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT TCTCTCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGGATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTCGATGACCACG TTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGTCACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACAGA CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGCTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACCCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_eugracilis_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA TGCGTCGCTGTATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT TCAATCGAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGCATAC TCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGATGTCATGTA CCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGATCCAACGGGCTCAATGACCACG TTGGCGCCCATATCGGAGTCGCCTCTAACGCCAACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGCCACCATGGACACTCAGCGGTACATCAT CCTGTTATCACAGCGGCAGTGGCAGCCGCTGGCCTGCATCCCGACACAGA TACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC GCATCAAGCTGGGCGTTACGCAGGCGGACGTGGGCAAAGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGAGCGCTGTCACAGAGCACGATCTGTAGATT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGGCGAAAAACAAGAGGCGC GATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGC CGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCATCAATGACTGGCCACGGTTCAGCGG GATTTGGATAC--- >D_ficusphila_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA TGCGCCGCTGCATGCCAAATCCATCTATTTACACA---CATCATCTTCCG TCTTTTCAGAGTCGTTTGTTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGAATCC TCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAAGCACCAAGCC CAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACGACGTCATGTA CCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGACCCGACGGGCTCGATGACCACG TTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACACACCAACACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTGCATCCCGACACAGA CACCGATCCCCGCGAGCTGGAGGCCTTCGCGGAGCGGTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT CTAAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGATCTGCAGGTT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGGCGC GACCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTACAGC CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_rhopaloa_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT TCTATCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGACGGCATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC ACTCGATGGACCAACTGGACATGCTGGATCCGACGGGCTCGATGACCACG TTGGCGCCCATTTCGGAGTCCCCACTGACGCCCACACACCAGCACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGTTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACCGA CACCGATCCCCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGCACGATCTGTAGATT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGACGC GATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTCGCCGTCCAGC CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC--- >D_elegans_acj6-PG ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT TCTATCGAGAGTCGTTTATTAGAAGATGCTTCCCTATTATGCAATTCGTG GTCAGCACGTCAGAATGGTGATATCTTCGCGGGCATCAACGATGGCATCC TCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCC CAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTA CCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGATGCACC ACTCGATGGACCAGCTGGACATGCTGGATCCGACGGGCTCGATGACCACG TTGGCGCCCATCTCGGAGTCCCCTCTGACGCCCACACACCAGCACCTGCA CGGTTCCTATCACAGCATGAATCACATGATGAGCCACCACCATCCGGGCA CGCTAAGTGGCCACACGGGGGGACACCATGGACACTCAGCGGTACATCAT CCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTGCATCCCGACACCGA CACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCGGTTCAAGCAGCGGC GCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCAAGGCCCTGGCCAAT CTCAAGTTACCTGGCGTCGGCGCACTGTCGCAGAGCACGATCTGTCGATT CGAGAGCCTGACGCTGTCGCACAACAACATGATCGCCCTGAAGCCCATCC TGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGAAAAACAAGCGACGC GACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAAAAGAAAAGGACTTC CATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTACTTTGCCGTGCAGC CGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCGAAAAGCTGGATTTG AAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAACGTCAAAAACAAAA ACGTATAGTTAGTAGTGTAACACCCTCAATGACTGGCCACGGTTCGGCGG GATTTGGATAC---
>D_melanogaster_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_sechellia_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_simulans_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_erecta_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_takahashii_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_biarmipes_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_suzukii_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SLESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_eugracilis_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_ficusphila_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIYT-HHLP SFQSRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_rhopaloa_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY >D_elegans_acj6-PG MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD SIESRLLEDASLLCNSWSARQNGDIFAGINDGILSRAEALAAVDIQKHQA QHVHSQMPSQIKHDVMYHHHSMSGPPQRPLQMHHSMDQLDMLDPTGSMTT LAPISESPLTPTHQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHH PVITAAVAAAGLHPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALAN LKLPGVGALSQSTICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRR DPDAPSVLPAGEKKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDL KKNVVRVWFCNQRQKQKRIVSSVTPSMTGHGSAGFGY
#NEXUS [ID: 4962710562] begin taxa; dimensions ntax=11; taxlabels D_melanogaster_acj6-PG D_sechellia_acj6-PG D_simulans_acj6-PG D_erecta_acj6-PG D_takahashii_acj6-PG D_biarmipes_acj6-PG D_suzukii_acj6-PG D_eugracilis_acj6-PG D_ficusphila_acj6-PG D_rhopaloa_acj6-PG D_elegans_acj6-PG ; end; begin trees; translate 1 D_melanogaster_acj6-PG, 2 D_sechellia_acj6-PG, 3 D_simulans_acj6-PG, 4 D_erecta_acj6-PG, 5 D_takahashii_acj6-PG, 6 D_biarmipes_acj6-PG, 7 D_suzukii_acj6-PG, 8 D_eugracilis_acj6-PG, 9 D_ficusphila_acj6-PG, 10 D_rhopaloa_acj6-PG, 11 D_elegans_acj6-PG ; [Note: This tree contains information on the topology, branch lengths (if present), and the probability of the partition indicated by the branch.] tree con_50_majrule = (1:0.01475586,2:0.002787641,(3:0.001220417,(4:0.003743594,(5:0.02417358,((6:0.01604029,7:0.005327393)0.815:0.005519727,9:0.1394371,(10:0.007185588,11:0.01397587)0.996:0.02130857)0.698:0.009571864,8:0.06886613)0.998:0.02760115)1.000:0.008364744)0.789:0.002521719); [Note: This tree contains information only on the topology and branch lengths (median of the posterior probability density).] tree con_50_majrule = (1:0.01475586,2:0.002787641,(3:0.001220417,(4:0.003743594,(5:0.02417358,((6:0.01604029,7:0.005327393):0.005519727,9:0.1394371,(10:0.007185588,11:0.01397587):0.02130857):0.009571864,8:0.06886613):0.02760115):0.008364744):0.002521719); end;
Estimated marginal likelihoods for runs sampled in files "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": (Use the harmonic mean for Bayes factor comparisons of models) (Values are saved to the file /opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat) Run Arithmetic mean Harmonic mean -------------------------------------- 1 -2466.01 -2484.91 2 -2465.92 -2491.75 -------------------------------------- TOTAL -2465.97 -2491.06 -------------------------------------- Model parameter summaries over the runs sampled in files "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p": Summaries are based on a total of 3002 samples from 2 runs. Each run produced 2001 samples of which 1501 samples were included. Parameter summaries saved to file "/opt/ADOPS/3/acj6-PG/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat". 95% HPD Interval -------------------- Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+ ------------------------------------------------------------------------------------------------------ TL{all} 0.405539 0.004198 0.287953 0.537082 0.399629 1151.96 1285.41 1.000 r(A<->C){all} 0.135157 0.001324 0.065472 0.205019 0.132245 877.62 912.21 1.003 r(A<->G){all} 0.206237 0.002191 0.117848 0.294669 0.203357 583.12 664.68 1.000 r(A<->T){all} 0.133072 0.001700 0.058529 0.215591 0.130242 669.94 793.30 1.003 r(C<->G){all} 0.055255 0.000306 0.023688 0.089028 0.053444 1026.52 1064.14 1.001 r(C<->T){all} 0.460926 0.003745 0.334927 0.575895 0.460106 605.01 629.37 1.000 r(G<->T){all} 0.009354 0.000077 0.000002 0.027146 0.006739 1150.86 1162.94 1.001 pi(A){all} 0.238435 0.000155 0.214425 0.262464 0.238015 1259.68 1344.98 1.001 pi(C){all} 0.304132 0.000167 0.278019 0.327796 0.303839 1147.97 1263.61 1.000 pi(G){all} 0.266757 0.000166 0.242084 0.292463 0.266671 965.01 1073.51 1.001 pi(T){all} 0.190677 0.000114 0.171532 0.212362 0.190658 1110.73 1157.09 1.000 alpha{1,2} 0.114328 0.000420 0.076541 0.151545 0.112923 1317.52 1381.32 1.000 alpha{3} 2.162042 0.600672 0.844509 3.652757 2.026815 1261.18 1302.66 1.001 pinvar{all} 0.743327 0.000778 0.683516 0.790727 0.744759 1393.53 1412.02 1.000 ------------------------------------------------------------------------------------------------------ * Convergence diagnostic (ESS = Estimated Sample Size); min and avg values correspond to minimal and average ESS among runs. ESS value below 100 may indicate that the parameter is undersampled. + Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman and Rubin, 1992) should approach 1.0 as runs converge. Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/acj6-PG/batch/allfiles/codeml/input.fasta.fasta.pnxs Model: One dN/dS ratio for branches, Codon frequency model: F3x4 Site-class models: ns = 11 ls = 386 Codon usage in sequences -------------------------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 4 3 | Ser TCT 3 3 2 3 4 3 | Tyr TAT 3 2 2 3 2 2 | Cys TGT 2 2 2 2 2 2 TTC 5 5 5 5 4 5 | TCC 9 9 10 9 7 8 | TAC 4 5 5 4 5 5 | TGC 4 4 4 4 4 4 Leu TTA 4 4 4 4 5 4 | TCA 4 4 4 4 5 4 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0 TTG 3 3 3 3 2 2 | TCG 11 11 11 11 11 12 | TAG 0 0 0 0 0 0 | Trp TGG 3 3 3 3 3 3 -------------------------------------------------------------------------------------------------------------------------------------- Leu CTT 1 0 0 0 0 0 | Pro CCT 5 5 5 5 3 5 | His CAT 11 9 9 9 9 9 | Arg CGT 7 7 7 7 6 5 CTC 4 5 5 4 4 4 | CCC 9 9 9 10 12 10 | CAC 16 18 18 18 18 18 | CGC 6 7 7 7 8 8 CTA 2 1 1 1 1 1 | CCA 5 5 5 5 5 3 | Gln CAA 9 9 9 8 9 9 | CGA 3 2 2 2 2 3 CTG 16 17 17 18 18 19 | CCG 7 7 7 6 6 8 | CAG 11 11 11 12 11 11 | CGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Ile ATT 4 3 3 3 4 3 | Thr ACT 2 2 2 2 2 2 | Asn AAT 6 7 6 6 6 6 | Ser AGT 9 9 9 9 9 9 ATC 12 13 13 13 12 13 | ACC 3 3 3 3 2 2 | AAC 5 4 5 5 5 5 | AGC 6 6 6 6 6 6 ATA 1 1 1 1 1 1 | ACA 5 5 5 5 4 4 | Lys AAA 9 9 9 9 9 9 | Arg AGA 1 1 1 1 1 1 Met ATG 19 19 19 19 19 19 | ACG 9 9 9 9 11 11 | AAG 11 11 11 11 11 11 | AGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- Val GTT 2 2 2 2 2 2 | Ala GCT 3 3 3 3 3 3 | Asp GAT 11 11 11 11 9 6 | Gly GGT 5 5 5 5 6 6 GTC 7 7 7 7 7 7 | GCC 12 12 12 12 12 13 | GAC 6 6 6 6 8 11 | GGC 9 9 9 9 10 10 GTA 3 3 3 3 4 3 | GCA 4 3 3 3 3 3 | Glu GAA 5 5 5 5 5 5 | GGA 7 7 7 7 5 5 GTG 4 4 4 4 3 4 | GCG 18 19 19 19 19 18 | GAG 12 12 12 12 12 12 | GGG 2 2 2 2 2 2 -------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------------------------------------------------------------------------- Phe TTT 3 3 3 3 4 | Ser TCT 3 2 2 3 3 | Tyr TAT 2 2 1 2 2 | Cys TGT 2 3 1 2 2 TTC 5 5 6 5 4 | TCC 8 8 8 9 9 | TAC 5 5 7 5 5 | TGC 4 3 4 4 4 Leu TTA 4 4 4 5 4 | TCA 5 9 4 5 5 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0 TTG 3 5 4 3 3 | TCG 11 8 11 10 10 | TAG 0 0 0 0 0 | Trp TGG 3 3 3 3 3 ---------------------------------------------------------------------------------------------------------------------- Leu CTT 0 0 1 0 0 | Pro CCT 4 5 4 3 5 | His CAT 9 10 7 9 9 | Arg CGT 6 7 6 7 7 CTC 4 3 2 3 3 | CCC 10 9 12 11 10 | CAC 18 17 21 18 18 | CGC 7 6 7 6 6 CTA 1 2 2 1 2 | CCA 5 8 4 6 5 | Gln CAA 9 8 6 9 8 | CGA 3 1 1 2 3 CTG 18 15 17 17 17 | CCG 7 4 7 6 6 | CAG 11 12 15 11 12 | CGG 2 2 3 2 2 ---------------------------------------------------------------------------------------------------------------------- Ile ATT 4 3 4 4 3 | Thr ACT 2 2 2 2 2 | Asn AAT 6 6 6 6 6 | Ser AGT 9 9 9 9 9 ATC 12 12 11 13 14 | ACC 3 2 2 3 3 | AAC 5 5 5 5 5 | AGC 6 6 6 6 6 ATA 1 3 1 1 1 | ACA 4 5 5 3 3 | Lys AAA 9 9 8 8 8 | Arg AGA 1 2 1 2 1 Met ATG 19 19 19 19 19 | ACG 10 10 11 11 11 | AAG 11 11 12 12 12 | AGG 2 3 3 2 2 ---------------------------------------------------------------------------------------------------------------------- Val GTT 2 3 2 2 2 | Ala GCT 3 3 4 3 3 | Asp GAT 9 12 7 8 8 | Gly GGT 6 4 5 5 5 GTC 7 5 7 7 6 | GCC 13 11 13 13 13 | GAC 8 5 9 9 9 | GGC 9 12 10 11 11 GTA 3 4 3 3 3 | GCA 3 5 3 3 4 | Glu GAA 5 5 5 5 5 | GGA 5 5 6 5 5 GTG 4 4 4 4 5 | GCG 18 18 17 18 17 | GAG 12 12 11 12 12 | GGG 3 2 2 2 2 ---------------------------------------------------------------------------------------------------------------------- Codon position x base (3x4) table for each sequence. #1: D_melanogaster_acj6-PG position 1: T:0.15026 C:0.29534 A:0.26943 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.19948 C:0.30311 A:0.16062 G:0.33679 Average T:0.19430 C:0.29361 A:0.24611 G:0.26598 #2: D_sechellia_acj6-PG position 1: T:0.15026 C:0.29534 A:0.26943 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.18912 C:0.31606 A:0.15285 G:0.34197 Average T:0.19085 C:0.29793 A:0.24352 G:0.26770 #3: D_simulans_acj6-PG position 1: T:0.15026 C:0.29534 A:0.26943 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.18394 C:0.32124 A:0.15285 G:0.34197 Average T:0.18912 C:0.29965 A:0.24352 G:0.26770 #4: D_erecta_acj6-PG position 1: T:0.15026 C:0.29534 A:0.26943 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.18912 C:0.31606 A:0.15026 G:0.34456 Average T:0.19085 C:0.29793 A:0.24266 G:0.26857 #5: D_takahashii_acj6-PG position 1: T:0.15026 C:0.29534 A:0.26943 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.18394 C:0.32124 A:0.15285 G:0.34197 Average T:0.18912 C:0.29965 A:0.24352 G:0.26770 #6: D_biarmipes_acj6-PG position 1: T:0.14767 C:0.29793 A:0.26943 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.17098 C:0.33420 A:0.14249 G:0.35233 Average T:0.18394 C:0.30484 A:0.24007 G:0.27116 #7: D_suzukii_acj6-PG position 1: T:0.15026 C:0.29534 A:0.26943 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.18135 C:0.32124 A:0.15026 G:0.34715 Average T:0.18826 C:0.29965 A:0.24266 G:0.26943 #8: D_eugracilis_acj6-PG position 1: T:0.15544 C:0.28238 A:0.27720 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.19171 C:0.29534 A:0.18135 G:0.33161 Average T:0.19344 C:0.28670 A:0.25561 G:0.26425 #9: D_ficusphila_acj6-PG position 1: T:0.15026 C:0.29793 A:0.27202 G:0.27979 position 2: T:0.23316 C:0.28238 A:0.31088 G:0.17358 position 3: T:0.16580 C:0.33679 A:0.13731 G:0.36010 Average T:0.18307 C:0.30570 A:0.24007 G:0.27116 #10: D_rhopaloa_acj6-PG position 1: T:0.15285 C:0.28756 A:0.27461 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.17617 C:0.33161 A:0.15026 G:0.34197 Average T:0.18739 C:0.30052 A:0.24439 G:0.26770 #11: D_elegans_acj6-PG position 1: T:0.15026 C:0.29275 A:0.27202 G:0.28497 position 2: T:0.23316 C:0.28238 A:0.30829 G:0.17617 position 3: T:0.18135 C:0.32642 A:0.14767 G:0.34456 Average T:0.18826 C:0.30052 A:0.24266 G:0.26857 Sums of codon usage counts ------------------------------------------------------------------------------ Phe F TTT 35 | Ser S TCT 31 | Tyr Y TAT 23 | Cys C TGT 22 TTC 54 | TCC 94 | TAC 55 | TGC 43 Leu L TTA 46 | TCA 53 | *** * TAA 0 | *** * TGA 0 TTG 34 | TCG 117 | TAG 0 | Trp W TGG 33 ------------------------------------------------------------------------------ Leu L CTT 2 | Pro P CCT 49 | His H CAT 100 | Arg R CGT 72 CTC 41 | CCC 111 | CAC 198 | CGC 75 CTA 15 | CCA 56 | Gln Q CAA 93 | CGA 24 CTG 189 | CCG 71 | CAG 128 | CGG 23 ------------------------------------------------------------------------------ Ile I ATT 38 | Thr T ACT 22 | Asn N AAT 67 | Ser S AGT 99 ATC 138 | ACC 29 | AAC 54 | AGC 66 ATA 13 | ACA 48 | Lys K AAA 96 | Arg R AGA 13 Met M ATG 209 | ACG 111 | AAG 124 | AGG 24 ------------------------------------------------------------------------------ Val V GTT 23 | Ala A GCT 34 | Asp D GAT 103 | Gly G GGT 57 GTC 74 | GCC 136 | GAC 83 | GGC 109 GTA 35 | GCA 37 | Glu E GAA 55 | GGA 64 GTG 44 | GCG 200 | GAG 131 | GGG 23 ------------------------------------------------------------------------------ Codon position x base (3x4) table, overall position 1: T:0.15073 C:0.29369 A:0.27108 G:0.28450 position 2: T:0.23316 C:0.28238 A:0.30853 G:0.17593 position 3: T:0.18300 C:0.32030 A:0.15261 G:0.34409 Average T:0.18896 C:0.29879 A:0.24407 G:0.26817 Nei & Gojobori 1986. dN/dS (dN, dS) (Note: This matrix is not used in later ML. analysis. Use runmode = -2 for ML pairwise comparison.) D_melanogaster_acj6-PG D_sechellia_acj6-PG -1.0000 (0.0000 0.0336) D_simulans_acj6-PG -1.0000 (0.0000 0.0336)-1.0000 (0.0000 0.0074) D_erecta_acj6-PG -1.0000 (0.0000 0.0530)-1.0000 (0.0000 0.0298)-1.0000 (0.0000 0.0223) D_takahashii_acj6-PG -1.0000 (0.0000 0.1402)-1.0000 (0.0000 0.1143)-1.0000 (0.0000 0.1143)-1.0000 (0.0000 0.1058) D_biarmipes_acj6-PG -1.0000 (0.0000 0.1399)-1.0000 (0.0000 0.1141)-1.0000 (0.0000 0.1056)-1.0000 (0.0000 0.0972)-1.0000 (0.0000 0.0808) D_suzukii_acj6-PG -1.0000 (0.0000 0.1270)-1.0000 (0.0000 0.1016)-1.0000 (0.0000 0.0932)-1.0000 (0.0000 0.0850)-1.0000 (0.0000 0.0768)-1.0000 (0.0000 0.0412) D_eugracilis_acj6-PG 0.0064 (0.0011 0.1771) 0.0062 (0.0011 0.1819) 0.0065 (0.0011 0.1726) 0.0069 (0.0011 0.1633) 0.0143 (0.0023 0.1587) 0.0068 (0.0011 0.1675) 0.0080 (0.0011 0.1407) D_ficusphila_acj6-PG 0.0690 (0.0146 0.2110) 0.0777 (0.0145 0.1873) 0.0817 (0.0145 0.1780) 0.0863 (0.0145 0.1686) 0.0883 (0.0157 0.1778) 0.0889 (0.0146 0.1637) 0.0968 (0.0146 0.1504) 0.0614 (0.0145 0.2368) D_rhopaloa_acj6-PG 0.0069 (0.0011 0.1629) 0.0080 (0.0011 0.1406) 0.0086 (0.0011 0.1319) 0.0086 (0.0011 0.1318) 0.0222 (0.0023 0.1018) 0.0127 (0.0011 0.0892) 0.0164 (0.0011 0.0689)-1.0000 (0.0000 0.1591) 0.0909 (0.0145 0.1599) D_elegans_acj6-PG 0.0066 (0.0011 0.1717) 0.0076 (0.0011 0.1492) 0.0081 (0.0011 0.1403) 0.0086 (0.0011 0.1314) 0.0099 (0.0011 0.1142) 0.0127 (0.0011 0.0890) 0.0147 (0.0011 0.0768)-1.0000 (0.0000 0.1633) 0.0840 (0.0145 0.1732)-1.0000 (0.0000 0.0414) Model 0: one-ratio TREE # 1: (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 lnL(ntime: 17 np: 19): -2386.440429 +0.000000 12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..9 16..18 18..10 18..11 15..8 0.022111 0.002693 0.002780 0.000004 0.011339 0.005231 0.039339 0.039168 0.013235 0.007856 0.025170 0.005518 0.147364 0.029349 0.012270 0.019180 0.083433 1.914323 0.027562 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.46604 (1: 0.022111, 2: 0.002693, (3: 0.000004, (4: 0.005231, (5: 0.039168, ((6: 0.025170, 7: 0.005518): 0.007856, 9: 0.147364, (10: 0.012270, 11: 0.019180): 0.029349): 0.013235, 8: 0.083433): 0.039339): 0.011339): 0.002780); (D_melanogaster_acj6-PG: 0.022111, D_sechellia_acj6-PG: 0.002693, (D_simulans_acj6-PG: 0.000004, (D_erecta_acj6-PG: 0.005231, (D_takahashii_acj6-PG: 0.039168, ((D_biarmipes_acj6-PG: 0.025170, D_suzukii_acj6-PG: 0.005518): 0.007856, D_ficusphila_acj6-PG: 0.147364, (D_rhopaloa_acj6-PG: 0.012270, D_elegans_acj6-PG: 0.019180): 0.029349): 0.013235, D_eugracilis_acj6-PG: 0.083433): 0.039339): 0.011339): 0.002780); Detailed output identifying parameters kappa (ts/tv) = 1.91432 omega (dN/dS) = 0.02756 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.022 872.1 285.9 0.0276 0.0008 0.0275 0.7 7.9 12..2 0.003 872.1 285.9 0.0276 0.0001 0.0034 0.1 1.0 12..13 0.003 872.1 285.9 0.0276 0.0001 0.0035 0.1 1.0 13..3 0.000 872.1 285.9 0.0276 0.0000 0.0000 0.0 0.0 13..14 0.011 872.1 285.9 0.0276 0.0004 0.0141 0.3 4.0 14..4 0.005 872.1 285.9 0.0276 0.0002 0.0065 0.2 1.9 14..15 0.039 872.1 285.9 0.0276 0.0014 0.0490 1.2 14.0 15..5 0.039 872.1 285.9 0.0276 0.0013 0.0488 1.2 13.9 15..16 0.013 872.1 285.9 0.0276 0.0005 0.0165 0.4 4.7 16..17 0.008 872.1 285.9 0.0276 0.0003 0.0098 0.2 2.8 17..6 0.025 872.1 285.9 0.0276 0.0009 0.0314 0.8 9.0 17..7 0.006 872.1 285.9 0.0276 0.0002 0.0069 0.2 2.0 16..9 0.147 872.1 285.9 0.0276 0.0051 0.1835 4.4 52.5 16..18 0.029 872.1 285.9 0.0276 0.0010 0.0366 0.9 10.5 18..10 0.012 872.1 285.9 0.0276 0.0004 0.0153 0.4 4.4 18..11 0.019 872.1 285.9 0.0276 0.0007 0.0239 0.6 6.8 15..8 0.083 872.1 285.9 0.0276 0.0029 0.1039 2.5 29.7 tree length for dN: 0.0160 tree length for dS: 0.5805 Time used: 0:15 Model 1: NearlyNeutral (2 categories) TREE # 1: (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 lnL(ntime: 17 np: 20): -2366.016141 +0.000000 12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..9 16..18 18..10 18..11 15..8 0.022152 0.002697 0.002784 0.000004 0.011377 0.005256 0.039581 0.039427 0.013315 0.007899 0.025326 0.005546 0.151337 0.029526 0.012329 0.019274 0.084175 1.914636 0.970798 0.000001 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.47200 (1: 0.022152, 2: 0.002697, (3: 0.000004, (4: 0.005256, (5: 0.039427, ((6: 0.025326, 7: 0.005546): 0.007899, 9: 0.151337, (10: 0.012329, 11: 0.019274): 0.029526): 0.013315, 8: 0.084175): 0.039581): 0.011377): 0.002784); (D_melanogaster_acj6-PG: 0.022152, D_sechellia_acj6-PG: 0.002697, (D_simulans_acj6-PG: 0.000004, (D_erecta_acj6-PG: 0.005256, (D_takahashii_acj6-PG: 0.039427, ((D_biarmipes_acj6-PG: 0.025326, D_suzukii_acj6-PG: 0.005546): 0.007899, D_ficusphila_acj6-PG: 0.151337, (D_rhopaloa_acj6-PG: 0.012329, D_elegans_acj6-PG: 0.019274): 0.029526): 0.013315, D_eugracilis_acj6-PG: 0.084175): 0.039581): 0.011377): 0.002784); Detailed output identifying parameters kappa (ts/tv) = 1.91464 dN/dS (w) for site classes (K=2) p: 0.97080 0.02920 w: 0.00000 1.00000 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.022 872.1 285.9 0.0292 0.0008 0.0275 0.7 7.9 12..2 0.003 872.1 285.9 0.0292 0.0001 0.0033 0.1 1.0 12..13 0.003 872.1 285.9 0.0292 0.0001 0.0035 0.1 1.0 13..3 0.000 872.1 285.9 0.0292 0.0000 0.0000 0.0 0.0 13..14 0.011 872.1 285.9 0.0292 0.0004 0.0141 0.4 4.0 14..4 0.005 872.1 285.9 0.0292 0.0002 0.0065 0.2 1.9 14..15 0.040 872.1 285.9 0.0292 0.0014 0.0491 1.2 14.0 15..5 0.039 872.1 285.9 0.0292 0.0014 0.0489 1.2 14.0 15..16 0.013 872.1 285.9 0.0292 0.0005 0.0165 0.4 4.7 16..17 0.008 872.1 285.9 0.0292 0.0003 0.0098 0.2 2.8 17..6 0.025 872.1 285.9 0.0292 0.0009 0.0314 0.8 9.0 17..7 0.006 872.1 285.9 0.0292 0.0002 0.0069 0.2 2.0 16..9 0.151 872.1 285.9 0.0292 0.0055 0.1876 4.8 53.6 16..18 0.030 872.1 285.9 0.0292 0.0011 0.0366 0.9 10.5 18..10 0.012 872.1 285.9 0.0292 0.0004 0.0153 0.4 4.4 18..11 0.019 872.1 285.9 0.0292 0.0007 0.0239 0.6 6.8 15..8 0.084 872.1 285.9 0.0292 0.0030 0.1044 2.7 29.8 Time used: 0:35 Model 2: PositiveSelection (3 categories) TREE # 1: (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 check convergence.. lnL(ntime: 17 np: 22): -2364.894727 +0.000000 12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..9 16..18 18..10 18..11 15..8 0.022377 0.002724 0.002810 0.000004 0.011508 0.005332 0.040144 0.040001 0.013507 0.008019 0.025683 0.005623 0.154045 0.029950 0.012488 0.019526 0.085565 1.934913 0.984408 0.000000 0.004914 2.323237 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.47931 (1: 0.022377, 2: 0.002724, (3: 0.000004, (4: 0.005332, (5: 0.040001, ((6: 0.025683, 7: 0.005623): 0.008019, 9: 0.154045, (10: 0.012488, 11: 0.019526): 0.029950): 0.013507, 8: 0.085565): 0.040144): 0.011508): 0.002810); (D_melanogaster_acj6-PG: 0.022377, D_sechellia_acj6-PG: 0.002724, (D_simulans_acj6-PG: 0.000004, (D_erecta_acj6-PG: 0.005332, (D_takahashii_acj6-PG: 0.040001, ((D_biarmipes_acj6-PG: 0.025683, D_suzukii_acj6-PG: 0.005623): 0.008019, D_ficusphila_acj6-PG: 0.154045, (D_rhopaloa_acj6-PG: 0.012488, D_elegans_acj6-PG: 0.019526): 0.029950): 0.013507, D_eugracilis_acj6-PG: 0.085565): 0.040144): 0.011508): 0.002810); Detailed output identifying parameters kappa (ts/tv) = 1.93491 dN/dS (w) for site classes (K=3) p: 0.98441 0.00000 0.01559 w: 0.00491 1.00000 2.32324 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.022 871.7 286.3 0.0411 0.0011 0.0268 1.0 7.7 12..2 0.003 871.7 286.3 0.0411 0.0001 0.0033 0.1 0.9 12..13 0.003 871.7 286.3 0.0411 0.0001 0.0034 0.1 1.0 13..3 0.000 871.7 286.3 0.0411 0.0000 0.0000 0.0 0.0 13..14 0.012 871.7 286.3 0.0411 0.0006 0.0138 0.5 3.9 14..4 0.005 871.7 286.3 0.0411 0.0003 0.0064 0.2 1.8 14..15 0.040 871.7 286.3 0.0411 0.0020 0.0481 1.7 13.8 15..5 0.040 871.7 286.3 0.0411 0.0020 0.0479 1.7 13.7 15..16 0.014 871.7 286.3 0.0411 0.0007 0.0162 0.6 4.6 16..17 0.008 871.7 286.3 0.0411 0.0004 0.0096 0.3 2.8 17..6 0.026 871.7 286.3 0.0411 0.0013 0.0308 1.1 8.8 17..7 0.006 871.7 286.3 0.0411 0.0003 0.0067 0.2 1.9 16..9 0.154 871.7 286.3 0.0411 0.0076 0.1846 6.6 52.9 16..18 0.030 871.7 286.3 0.0411 0.0015 0.0359 1.3 10.3 18..10 0.012 871.7 286.3 0.0411 0.0006 0.0150 0.5 4.3 18..11 0.020 871.7 286.3 0.0411 0.0010 0.0234 0.8 6.7 15..8 0.086 871.7 286.3 0.0411 0.0042 0.1026 3.7 29.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 1.000** 2.322 47 S 0.998** 2.320 48 C 0.998** 2.318 49 D 0.999** 2.322 51 L 1.000** 2.323 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 0.750 2.283 +- 1.443 47 S 0.601 1.887 +- 1.257 48 C 0.528 1.690 +- 1.130 49 D 0.633 1.934 +- 1.189 51 L 0.678 2.044 +- 1.217 The grid (see ternary graph for p0-p1) w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 w2: 0.423 0.288 0.160 0.072 0.030 0.013 0.006 0.004 0.002 0.002 Posterior for p0-p1 (see the ternary graph) 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 sum of density on p0-p1 = 1.000000 Time used: 1:23 Model 3: discrete (3 categories) TREE # 1: (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 check convergence.. lnL(ntime: 17 np: 23): -2364.894727 +0.000000 12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..9 16..18 18..10 18..11 15..8 0.022377 0.002724 0.002810 0.000004 0.011508 0.005333 0.040144 0.040001 0.013508 0.008019 0.025683 0.005623 0.154045 0.029950 0.012488 0.019526 0.085565 1.934911 0.021026 0.963382 0.004889 0.004914 2.323233 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.47931 (1: 0.022377, 2: 0.002724, (3: 0.000004, (4: 0.005333, (5: 0.040001, ((6: 0.025683, 7: 0.005623): 0.008019, 9: 0.154045, (10: 0.012488, 11: 0.019526): 0.029950): 0.013508, 8: 0.085565): 0.040144): 0.011508): 0.002810); (D_melanogaster_acj6-PG: 0.022377, D_sechellia_acj6-PG: 0.002724, (D_simulans_acj6-PG: 0.000004, (D_erecta_acj6-PG: 0.005333, (D_takahashii_acj6-PG: 0.040001, ((D_biarmipes_acj6-PG: 0.025683, D_suzukii_acj6-PG: 0.005623): 0.008019, D_ficusphila_acj6-PG: 0.154045, (D_rhopaloa_acj6-PG: 0.012488, D_elegans_acj6-PG: 0.019526): 0.029950): 0.013508, D_eugracilis_acj6-PG: 0.085565): 0.040144): 0.011508): 0.002810); Detailed output identifying parameters kappa (ts/tv) = 1.93491 dN/dS (w) for site classes (K=3) p: 0.02103 0.96338 0.01559 w: 0.00489 0.00491 2.32323 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.022 871.7 286.3 0.0411 0.0011 0.0268 1.0 7.7 12..2 0.003 871.7 286.3 0.0411 0.0001 0.0033 0.1 0.9 12..13 0.003 871.7 286.3 0.0411 0.0001 0.0034 0.1 1.0 13..3 0.000 871.7 286.3 0.0411 0.0000 0.0000 0.0 0.0 13..14 0.012 871.7 286.3 0.0411 0.0006 0.0138 0.5 3.9 14..4 0.005 871.7 286.3 0.0411 0.0003 0.0064 0.2 1.8 14..15 0.040 871.7 286.3 0.0411 0.0020 0.0481 1.7 13.8 15..5 0.040 871.7 286.3 0.0411 0.0020 0.0479 1.7 13.7 15..16 0.014 871.7 286.3 0.0411 0.0007 0.0162 0.6 4.6 16..17 0.008 871.7 286.3 0.0411 0.0004 0.0096 0.3 2.8 17..6 0.026 871.7 286.3 0.0411 0.0013 0.0308 1.1 8.8 17..7 0.006 871.7 286.3 0.0411 0.0003 0.0067 0.2 1.9 16..9 0.154 871.7 286.3 0.0411 0.0076 0.1846 6.6 52.9 16..18 0.030 871.7 286.3 0.0411 0.0015 0.0359 1.3 10.3 18..10 0.012 871.7 286.3 0.0411 0.0006 0.0150 0.5 4.3 18..11 0.020 871.7 286.3 0.0411 0.0010 0.0234 0.8 6.7 15..8 0.086 871.7 286.3 0.0411 0.0042 0.1026 3.7 29.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 1.000** 2.322 47 S 0.998** 2.320 48 C 0.998** 2.318 49 D 0.999** 2.322 51 L 1.000** 2.323 Time used: 2:00 Model 7: beta (10 categories) TREE # 1: (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 lnL(ntime: 17 np: 20): -2371.804541 +0.000000 12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..9 16..18 18..10 18..11 15..8 0.022500 0.002741 0.002829 0.000004 0.011543 0.005330 0.040081 0.039919 0.013487 0.008006 0.025648 0.005622 0.151173 0.029902 0.012496 0.019537 0.085077 1.924184 0.010410 0.213758 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.47589 (1: 0.022500, 2: 0.002741, (3: 0.000004, (4: 0.005330, (5: 0.039919, ((6: 0.025648, 7: 0.005622): 0.008006, 9: 0.151173, (10: 0.012496, 11: 0.019537): 0.029902): 0.013487, 8: 0.085077): 0.040081): 0.011543): 0.002829); (D_melanogaster_acj6-PG: 0.022500, D_sechellia_acj6-PG: 0.002741, (D_simulans_acj6-PG: 0.000004, (D_erecta_acj6-PG: 0.005330, (D_takahashii_acj6-PG: 0.039919, ((D_biarmipes_acj6-PG: 0.025648, D_suzukii_acj6-PG: 0.005622): 0.008006, D_ficusphila_acj6-PG: 0.151173, (D_rhopaloa_acj6-PG: 0.012496, D_elegans_acj6-PG: 0.019537): 0.029902): 0.013487, D_eugracilis_acj6-PG: 0.085077): 0.040081): 0.011543): 0.002829); Detailed output identifying parameters kappa (ts/tv) = 1.92418 Parameters in M7 (beta): p = 0.01041 q = 0.21376 dN/dS (w) for site classes (K=10) p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00001 0.36522 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.023 871.9 286.1 0.0365 0.0010 0.0273 0.9 7.8 12..2 0.003 871.9 286.1 0.0365 0.0001 0.0033 0.1 1.0 12..13 0.003 871.9 286.1 0.0365 0.0001 0.0034 0.1 1.0 13..3 0.000 871.9 286.1 0.0365 0.0000 0.0000 0.0 0.0 13..14 0.012 871.9 286.1 0.0365 0.0005 0.0140 0.4 4.0 14..4 0.005 871.9 286.1 0.0365 0.0002 0.0065 0.2 1.9 14..15 0.040 871.9 286.1 0.0365 0.0018 0.0487 1.5 13.9 15..5 0.040 871.9 286.1 0.0365 0.0018 0.0485 1.5 13.9 15..16 0.013 871.9 286.1 0.0365 0.0006 0.0164 0.5 4.7 16..17 0.008 871.9 286.1 0.0365 0.0004 0.0097 0.3 2.8 17..6 0.026 871.9 286.1 0.0365 0.0011 0.0311 1.0 8.9 17..7 0.006 871.9 286.1 0.0365 0.0002 0.0068 0.2 2.0 16..9 0.151 871.9 286.1 0.0365 0.0067 0.1836 5.8 52.5 16..18 0.030 871.9 286.1 0.0365 0.0013 0.0363 1.2 10.4 18..10 0.012 871.9 286.1 0.0365 0.0006 0.0152 0.5 4.3 18..11 0.020 871.9 286.1 0.0365 0.0009 0.0237 0.8 6.8 15..8 0.085 871.9 286.1 0.0365 0.0038 0.1033 3.3 29.6 Time used: 4:12 Model 8: beta&w>1 (11 categories) TREE # 1: (1, 2, (3, (4, (5, ((6, 7), 9, (10, 11)), 8)))); MP score: 151 lnL(ntime: 17 np: 22): -2364.902852 +0.000000 12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..9 16..18 18..10 18..11 15..8 0.022376 0.002724 0.002810 0.000004 0.011507 0.005332 0.040140 0.039997 0.013506 0.008019 0.025680 0.005623 0.154034 0.029947 0.012487 0.019524 0.085556 1.935065 0.984419 0.522469 99.000000 2.321694 Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site). tree length = 0.47927 (1: 0.022376, 2: 0.002724, (3: 0.000004, (4: 0.005332, (5: 0.039997, ((6: 0.025680, 7: 0.005623): 0.008019, 9: 0.154034, (10: 0.012487, 11: 0.019524): 0.029947): 0.013506, 8: 0.085556): 0.040140): 0.011507): 0.002810); (D_melanogaster_acj6-PG: 0.022376, D_sechellia_acj6-PG: 0.002724, (D_simulans_acj6-PG: 0.000004, (D_erecta_acj6-PG: 0.005332, (D_takahashii_acj6-PG: 0.039997, ((D_biarmipes_acj6-PG: 0.025680, D_suzukii_acj6-PG: 0.005623): 0.008019, D_ficusphila_acj6-PG: 0.154034, (D_rhopaloa_acj6-PG: 0.012487, D_elegans_acj6-PG: 0.019524): 0.029947): 0.013506, D_eugracilis_acj6-PG: 0.085556): 0.040140): 0.011507): 0.002810); Detailed output identifying parameters kappa (ts/tv) = 1.93507 Parameters in M8 (beta&w>1): p0 = 0.98442 p = 0.52247 q = 99.00000 (p1 = 0.01558) w = 2.32169 dN/dS (w) for site classes (K=11) p: 0.09844 0.09844 0.09844 0.09844 0.09844 0.09844 0.09844 0.09844 0.09844 0.09844 0.01558 w: 0.00003 0.00022 0.00059 0.00116 0.00198 0.00311 0.00469 0.00702 0.01086 0.01981 2.32169 dN & dS for each branch branch t N S dN/dS dN dS N*dN S*dS 12..1 0.022 871.7 286.3 0.0410 0.0011 0.0268 1.0 7.7 12..2 0.003 871.7 286.3 0.0410 0.0001 0.0033 0.1 0.9 12..13 0.003 871.7 286.3 0.0410 0.0001 0.0034 0.1 1.0 13..3 0.000 871.7 286.3 0.0410 0.0000 0.0000 0.0 0.0 13..14 0.012 871.7 286.3 0.0410 0.0006 0.0138 0.5 3.9 14..4 0.005 871.7 286.3 0.0410 0.0003 0.0064 0.2 1.8 14..15 0.040 871.7 286.3 0.0410 0.0020 0.0481 1.7 13.8 15..5 0.040 871.7 286.3 0.0410 0.0020 0.0479 1.7 13.7 15..16 0.014 871.7 286.3 0.0410 0.0007 0.0162 0.6 4.6 16..17 0.008 871.7 286.3 0.0410 0.0004 0.0096 0.3 2.8 17..6 0.026 871.7 286.3 0.0410 0.0013 0.0308 1.1 8.8 17..7 0.006 871.7 286.3 0.0410 0.0003 0.0067 0.2 1.9 16..9 0.154 871.7 286.3 0.0410 0.0076 0.1846 6.6 52.9 16..18 0.030 871.7 286.3 0.0410 0.0015 0.0359 1.3 10.3 18..10 0.012 871.7 286.3 0.0410 0.0006 0.0150 0.5 4.3 18..11 0.020 871.7 286.3 0.0410 0.0010 0.0234 0.8 6.7 15..8 0.086 871.7 286.3 0.0410 0.0042 0.1025 3.7 29.4 Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 0.999** 2.319 47 S 0.996** 2.313 48 C 0.994** 2.309 49 D 0.999** 2.318 51 L 1.000** 2.322 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 0.856 1.899 +- 1.059 47 S 0.740 1.670 +- 1.072 48 C 0.680 1.534 +- 1.039 49 D 0.811 1.786 +- 1.019 51 L 0.868 1.894 +- 0.992 The grid p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950 p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900 ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500 Posterior on the grid p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000 p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 q : 0.000 0.000 0.000 0.000 0.000 0.000 0.002 0.025 0.171 0.802 ws: 0.618 0.240 0.096 0.032 0.010 0.003 0.001 0.000 0.000 0.000 Time used: 8:26
Model 1: NearlyNeutral -2366.016141 Model 2: PositiveSelection -2364.894727 Model 0: one-ratio -2386.440429 Model 3: discrete -2364.894727 Model 7: beta -2371.804541 Model 8: beta&w>1 -2364.902852 Model 0 vs 1 40.84857600000032 Model 2 vs 1 2.2428280000003724 Model 8 vs 7 13.803377999999611 Additional information for M7 vs M8: Naive Empirical Bayes (NEB) analysis Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 0.999** 2.319 47 S 0.996** 2.313 48 C 0.994** 2.309 49 D 0.999** 2.318 51 L 1.000** 2.322 Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118) Positively selected sites (*: P>95%; **: P>99%) (amino acids refer to 1st sequence: D_melanogaster_acj6-PG) Pr(w>1) post mean +- SE for w 46 S 0.856 1.899 +- 1.059 47 S 0.740 1.670 +- 1.072 48 C 0.680 1.534 +- 1.039 49 D 0.811 1.786 +- 1.019 51 L 0.868 1.894 +- 0.992