--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 08:02:25 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/acj6-PF/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2257.37 -2282.05
2 -2256.73 -2276.21
--------------------------------------
TOTAL -2257.00 -2281.36
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.389200 0.003138 0.287301 0.504191 0.384507 1405.33 1436.15 1.000
r(A<->C){all} 0.119417 0.001146 0.058768 0.190841 0.116106 795.84 908.99 1.000
r(A<->G){all} 0.251567 0.002956 0.147983 0.358029 0.247817 589.66 640.17 1.000
r(A<->T){all} 0.110706 0.001484 0.041559 0.187782 0.107179 757.43 817.06 1.000
r(C<->G){all} 0.065725 0.000407 0.030332 0.107925 0.063458 960.11 1006.60 1.000
r(C<->T){all} 0.441390 0.003780 0.323123 0.560051 0.441287 591.01 664.37 1.000
r(G<->T){all} 0.011194 0.000107 0.000002 0.031442 0.008227 921.04 1021.98 1.000
pi(A){all} 0.238453 0.000149 0.215876 0.262784 0.238250 986.36 1149.22 1.000
pi(C){all} 0.308173 0.000175 0.283215 0.334078 0.307752 1207.76 1210.44 1.000
pi(G){all} 0.270920 0.000168 0.245455 0.296428 0.271094 1117.11 1203.63 1.000
pi(T){all} 0.182454 0.000122 0.162519 0.205410 0.182323 1156.83 1195.96 1.000
alpha{1,2} 0.046441 0.000670 0.000113 0.086602 0.048221 1266.70 1325.95 1.000
alpha{3} 2.457735 0.659965 1.069537 4.040857 2.338692 1396.56 1448.78 1.000
pinvar{all} 0.746451 0.000694 0.695172 0.797072 0.747761 1101.42 1284.18 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -2158.388457
Model 2: PositiveSelection -2158.385862
Model 0: one-ratio -2158.434656
Model 3: discrete -2158.385862
Model 7: beta -2158.385379
Model 8: beta&w>1 -2158.387974
Model 0 vs 1 0.09239799999977549
Model 2 vs 1 0.005189999999856809
Model 8 vs 7 0.005190000000766304
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=364
C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
C11 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
**************************************************
C1 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C2 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C3 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C4 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C5 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C6 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C7 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C8 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C9 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C10 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
C11 DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
**************************************************
C1 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C2 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C3 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C4 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C5 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C6 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C7 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C8 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C9 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C10 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
C11 QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
**************************************************
C1 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C2 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C3 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C4 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C5 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C6 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C7 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C8 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C9 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C10 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
C11 NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
**************************************************
C1 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C2 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C3 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C4 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C5 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C6 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C7 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C8 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C9 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C10 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
C11 EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
**************************************************
C1 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C2 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C3 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C4 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C5 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C6 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C7 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C8 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C9 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C10 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
C11 HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
**************************************************
C1 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C2 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C3 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C4 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C5 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C6 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C7 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C8 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C9 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C10 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
C11 RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
**************************************************
C1 TPSMTGHGSAGFGY
C2 TPSMTGHGSAGFGY
C3 TPSMTGHGSAGFGY
C4 TPSMTGHGSAGFGY
C5 TPSMTGHGSAGFGY
C6 TPSMTGHGSAGFGY
C7 TPSMTGHGSAGFGY
C8 TPSMTGHGSAGFGY
C9 TPSMTGHGSAGFGY
C10 TPSMTGHGSAGFGY
C11 TPSMTGHGSAGFGY
**************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 364 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 364 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [40040]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [40040]--->[40040]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/acj6-PF/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.675 Mb, Max= 31.810 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
FORMAT of file /tmp/tmp4360206860008620685aln Not Supported[FATAL:T-COFFEE]
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:364 S:100 BS:364
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 100.00 C1 C8 100.00
TOP 7 0 100.00 C8 C1 100.00
BOT 0 8 100.00 C1 C9 100.00
TOP 8 0 100.00 C9 C1 100.00
BOT 0 9 100.00 C1 C10 100.00
TOP 9 0 100.00 C10 C1 100.00
BOT 0 10 100.00 C1 C11 100.00
TOP 10 0 100.00 C11 C1 100.00
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 1 6 100.00 C2 C7 100.00
TOP 6 1 100.00 C7 C2 100.00
BOT 1 7 100.00 C2 C8 100.00
TOP 7 1 100.00 C8 C2 100.00
BOT 1 8 100.00 C2 C9 100.00
TOP 8 1 100.00 C9 C2 100.00
BOT 1 9 100.00 C2 C10 100.00
TOP 9 1 100.00 C10 C2 100.00
BOT 1 10 100.00 C2 C11 100.00
TOP 10 1 100.00 C11 C2 100.00
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 100.00 C3 C8 100.00
TOP 7 2 100.00 C8 C3 100.00
BOT 2 8 100.00 C3 C9 100.00
TOP 8 2 100.00 C9 C3 100.00
BOT 2 9 100.00 C3 C10 100.00
TOP 9 2 100.00 C10 C3 100.00
BOT 2 10 100.00 C3 C11 100.00
TOP 10 2 100.00 C11 C3 100.00
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 100.00 C4 C7 100.00
TOP 6 3 100.00 C7 C4 100.00
BOT 3 7 100.00 C4 C8 100.00
TOP 7 3 100.00 C8 C4 100.00
BOT 3 8 100.00 C4 C9 100.00
TOP 8 3 100.00 C9 C4 100.00
BOT 3 9 100.00 C4 C10 100.00
TOP 9 3 100.00 C10 C4 100.00
BOT 3 10 100.00 C4 C11 100.00
TOP 10 3 100.00 C11 C4 100.00
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 100.00 C5 C8 100.00
TOP 7 4 100.00 C8 C5 100.00
BOT 4 8 100.00 C5 C9 100.00
TOP 8 4 100.00 C9 C5 100.00
BOT 4 9 100.00 C5 C10 100.00
TOP 9 4 100.00 C10 C5 100.00
BOT 4 10 100.00 C5 C11 100.00
TOP 10 4 100.00 C11 C5 100.00
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 100.00 C6 C8 100.00
TOP 7 5 100.00 C8 C6 100.00
BOT 5 8 100.00 C6 C9 100.00
TOP 8 5 100.00 C9 C6 100.00
BOT 5 9 100.00 C6 C10 100.00
TOP 9 5 100.00 C10 C6 100.00
BOT 5 10 100.00 C6 C11 100.00
TOP 10 5 100.00 C11 C6 100.00
BOT 6 7 100.00 C7 C8 100.00
TOP 7 6 100.00 C8 C7 100.00
BOT 6 8 100.00 C7 C9 100.00
TOP 8 6 100.00 C9 C7 100.00
BOT 6 9 100.00 C7 C10 100.00
TOP 9 6 100.00 C10 C7 100.00
BOT 6 10 100.00 C7 C11 100.00
TOP 10 6 100.00 C11 C7 100.00
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 7 10 100.00 C8 C11 100.00
TOP 10 7 100.00 C11 C8 100.00
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
BOT 8 10 100.00 C9 C11 100.00
TOP 10 8 100.00 C11 C9 100.00
BOT 9 10 100.00 C10 C11 100.00
TOP 10 9 100.00 C11 C10 100.00
AVG 0 C1 * 100.00
AVG 1 C2 * 100.00
AVG 2 C3 * 100.00
AVG 3 C4 * 100.00
AVG 4 C5 * 100.00
AVG 5 C6 * 100.00
AVG 6 C7 * 100.00
AVG 7 C8 * 100.00
AVG 8 C9 * 100.00
AVG 9 C10 * 100.00
AVG 10 C11 * 100.00
TOT TOT * 100.00
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
C2 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C3 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C4 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C5 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C6 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C7 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C8 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C9 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C10 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C11 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
***************** ********************************
C1 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C2 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C3 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C4 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C5 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C6 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C7 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C8 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
C9 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA
C10 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C11 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
********************************* **************.*
C1 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C2 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C3 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C4 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C5 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C6 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C7 TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C8 TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C9 TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC
C10 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
C11 TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
**** ***** ***********.** ************************
C1 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C2 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C3 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C4 GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C5 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C6 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C7 GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C8 GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA
C9 GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA
C10 GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
C11 GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
** ** **.****************** ****.*****************
C1 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG
C2 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C3 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C4 GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C5 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C6 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C7 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C8 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C9 GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG
C10 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
C11 GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
*** *********** **.** *****************.** *******
C1 ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C2 ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C3 ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C4 ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
C5 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
C6 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG
C7 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
C8 ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
C9 ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG
C10 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
C11 ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
* ******** ** ** ***************** ** **.***** **
C1 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
C2 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
C3 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
C4 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C5 CAGGAAAATCCCTTTTCCCGGCAGATGCACCACTCGATGGACCAGCTGGA
C6 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C7 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C8 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C9 CAGGAAAATCCTTTCTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
C10 CAGGAAAATCCTTTTTCCCGACAGATGCACCACTCGATGGACCAACTGGA
C11 CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
*********** ** ** **.***********************.*****
C1 CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
C2 CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
C3 CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
C4 CATGCTGGATCCAACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
C5 CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGT
C6 CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGT
C7 CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
C8 CATGCTGGATCCAACGGGCTCAATGACCACGTTGGCGCCCATATCGGAGT
C9 CATGCTGGACCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
C10 CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
C11 CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGT
********* **.********.********. ********** *******
C1 CGCCGCTAACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C2 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C3 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C4 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C5 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C6 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C7 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C8 CGCCTCTAACGCCAACACACCAACACCTGCACGGTTCCTATCACAGCATG
C9 CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
C10 CCCCACTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG
C11 CCCCTCTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG
* ** **.*****.********.***************************
C1 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCATACGGG
C2 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C3 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C4 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C5 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C6 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C7 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C8 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C9 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C10 AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
C11 AATCACATGATGAGCCACCACCATCCGGGCACGCTAAGTGGCCACACGGG
********************************* ********** *****
C1 GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCAG
C2 GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
C3 GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
C4 GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
C5 GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
C6 GGGTCACCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
C7 GGGTCACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
C8 GGGCCACCATGGACACTCAGCGGTACATCATCCTGTTATCACAGCGGCAG
C9 GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
C10 GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
C11 GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
*** ** ***********.***********************.*****.*
C1 TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C2 TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C3 TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C4 TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C5 TAGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C6 TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG
C7 TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG
C8 TGGCAGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
C9 TGGCTGCCGCTGGCCTGCATCCCGACACAGACACCGATCCCCGCGAGCTG
C10 TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCCCGCGAGCTG
C11 TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCTCGCGAGCTG
*.**:***********************.** ******** *********
C1 GAGGCGTTTGCGGAGCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C2 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C3 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C4 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C5 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C6 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C7 GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C8 GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTAC
C9 GAGGCCTTCGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C10 GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
C11 GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
***** ** ******** ************************** ** **
C1 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C2 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C3 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C4 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C5 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C6 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C7 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C8 GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C9 GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCG
C10 GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
C11 GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
******************.**************.****************
C1 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
C2 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
C3 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
C4 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
C5 GTGCGCTGTCGCAGAGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCG
C6 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG
C7 GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCG
C8 GAGCGCTGTCACAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG
C9 GCGCGCTGTCGCAGAGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCG
C10 GCGCGCTGTCGCAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG
C11 GCGCACTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG
* **.*****.************** .* ************** *****
C1 CACAACAACATGATCGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C2 CACAACAATATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C3 CACAACAACATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C4 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C5 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C6 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C7 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C8 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C9 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C10 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
C11 CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
******** *********** *****************************
C1 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
C2 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
C3 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
C4 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
C5 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTG
C6 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTG
C7 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTG
C8 GGCTGAGGCGCAGGCGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTG
C9 GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTG
C10 GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTG
C11 GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTG
*** *********************.*.***** ** ** **********
C1 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C2 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C3 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C4 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C5 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCCGAAAAG
C6 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C7 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C8 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C9 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C10 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
C11 TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
******************************************* ******
C1 CGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
C2 CGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
C3 CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
C4 CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
C5 CGTTCTTTGGAAGCCTACTTTGCCGTCCAGCCGAGGCCATCCGGTGAGAA
C6 CGCTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCGTCCGGTGAGAA
C7 CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
C8 CGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAA
C9 CGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAA
C10 CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
C11 CGTTCCCTGGAAGCCTACTTTGCCGTGCAGCCGAGGCCATCCGGTGAGAA
** ** ************* ***** ***********.***********
C1 AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C2 AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C3 AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C4 AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C5 AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C6 AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C7 AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C8 AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C9 AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C10 AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
C11 AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
******:** ****************************************
C1 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C2 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C3 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C4 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C5 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C6 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C7 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C8 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C9 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C10 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
C11 TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
**************************************************
C1 ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C2 ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C3 ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C4 ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C5 ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C6 ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C7 ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C8 ACACCATCAATGACTGGCCACGGTTCAGCGGGATTTGGATAC
C9 ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C10 ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
C11 ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
*****.********************.***************
>C1
ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG
ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
CGCCGCTAACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCATACGGG
GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCAG
TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
CACAACAACATGATCGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C2
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
CACAACAATATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C3
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA
CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
CACAACAACATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C4
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGATCCAACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C5
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
CAGGAAAATCCCTTTTCCCGGCAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TAGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GTGCGCTGTCGCAGAGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCCGAAAAG
CGTTCTTTGGAAGCCTACTTTGCCGTCCAGCCGAGGCCATCCGGTGAGAA
AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C6
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGTCACCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGCTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCGTCCGGTGAGAA
AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C7
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGTCACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C8
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGATCCAACGGGCTCAATGACCACGTTGGCGCCCATATCGGAGT
CGCCTCTAACGCCAACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGCCACCATGGACACTCAGCGGTACATCATCCTGTTATCACAGCGGCAG
TGGCAGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTAC
GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GAGCGCTGTCACAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCTGAGGCGCAGGCGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAA
AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCATCAATGACTGGCCACGGTTCAGCGGGATTTGGATAC
>C9
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA
TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC
GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA
GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG
ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG
CAGGAAAATCCTTTCTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGACCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCTGCCGCTGGCCTGCATCCCGACACAGACACCGATCCCCGCGAGCTG
GAGGCCTTCGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCG
GCGCGCTGTCGCAGAGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAA
AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C10
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGGAAAATCCTTTTTCCCGACAGATGCACCACTCGATGGACCAACTGGA
CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT
CCCCACTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG
GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCCCGCGAGCTG
GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GCGCGCTGTCGCAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA
AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C11
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC
GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA
GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG
ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG
CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA
CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGT
CCCCTCTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG
AATCACATGATGAGCCACCACCATCCGGGCACGCTAAGTGGCCACACGGG
GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG
TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCTCGCGAGCTG
GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC
GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG
GCGCACTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG
CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA
GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTG
TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG
CGTTCCCTGGAAGCCTACTTTGCCGTGCAGCCGAGGCCATCCGGTGAGAA
AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG
TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA
ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
>C11
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
TPSMTGHGSAGFGY
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 1092 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479800847
Setting output file names to "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1186763576
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4376139070
Seed = 1498396627
Swapseed = 1479800847
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 11 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 67 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -4053.125481 -- -24.640631
Chain 2 -- -4009.297880 -- -24.640631
Chain 3 -- -4060.533013 -- -24.640631
Chain 4 -- -4024.060769 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -4050.323770 -- -24.640631
Chain 2 -- -4064.951147 -- -24.640631
Chain 3 -- -4028.040099 -- -24.640631
Chain 4 -- -4015.203576 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-4053.125] (-4009.298) (-4060.533) (-4024.061) * [-4050.324] (-4064.951) (-4028.040) (-4015.204)
500 -- [-2433.132] (-2438.498) (-2409.412) (-2430.230) * (-2409.358) [-2419.791] (-2447.174) (-2417.742) -- 0:33:19
1000 -- [-2395.256] (-2401.381) (-2396.947) (-2398.796) * [-2359.786] (-2376.189) (-2403.082) (-2373.591) -- 0:16:39
1500 -- [-2357.509] (-2352.264) (-2349.962) (-2396.677) * (-2348.566) [-2334.943] (-2347.725) (-2352.804) -- 0:11:05
2000 -- (-2328.143) [-2324.143] (-2333.507) (-2350.438) * (-2336.879) [-2299.244] (-2323.130) (-2342.610) -- 0:08:19
2500 -- (-2320.731) [-2299.380] (-2307.127) (-2322.669) * (-2312.454) [-2270.637] (-2314.269) (-2321.302) -- 0:06:39
3000 -- (-2285.731) (-2284.895) [-2287.316] (-2314.089) * (-2291.030) [-2278.094] (-2295.609) (-2318.763) -- 0:11:04
3500 -- (-2273.142) [-2266.046] (-2283.259) (-2277.838) * (-2278.152) (-2267.292) [-2267.836] (-2291.478) -- 0:09:29
4000 -- (-2276.467) [-2257.346] (-2270.751) (-2273.447) * (-2273.743) (-2268.738) (-2273.716) [-2267.290] -- 0:08:18
4500 -- [-2260.083] (-2270.126) (-2272.941) (-2268.974) * (-2272.975) [-2257.079] (-2263.803) (-2263.733) -- 0:07:22
5000 -- (-2260.250) (-2263.848) [-2267.175] (-2269.306) * (-2258.285) [-2260.228] (-2262.122) (-2269.823) -- 0:06:38
Average standard deviation of split frequencies: 0.083189
5500 -- (-2270.554) (-2266.006) (-2270.377) [-2259.946] * [-2270.336] (-2270.693) (-2261.894) (-2275.497) -- 0:06:01
6000 -- [-2257.955] (-2261.186) (-2267.915) (-2274.866) * [-2268.190] (-2262.723) (-2263.063) (-2277.201) -- 0:08:17
6500 -- (-2266.046) (-2267.461) [-2274.076] (-2279.122) * (-2269.771) (-2265.646) (-2269.753) [-2265.854] -- 0:07:38
7000 -- [-2263.888] (-2277.010) (-2264.517) (-2262.128) * (-2267.056) [-2265.691] (-2266.280) (-2268.144) -- 0:07:05
7500 -- [-2261.710] (-2268.742) (-2260.544) (-2274.372) * (-2266.046) (-2266.468) (-2266.207) [-2267.023] -- 0:06:37
8000 -- [-2261.643] (-2281.314) (-2266.981) (-2268.081) * (-2279.646) (-2266.025) (-2274.723) [-2273.824] -- 0:06:12
8500 -- (-2263.736) (-2266.801) [-2260.758] (-2268.127) * (-2267.186) (-2274.885) [-2266.067] (-2263.756) -- 0:05:49
9000 -- (-2265.307) [-2257.564] (-2270.184) (-2268.171) * (-2257.923) (-2272.539) [-2269.754] (-2268.920) -- 0:05:30
9500 -- (-2259.570) (-2277.467) (-2266.211) [-2259.545] * (-2264.916) [-2264.316] (-2269.002) (-2271.471) -- 0:06:57
10000 -- [-2267.648] (-2267.295) (-2273.023) (-2268.404) * (-2265.115) [-2259.391] (-2279.662) (-2275.861) -- 0:06:36
Average standard deviation of split frequencies: 0.080102
10500 -- [-2269.667] (-2269.083) (-2260.174) (-2278.699) * (-2278.809) [-2260.674] (-2279.028) (-2273.036) -- 0:06:16
11000 -- (-2272.945) (-2261.176) [-2260.020] (-2273.822) * (-2265.744) (-2263.178) [-2271.009] (-2259.977) -- 0:05:59
11500 -- [-2261.337] (-2258.656) (-2271.788) (-2260.916) * [-2260.104] (-2255.858) (-2282.695) (-2258.925) -- 0:05:43
12000 -- [-2265.564] (-2276.647) (-2267.795) (-2282.287) * (-2268.369) [-2258.897] (-2268.957) (-2275.622) -- 0:05:29
12500 -- (-2275.723) (-2261.887) [-2271.633] (-2274.253) * [-2262.114] (-2271.117) (-2268.578) (-2269.641) -- 0:05:16
13000 -- (-2262.078) (-2273.217) (-2275.742) [-2263.555] * (-2262.544) (-2271.161) [-2270.662] (-2264.729) -- 0:06:19
13500 -- (-2268.835) (-2269.801) [-2275.957] (-2272.567) * (-2264.612) (-2283.073) [-2271.136] (-2270.969) -- 0:06:05
14000 -- [-2263.277] (-2273.223) (-2277.681) (-2264.298) * [-2266.052] (-2262.840) (-2263.618) (-2271.956) -- 0:05:52
14500 -- (-2278.080) [-2259.636] (-2272.912) (-2272.504) * (-2263.443) (-2265.209) (-2267.351) [-2262.653] -- 0:05:39
15000 -- (-2267.928) (-2268.999) (-2269.589) [-2266.854] * (-2278.574) (-2264.783) [-2262.168] (-2267.465) -- 0:05:28
Average standard deviation of split frequencies: 0.050508
15500 -- [-2275.815] (-2259.472) (-2268.836) (-2269.566) * (-2269.096) (-2273.451) (-2274.790) [-2259.608] -- 0:05:17
16000 -- [-2261.125] (-2271.254) (-2270.251) (-2270.471) * (-2264.322) (-2289.434) [-2264.888] (-2272.820) -- 0:05:07
16500 -- [-2261.345] (-2269.740) (-2271.535) (-2277.372) * [-2262.636] (-2263.941) (-2260.986) (-2263.110) -- 0:05:57
17000 -- [-2259.770] (-2263.817) (-2266.748) (-2267.341) * [-2269.743] (-2265.733) (-2270.459) (-2272.701) -- 0:05:46
17500 -- (-2268.906) (-2264.981) [-2263.872] (-2266.230) * [-2268.627] (-2268.732) (-2269.146) (-2271.324) -- 0:05:36
18000 -- (-2257.056) [-2264.365] (-2255.119) (-2276.869) * (-2266.217) (-2277.580) (-2278.316) [-2261.344] -- 0:05:27
18500 -- (-2274.339) (-2268.451) [-2267.420] (-2267.767) * [-2269.704] (-2277.696) (-2285.293) (-2264.163) -- 0:05:18
19000 -- [-2258.211] (-2267.287) (-2263.160) (-2279.604) * (-2271.342) (-2272.992) [-2270.784] (-2274.387) -- 0:05:09
19500 -- (-2260.958) [-2263.032] (-2275.631) (-2260.429) * (-2271.844) [-2260.947] (-2280.618) (-2278.698) -- 0:05:01
20000 -- (-2272.498) (-2260.283) (-2278.496) [-2263.417] * [-2264.403] (-2269.151) (-2279.721) (-2261.869) -- 0:05:43
Average standard deviation of split frequencies: 0.061411
20500 -- (-2273.645) [-2255.413] (-2276.641) (-2263.670) * [-2268.082] (-2269.293) (-2289.073) (-2273.660) -- 0:05:34
21000 -- [-2259.972] (-2260.424) (-2269.290) (-2272.091) * [-2264.127] (-2277.084) (-2269.511) (-2265.977) -- 0:05:26
21500 -- [-2274.212] (-2268.748) (-2261.891) (-2263.214) * (-2264.155) (-2270.105) [-2264.273] (-2257.011) -- 0:05:18
22000 -- (-2260.595) (-2272.763) (-2262.904) [-2260.016] * (-2258.653) (-2275.908) (-2264.259) [-2265.530] -- 0:05:11
22500 -- (-2257.093) [-2254.146] (-2264.671) (-2276.932) * (-2267.293) (-2268.631) (-2262.138) [-2264.444] -- 0:05:04
23000 -- (-2267.496) (-2269.359) (-2272.855) [-2269.927] * (-2265.158) [-2260.765] (-2266.525) (-2265.304) -- 0:04:57
23500 -- (-2266.790) [-2263.985] (-2273.072) (-2275.465) * (-2262.412) [-2255.918] (-2268.789) (-2261.979) -- 0:05:32
24000 -- (-2264.850) (-2259.702) [-2261.087] (-2264.163) * (-2266.341) (-2272.445) [-2259.891] (-2276.324) -- 0:05:25
24500 -- (-2273.328) (-2273.081) [-2265.501] (-2269.819) * (-2268.926) (-2274.160) (-2260.751) [-2274.937] -- 0:05:18
25000 -- [-2264.874] (-2274.305) (-2268.363) (-2269.417) * [-2263.381] (-2264.037) (-2262.043) (-2264.034) -- 0:05:12
Average standard deviation of split frequencies: 0.069934
25500 -- [-2261.907] (-2275.096) (-2267.671) (-2265.392) * (-2269.773) (-2281.904) [-2260.787] (-2263.755) -- 0:05:05
26000 -- (-2267.418) (-2278.194) (-2272.823) [-2271.677] * (-2275.531) (-2264.208) (-2259.779) [-2269.285] -- 0:04:59
26500 -- (-2256.766) (-2282.264) (-2259.859) [-2260.167] * (-2264.109) [-2274.410] (-2261.021) (-2280.300) -- 0:04:53
27000 -- (-2263.814) (-2266.583) [-2258.311] (-2282.593) * (-2268.017) (-2275.313) [-2265.157] (-2273.117) -- 0:05:24
27500 -- [-2258.282] (-2273.289) (-2267.197) (-2269.466) * (-2270.331) (-2274.984) (-2271.639) [-2261.245] -- 0:05:18
28000 -- (-2272.176) (-2271.031) [-2257.460] (-2260.247) * (-2274.401) (-2273.025) [-2259.748] (-2265.745) -- 0:05:12
28500 -- [-2252.896] (-2260.337) (-2273.230) (-2264.029) * (-2271.413) [-2260.302] (-2266.864) (-2273.375) -- 0:05:06
29000 -- [-2272.563] (-2264.646) (-2267.513) (-2261.584) * (-2264.930) (-2260.169) (-2264.812) [-2260.438] -- 0:05:01
29500 -- [-2268.193] (-2265.553) (-2265.605) (-2264.412) * (-2262.400) [-2254.175] (-2262.762) (-2270.990) -- 0:04:56
30000 -- (-2273.947) [-2267.714] (-2268.140) (-2265.313) * [-2260.822] (-2260.714) (-2266.132) (-2269.394) -- 0:04:51
Average standard deviation of split frequencies: 0.064782
30500 -- (-2264.294) (-2269.493) (-2262.910) [-2260.341] * (-2265.551) [-2260.333] (-2270.489) (-2267.360) -- 0:05:17
31000 -- (-2263.856) (-2272.720) [-2265.313] (-2267.855) * [-2258.686] (-2273.442) (-2270.227) (-2275.684) -- 0:05:12
31500 -- [-2255.760] (-2273.634) (-2275.885) (-2260.991) * (-2276.638) (-2261.841) (-2268.830) [-2266.141] -- 0:05:07
32000 -- (-2272.975) [-2256.750] (-2279.897) (-2269.336) * (-2265.104) [-2267.906] (-2263.217) (-2267.220) -- 0:05:02
32500 -- (-2271.713) (-2261.841) (-2265.386) [-2256.256] * (-2274.000) (-2277.796) (-2265.127) [-2268.294] -- 0:04:57
33000 -- [-2262.952] (-2265.881) (-2274.333) (-2260.407) * [-2259.968] (-2264.500) (-2272.516) (-2264.990) -- 0:04:53
33500 -- [-2265.170] (-2268.807) (-2271.964) (-2268.905) * (-2260.939) (-2262.909) (-2269.297) [-2257.275] -- 0:05:17
34000 -- (-2259.632) (-2265.564) (-2272.892) [-2258.296] * (-2264.440) (-2270.976) [-2263.183] (-2275.583) -- 0:05:12
34500 -- (-2267.078) (-2262.306) [-2261.975] (-2270.199) * [-2260.946] (-2273.924) (-2271.606) (-2271.886) -- 0:05:07
35000 -- [-2266.459] (-2269.156) (-2268.815) (-2268.301) * (-2277.956) (-2270.746) (-2268.256) [-2258.267] -- 0:05:03
Average standard deviation of split frequencies: 0.056407
35500 -- (-2267.940) (-2265.141) [-2265.502] (-2278.404) * (-2270.244) [-2267.403] (-2270.489) (-2271.437) -- 0:04:58
36000 -- (-2267.878) (-2275.444) [-2266.285] (-2259.470) * (-2275.085) [-2266.145] (-2279.788) (-2260.135) -- 0:05:21
36500 -- (-2260.751) [-2262.416] (-2274.608) (-2280.844) * (-2265.433) (-2265.968) [-2260.962] (-2269.537) -- 0:05:16
37000 -- (-2274.904) [-2266.165] (-2264.984) (-2263.261) * (-2270.161) (-2270.683) [-2259.469] (-2264.439) -- 0:05:12
37500 -- [-2259.108] (-2283.950) (-2273.006) (-2273.866) * (-2268.956) (-2260.500) (-2272.230) [-2263.391] -- 0:05:08
38000 -- (-2268.534) (-2266.802) (-2272.423) [-2268.538] * (-2275.589) (-2270.561) (-2263.059) [-2264.339] -- 0:05:03
38500 -- (-2272.763) (-2272.705) (-2266.173) [-2265.170] * (-2269.460) (-2278.661) (-2263.164) [-2262.754] -- 0:04:59
39000 -- (-2273.719) (-2278.850) [-2274.006] (-2286.507) * (-2270.961) (-2266.136) (-2264.138) [-2265.749] -- 0:04:55
39500 -- (-2265.949) (-2264.917) (-2259.194) [-2277.983] * (-2266.157) [-2260.755] (-2281.367) (-2277.021) -- 0:05:16
40000 -- (-2272.475) (-2262.163) [-2272.135] (-2289.225) * (-2279.099) [-2258.363] (-2263.465) (-2283.664) -- 0:05:12
Average standard deviation of split frequencies: 0.056176
40500 -- (-2284.402) (-2262.377) [-2259.091] (-2271.213) * [-2259.955] (-2267.954) (-2272.525) (-2271.669) -- 0:05:07
41000 -- (-2262.352) (-2264.323) [-2268.998] (-2266.014) * (-2261.274) (-2265.571) (-2266.079) [-2255.062] -- 0:05:04
41500 -- (-2268.505) (-2274.170) [-2265.540] (-2263.226) * (-2266.229) [-2259.757] (-2272.929) (-2267.410) -- 0:05:00
42000 -- (-2264.243) [-2261.900] (-2266.041) (-2267.573) * (-2267.162) [-2262.632] (-2266.718) (-2299.653) -- 0:04:56
42500 -- (-2268.760) [-2275.674] (-2272.654) (-2266.372) * (-2270.526) (-2271.325) [-2268.213] (-2271.281) -- 0:04:52
43000 -- [-2271.835] (-2267.525) (-2270.086) (-2266.600) * (-2260.814) (-2272.240) (-2274.189) [-2265.983] -- 0:05:11
43500 -- (-2272.415) (-2258.430) (-2290.628) [-2256.670] * [-2263.395] (-2273.332) (-2272.923) (-2273.453) -- 0:05:07
44000 -- (-2268.833) (-2267.960) [-2267.279] (-2279.022) * [-2268.550] (-2262.720) (-2271.441) (-2264.902) -- 0:05:04
44500 -- (-2269.931) [-2263.665] (-2268.887) (-2264.761) * (-2276.577) [-2264.421] (-2265.544) (-2258.187) -- 0:05:00
45000 -- (-2262.701) [-2269.117] (-2267.291) (-2264.618) * [-2263.827] (-2273.162) (-2275.361) (-2269.935) -- 0:04:57
Average standard deviation of split frequencies: 0.041724
45500 -- (-2255.100) (-2266.110) (-2273.347) [-2253.925] * (-2280.664) (-2258.115) [-2268.421] (-2269.382) -- 0:04:53
46000 -- (-2274.362) (-2266.091) [-2258.723] (-2263.482) * [-2263.796] (-2264.543) (-2274.695) (-2254.371) -- 0:05:11
46500 -- (-2267.891) (-2257.961) (-2266.633) [-2267.674] * (-2267.103) (-2263.940) (-2267.449) [-2263.308] -- 0:05:07
47000 -- [-2262.343] (-2262.411) (-2274.380) (-2265.750) * (-2279.851) [-2263.693] (-2273.561) (-2260.421) -- 0:05:04
47500 -- (-2257.008) (-2277.152) [-2268.735] (-2266.917) * (-2267.075) [-2267.852] (-2263.047) (-2269.808) -- 0:05:00
48000 -- (-2267.751) (-2280.711) [-2265.449] (-2264.475) * (-2263.758) [-2262.364] (-2274.535) (-2273.187) -- 0:04:57
48500 -- (-2272.862) (-2277.210) [-2268.778] (-2269.066) * [-2257.194] (-2265.886) (-2269.543) (-2269.336) -- 0:04:54
49000 -- (-2276.719) (-2269.701) [-2265.626] (-2274.653) * (-2264.741) (-2267.704) (-2268.236) [-2262.041] -- 0:04:51
49500 -- [-2266.720] (-2267.866) (-2264.279) (-2268.849) * (-2266.726) [-2263.137] (-2262.929) (-2258.354) -- 0:04:48
50000 -- (-2272.880) (-2264.463) [-2260.084] (-2260.736) * (-2278.071) (-2264.061) (-2262.751) [-2265.364] -- 0:05:04
Average standard deviation of split frequencies: 0.040539
50500 -- (-2265.655) (-2264.273) [-2265.024] (-2274.726) * (-2269.815) (-2268.079) [-2265.858] (-2267.488) -- 0:05:00
51000 -- (-2264.066) (-2263.272) [-2266.429] (-2276.034) * [-2263.751] (-2279.546) (-2263.648) (-2285.202) -- 0:04:57
51500 -- (-2260.910) [-2258.748] (-2265.534) (-2281.342) * (-2283.893) (-2271.725) (-2281.469) [-2270.416] -- 0:04:54
52000 -- (-2268.369) [-2266.587] (-2255.929) (-2286.255) * [-2269.433] (-2268.717) (-2279.492) (-2269.439) -- 0:04:51
52500 -- (-2265.110) (-2285.582) (-2257.694) [-2261.073] * [-2269.326] (-2273.643) (-2261.375) (-2265.549) -- 0:04:48
53000 -- (-2265.628) (-2281.731) [-2270.484] (-2270.137) * [-2262.995] (-2274.703) (-2269.994) (-2261.152) -- 0:04:45
53500 -- [-2264.816] (-2278.557) (-2261.123) (-2269.887) * (-2260.148) (-2277.571) [-2264.782] (-2268.751) -- 0:05:00
54000 -- (-2264.872) [-2268.155] (-2258.766) (-2270.880) * (-2276.818) (-2271.656) [-2263.615] (-2267.762) -- 0:04:57
54500 -- (-2271.230) (-2272.978) (-2261.301) [-2265.594] * (-2267.469) (-2270.732) (-2258.855) [-2254.169] -- 0:04:54
55000 -- [-2260.154] (-2260.830) (-2260.227) (-2275.198) * (-2274.096) (-2267.820) [-2263.237] (-2260.847) -- 0:04:52
Average standard deviation of split frequencies: 0.026456
55500 -- (-2267.686) (-2267.519) [-2260.550] (-2268.318) * [-2263.614] (-2267.144) (-2263.874) (-2283.358) -- 0:04:49
56000 -- (-2266.626) (-2268.465) [-2260.878] (-2263.787) * (-2268.399) [-2261.733] (-2266.357) (-2260.113) -- 0:05:03
56500 -- (-2264.063) (-2267.968) [-2259.960] (-2268.198) * [-2266.576] (-2272.045) (-2269.643) (-2263.814) -- 0:05:00
57000 -- (-2272.497) [-2266.766] (-2260.334) (-2273.068) * (-2269.257) (-2260.586) [-2273.061] (-2278.085) -- 0:04:57
57500 -- (-2268.645) [-2263.269] (-2266.025) (-2263.266) * (-2272.030) [-2260.928] (-2291.092) (-2282.912) -- 0:04:55
58000 -- (-2260.983) [-2262.229] (-2271.574) (-2275.373) * (-2258.765) (-2272.772) [-2257.830] (-2284.169) -- 0:04:52
58500 -- (-2262.973) (-2261.041) [-2268.643] (-2266.260) * [-2265.036] (-2273.190) (-2265.497) (-2266.024) -- 0:05:05
59000 -- (-2277.030) (-2256.964) [-2263.681] (-2277.176) * (-2262.860) (-2261.825) (-2266.637) [-2258.804] -- 0:05:03
59500 -- (-2272.749) [-2256.180] (-2261.008) (-2262.806) * [-2262.953] (-2269.502) (-2262.833) (-2259.994) -- 0:05:00
60000 -- (-2273.976) [-2260.266] (-2256.322) (-2270.835) * [-2255.984] (-2264.144) (-2265.828) (-2261.880) -- 0:04:57
Average standard deviation of split frequencies: 0.034412
60500 -- (-2261.590) [-2259.378] (-2268.154) (-2271.252) * (-2275.501) [-2268.961] (-2262.277) (-2255.321) -- 0:04:55
61000 -- (-2271.370) (-2262.191) (-2257.651) [-2260.853] * (-2270.106) [-2269.575] (-2268.260) (-2263.723) -- 0:04:52
61500 -- (-2261.026) (-2268.667) [-2263.287] (-2261.677) * (-2266.794) (-2260.468) (-2260.981) [-2260.682] -- 0:04:49
62000 -- (-2272.344) [-2263.338] (-2272.896) (-2281.073) * (-2261.976) (-2271.917) [-2266.595] (-2270.828) -- 0:05:02
62500 -- (-2262.530) [-2265.749] (-2262.834) (-2264.887) * [-2258.504] (-2276.695) (-2261.998) (-2280.736) -- 0:05:00
63000 -- (-2266.930) (-2265.867) (-2266.946) [-2275.868] * (-2266.537) (-2280.965) [-2266.835] (-2262.268) -- 0:04:57
63500 -- (-2264.049) (-2272.509) [-2259.701] (-2282.545) * (-2271.448) (-2271.766) [-2269.765] (-2264.986) -- 0:04:54
64000 -- (-2272.778) (-2269.738) (-2268.200) [-2274.059] * (-2274.352) (-2268.061) [-2271.602] (-2267.330) -- 0:04:52
64500 -- (-2274.607) (-2260.692) (-2259.961) [-2261.875] * (-2266.830) (-2264.543) (-2282.137) [-2257.292] -- 0:04:50
65000 -- (-2267.825) [-2264.449] (-2267.790) (-2278.920) * (-2278.840) [-2265.878] (-2262.577) (-2264.637) -- 0:04:47
Average standard deviation of split frequencies: 0.029046
65500 -- (-2270.423) [-2257.990] (-2269.252) (-2277.010) * (-2271.666) (-2276.423) (-2267.281) [-2265.381] -- 0:04:59
66000 -- (-2269.019) [-2259.851] (-2274.794) (-2266.964) * (-2281.478) (-2268.854) (-2266.738) [-2271.775] -- 0:04:57
66500 -- (-2271.003) [-2265.959] (-2273.562) (-2272.744) * (-2263.618) (-2275.572) (-2269.584) [-2264.048] -- 0:04:54
67000 -- (-2272.380) [-2265.349] (-2267.055) (-2272.831) * [-2259.490] (-2265.849) (-2263.438) (-2275.672) -- 0:04:52
67500 -- [-2267.721] (-2259.357) (-2267.350) (-2267.906) * [-2267.835] (-2273.508) (-2277.496) (-2262.020) -- 0:04:50
68000 -- (-2263.436) (-2274.590) (-2267.233) [-2263.119] * (-2280.656) [-2263.798] (-2268.186) (-2262.807) -- 0:04:47
68500 -- (-2275.766) [-2255.169] (-2268.244) (-2262.506) * (-2276.763) [-2262.327] (-2272.738) (-2261.362) -- 0:04:45
69000 -- [-2263.742] (-2256.848) (-2286.033) (-2256.350) * [-2273.003] (-2259.938) (-2271.963) (-2255.736) -- 0:04:56
69500 -- (-2278.297) (-2274.719) (-2277.409) [-2270.840] * (-2266.839) (-2266.179) (-2266.342) [-2264.354] -- 0:04:54
70000 -- (-2270.570) [-2267.188] (-2274.895) (-2276.583) * (-2270.381) [-2253.093] (-2272.509) (-2274.909) -- 0:04:52
Average standard deviation of split frequencies: 0.033799
70500 -- [-2267.865] (-2260.971) (-2270.941) (-2284.053) * (-2256.714) (-2262.633) (-2269.096) [-2262.183] -- 0:04:50
71000 -- [-2267.620] (-2264.759) (-2266.593) (-2264.380) * (-2265.786) (-2263.463) [-2267.029] (-2263.677) -- 0:04:47
71500 -- (-2260.112) (-2268.248) [-2266.531] (-2276.293) * (-2260.182) [-2261.289] (-2278.120) (-2272.198) -- 0:04:58
72000 -- (-2265.477) (-2275.109) (-2267.331) [-2264.021] * (-2262.688) (-2262.140) [-2270.811] (-2261.451) -- 0:04:56
72500 -- [-2257.025] (-2263.795) (-2274.359) (-2280.518) * [-2268.069] (-2262.055) (-2266.573) (-2275.944) -- 0:04:54
73000 -- (-2264.405) (-2259.947) (-2270.365) [-2270.504] * (-2285.790) (-2278.798) [-2263.479] (-2267.312) -- 0:04:52
73500 -- (-2263.384) (-2261.825) (-2275.968) [-2269.991] * [-2258.813] (-2266.393) (-2263.743) (-2264.828) -- 0:04:49
74000 -- (-2275.369) (-2271.138) [-2264.611] (-2264.423) * (-2261.977) (-2265.254) [-2258.376] (-2275.720) -- 0:04:47
74500 -- (-2264.056) (-2280.035) [-2264.868] (-2278.877) * (-2271.821) [-2268.031] (-2269.449) (-2268.327) -- 0:04:45
75000 -- (-2266.074) (-2272.279) (-2259.274) [-2274.902] * (-2263.544) (-2266.197) [-2266.453] (-2276.639) -- 0:04:56
Average standard deviation of split frequencies: 0.035444
75500 -- [-2262.147] (-2269.032) (-2259.893) (-2274.831) * (-2271.581) (-2269.209) [-2266.733] (-2260.285) -- 0:04:53
76000 -- (-2262.358) (-2270.047) [-2266.346] (-2268.756) * (-2266.849) (-2267.371) (-2267.827) [-2261.553] -- 0:04:51
76500 -- (-2268.010) [-2265.086] (-2270.074) (-2280.561) * (-2267.902) [-2269.391] (-2269.891) (-2265.750) -- 0:04:49
77000 -- [-2264.220] (-2272.807) (-2270.769) (-2261.876) * (-2270.620) [-2257.190] (-2271.929) (-2254.536) -- 0:04:47
77500 -- (-2263.234) (-2269.623) [-2266.297] (-2262.023) * (-2273.143) [-2269.721] (-2266.439) (-2260.960) -- 0:04:45
78000 -- (-2268.309) (-2257.141) [-2264.889] (-2266.975) * (-2264.175) (-2277.129) (-2265.223) [-2259.824] -- 0:04:55
78500 -- [-2263.572] (-2259.150) (-2271.716) (-2271.675) * [-2260.285] (-2259.496) (-2263.909) (-2263.377) -- 0:04:53
79000 -- (-2268.093) (-2260.419) [-2273.252] (-2268.353) * (-2279.965) [-2267.820] (-2265.189) (-2262.548) -- 0:04:51
79500 -- (-2279.479) (-2260.392) (-2279.212) [-2266.377] * (-2263.963) [-2269.024] (-2271.149) (-2267.610) -- 0:04:49
80000 -- (-2267.349) [-2254.375] (-2272.737) (-2259.873) * [-2262.214] (-2272.547) (-2271.797) (-2262.213) -- 0:04:47
Average standard deviation of split frequencies: 0.031167
80500 -- [-2261.456] (-2258.773) (-2269.903) (-2274.340) * (-2270.613) (-2277.803) [-2265.035] (-2268.943) -- 0:04:56
81000 -- (-2266.128) (-2272.480) [-2258.376] (-2267.336) * (-2265.553) (-2269.829) [-2260.579] (-2262.229) -- 0:04:54
81500 -- (-2269.479) [-2269.049] (-2262.910) (-2266.994) * (-2270.391) (-2276.853) [-2262.979] (-2264.396) -- 0:04:53
82000 -- (-2273.364) [-2267.048] (-2265.814) (-2278.882) * (-2269.862) (-2260.796) (-2269.602) [-2259.569] -- 0:04:51
82500 -- (-2269.849) [-2263.220] (-2268.184) (-2269.515) * (-2279.742) (-2273.984) [-2264.322] (-2270.206) -- 0:04:49
83000 -- (-2264.863) (-2267.428) [-2261.071] (-2271.233) * (-2272.705) (-2268.482) [-2260.178] (-2265.682) -- 0:04:47
83500 -- (-2268.980) [-2254.792] (-2262.253) (-2281.832) * (-2263.152) (-2277.105) (-2264.141) [-2257.726] -- 0:04:45
84000 -- (-2267.607) (-2252.860) [-2259.854] (-2270.162) * (-2271.079) (-2271.791) [-2262.393] (-2267.417) -- 0:04:54
84500 -- (-2268.791) [-2249.750] (-2259.216) (-2275.542) * (-2271.662) (-2275.532) [-2256.839] (-2267.643) -- 0:04:52
85000 -- [-2262.852] (-2268.323) (-2267.740) (-2279.903) * (-2283.357) (-2257.830) (-2270.182) [-2262.742] -- 0:04:50
Average standard deviation of split frequencies: 0.033254
85500 -- (-2267.070) (-2266.993) (-2267.013) [-2266.014] * (-2272.892) (-2269.787) [-2261.647] (-2272.491) -- 0:04:48
86000 -- [-2267.436] (-2274.977) (-2266.354) (-2272.944) * (-2257.877) (-2275.245) (-2278.938) [-2274.367] -- 0:04:46
86500 -- (-2272.437) [-2262.324] (-2268.415) (-2280.043) * (-2268.551) [-2267.230] (-2259.895) (-2259.211) -- 0:04:55
87000 -- [-2267.094] (-2269.342) (-2258.596) (-2272.516) * (-2259.665) [-2265.341] (-2262.189) (-2259.865) -- 0:04:53
87500 -- (-2263.227) (-2263.551) [-2259.146] (-2271.380) * (-2268.886) (-2261.804) (-2262.553) [-2257.724] -- 0:04:52
88000 -- [-2257.492] (-2269.258) (-2263.614) (-2259.837) * (-2261.933) [-2256.582] (-2266.838) (-2267.004) -- 0:04:50
88500 -- (-2257.606) (-2273.910) (-2266.299) [-2264.508] * (-2279.222) [-2261.178] (-2270.972) (-2266.175) -- 0:04:48
89000 -- [-2260.635] (-2265.150) (-2261.901) (-2266.873) * (-2277.342) (-2261.677) (-2284.329) [-2272.830] -- 0:04:46
89500 -- (-2269.791) (-2270.724) [-2269.933] (-2263.359) * (-2265.217) [-2267.815] (-2276.772) (-2278.605) -- 0:04:55
90000 -- (-2273.745) (-2260.037) (-2265.945) [-2264.530] * [-2255.072] (-2271.591) (-2267.636) (-2281.347) -- 0:04:53
Average standard deviation of split frequencies: 0.029809
90500 -- (-2268.674) (-2259.264) [-2259.801] (-2282.308) * [-2267.748] (-2271.653) (-2272.099) (-2285.121) -- 0:04:51
91000 -- (-2267.847) [-2263.247] (-2265.821) (-2269.535) * (-2272.783) (-2280.887) [-2260.573] (-2269.032) -- 0:04:49
91500 -- (-2267.958) [-2263.267] (-2263.890) (-2269.278) * (-2262.882) (-2269.251) [-2263.085] (-2263.480) -- 0:04:47
92000 -- (-2263.551) [-2262.510] (-2265.684) (-2273.214) * (-2262.033) (-2271.384) [-2267.631] (-2271.207) -- 0:04:46
92500 -- (-2262.086) (-2269.130) (-2269.720) [-2261.379] * (-2276.156) (-2267.611) (-2279.252) [-2258.755] -- 0:04:44
93000 -- (-2268.115) [-2256.295] (-2266.044) (-2275.013) * [-2259.104] (-2260.473) (-2255.818) (-2265.014) -- 0:04:52
93500 -- (-2261.519) (-2274.260) (-2260.087) [-2265.155] * [-2265.288] (-2262.763) (-2271.229) (-2274.397) -- 0:04:50
94000 -- (-2268.149) (-2264.868) [-2257.389] (-2275.733) * (-2265.594) (-2271.257) [-2266.511] (-2280.520) -- 0:04:49
94500 -- (-2266.623) [-2256.063] (-2264.427) (-2267.835) * (-2281.427) [-2255.797] (-2262.067) (-2270.776) -- 0:04:47
95000 -- (-2271.068) [-2260.221] (-2267.043) (-2261.869) * (-2266.073) [-2266.650] (-2268.687) (-2269.094) -- 0:04:45
Average standard deviation of split frequencies: 0.027171
95500 -- (-2269.495) (-2269.339) [-2259.085] (-2263.560) * [-2257.950] (-2262.855) (-2271.366) (-2267.053) -- 0:04:53
96000 -- (-2269.113) (-2269.115) (-2268.737) [-2261.448] * [-2263.915] (-2262.568) (-2274.744) (-2261.712) -- 0:04:51
96500 -- [-2264.285] (-2269.642) (-2276.322) (-2258.482) * (-2267.584) [-2258.126] (-2263.906) (-2264.159) -- 0:04:50
97000 -- [-2267.562] (-2268.280) (-2269.933) (-2268.552) * (-2265.632) [-2263.802] (-2260.545) (-2275.211) -- 0:04:48
97500 -- (-2280.167) (-2273.147) (-2269.266) [-2263.265] * (-2263.826) (-2272.139) [-2266.428] (-2260.873) -- 0:04:56
98000 -- [-2264.441] (-2260.669) (-2263.842) (-2263.989) * (-2261.237) [-2268.054] (-2269.987) (-2268.632) -- 0:04:54
98500 -- (-2265.319) (-2262.391) [-2267.757] (-2272.715) * (-2259.695) (-2266.717) [-2270.081] (-2260.498) -- 0:04:52
99000 -- (-2268.175) (-2263.922) [-2267.122] (-2266.475) * [-2261.677] (-2266.398) (-2274.010) (-2272.168) -- 0:04:51
99500 -- (-2276.417) (-2265.924) (-2269.569) [-2262.478] * (-2265.033) (-2260.525) (-2269.557) [-2269.429] -- 0:04:49
100000 -- (-2260.914) (-2274.514) [-2269.071] (-2259.170) * [-2264.131] (-2272.711) (-2265.318) (-2262.423) -- 0:04:48
Average standard deviation of split frequencies: 0.023102
100500 -- [-2257.682] (-2270.113) (-2270.384) (-2261.711) * (-2274.928) (-2277.626) (-2254.963) [-2262.754] -- 0:04:46
101000 -- (-2258.882) (-2270.337) (-2284.582) [-2260.997] * (-2266.771) [-2266.404] (-2266.269) (-2273.652) -- 0:04:53
101500 -- (-2264.195) (-2263.977) (-2276.581) [-2268.061] * (-2271.207) (-2267.165) [-2257.909] (-2278.792) -- 0:04:52
102000 -- [-2265.220] (-2261.082) (-2277.466) (-2276.138) * [-2261.669] (-2266.485) (-2266.997) (-2277.934) -- 0:04:50
102500 -- (-2266.593) (-2275.239) [-2266.139] (-2276.926) * (-2265.083) [-2272.352] (-2269.416) (-2261.247) -- 0:04:48
103000 -- (-2264.437) [-2266.567] (-2272.059) (-2265.551) * (-2281.907) [-2263.519] (-2280.157) (-2260.149) -- 0:04:47
103500 -- (-2282.610) (-2268.865) (-2271.742) [-2258.814] * (-2267.492) (-2263.911) (-2271.200) [-2260.970] -- 0:04:45
104000 -- (-2270.831) (-2268.619) [-2261.876] (-2265.475) * (-2266.112) [-2267.992] (-2280.510) (-2271.076) -- 0:04:44
104500 -- (-2268.694) (-2273.016) [-2263.737] (-2279.664) * (-2273.037) [-2264.084] (-2272.609) (-2268.518) -- 0:04:51
105000 -- (-2258.459) (-2263.138) (-2279.460) [-2264.938] * (-2270.128) (-2270.077) (-2267.140) [-2271.565] -- 0:04:49
Average standard deviation of split frequencies: 0.019271
105500 -- (-2275.676) [-2258.345] (-2269.583) (-2260.807) * [-2282.651] (-2262.336) (-2264.286) (-2260.766) -- 0:04:48
106000 -- (-2266.629) (-2270.023) [-2265.766] (-2271.549) * (-2262.248) (-2266.279) [-2263.425] (-2278.676) -- 0:04:46
106500 -- (-2267.335) (-2257.969) (-2273.113) [-2254.598] * (-2271.799) [-2266.559] (-2263.744) (-2263.043) -- 0:04:45
107000 -- (-2271.543) (-2269.495) (-2273.817) [-2256.987] * (-2278.119) [-2260.585] (-2269.376) (-2268.662) -- 0:04:43
107500 -- [-2269.455] (-2267.035) (-2271.516) (-2259.992) * (-2284.155) [-2266.577] (-2279.574) (-2260.029) -- 0:04:50
108000 -- (-2285.182) (-2274.300) [-2257.905] (-2268.030) * [-2269.371] (-2263.258) (-2262.234) (-2262.891) -- 0:04:49
108500 -- (-2274.605) [-2267.564] (-2265.100) (-2265.985) * (-2266.837) [-2262.966] (-2282.194) (-2270.863) -- 0:04:47
109000 -- (-2267.516) (-2264.852) [-2265.969] (-2280.614) * (-2257.676) (-2269.099) (-2275.568) [-2259.744] -- 0:04:46
109500 -- [-2261.420] (-2268.045) (-2259.415) (-2280.884) * [-2267.842] (-2280.105) (-2269.624) (-2266.066) -- 0:04:44
110000 -- (-2275.035) [-2269.048] (-2267.884) (-2277.560) * (-2261.363) (-2274.968) [-2271.146] (-2266.136) -- 0:04:43
Average standard deviation of split frequencies: 0.017039
110500 -- (-2262.337) (-2267.074) (-2256.931) [-2270.715] * (-2274.922) (-2259.888) (-2264.797) [-2260.175] -- 0:04:41
111000 -- [-2269.370] (-2267.875) (-2271.867) (-2260.656) * (-2280.234) (-2270.110) [-2258.510] (-2253.863) -- 0:04:48
111500 -- (-2281.847) [-2268.614] (-2266.883) (-2254.829) * (-2288.976) [-2268.407] (-2279.896) (-2262.905) -- 0:04:46
112000 -- (-2276.190) (-2273.061) [-2254.949] (-2269.193) * [-2262.701] (-2272.065) (-2270.282) (-2269.207) -- 0:04:45
112500 -- (-2267.033) (-2265.385) (-2264.703) [-2267.788] * (-2267.560) (-2264.945) [-2259.397] (-2269.756) -- 0:04:44
113000 -- (-2261.447) (-2268.127) [-2265.460] (-2264.288) * (-2274.202) (-2272.167) (-2262.202) [-2264.937] -- 0:04:42
113500 -- [-2264.101] (-2270.415) (-2278.789) (-2265.495) * (-2262.199) [-2268.424] (-2284.644) (-2267.206) -- 0:04:41
114000 -- [-2261.614] (-2266.687) (-2262.451) (-2264.511) * (-2272.606) (-2270.524) [-2257.186] (-2274.282) -- 0:04:39
114500 -- [-2265.079] (-2268.965) (-2265.066) (-2265.245) * (-2281.313) [-2268.211] (-2262.480) (-2260.074) -- 0:04:46
115000 -- (-2271.764) (-2265.449) (-2268.559) [-2264.260] * (-2278.534) [-2263.273] (-2267.280) (-2274.996) -- 0:04:44
Average standard deviation of split frequencies: 0.018965
115500 -- (-2278.525) (-2256.615) [-2261.361] (-2269.741) * (-2263.207) (-2265.606) (-2270.851) [-2263.646] -- 0:04:43
116000 -- (-2259.907) (-2269.726) [-2268.427] (-2273.518) * (-2276.425) (-2270.856) [-2262.121] (-2267.034) -- 0:04:41
116500 -- (-2266.687) [-2264.602] (-2261.637) (-2275.777) * (-2273.063) (-2275.459) [-2268.872] (-2268.080) -- 0:04:40
117000 -- (-2277.987) (-2266.145) [-2262.501] (-2264.518) * (-2284.556) (-2264.710) (-2265.380) [-2259.307] -- 0:04:39
117500 -- (-2273.253) (-2285.878) (-2272.552) [-2262.562] * (-2271.495) [-2264.065] (-2270.011) (-2272.444) -- 0:04:45
118000 -- (-2273.857) [-2270.043] (-2267.822) (-2276.794) * (-2275.315) (-2267.399) [-2265.789] (-2278.704) -- 0:04:44
118500 -- [-2260.465] (-2267.540) (-2270.110) (-2263.400) * (-2268.772) (-2261.737) (-2278.009) [-2265.440] -- 0:04:42
119000 -- [-2260.142] (-2269.567) (-2273.213) (-2260.426) * (-2269.859) (-2259.976) (-2262.666) [-2263.431] -- 0:04:41
119500 -- (-2282.973) [-2266.092] (-2266.446) (-2258.768) * [-2266.587] (-2261.303) (-2268.527) (-2265.340) -- 0:04:39
120000 -- (-2267.748) [-2257.611] (-2263.051) (-2287.787) * (-2273.980) (-2269.987) [-2263.595] (-2262.202) -- 0:04:38
Average standard deviation of split frequencies: 0.015366
120500 -- (-2278.461) (-2268.270) (-2266.188) [-2266.959] * (-2279.749) (-2267.447) [-2269.273] (-2265.920) -- 0:04:37
121000 -- (-2277.418) (-2289.050) [-2256.462] (-2263.367) * (-2272.010) (-2259.315) (-2272.033) [-2262.650] -- 0:04:43
121500 -- (-2279.535) (-2264.883) (-2266.757) [-2268.212] * (-2273.135) [-2265.982] (-2269.781) (-2276.180) -- 0:04:41
122000 -- (-2271.519) (-2271.497) (-2275.628) [-2260.511] * (-2272.145) [-2260.918] (-2269.917) (-2270.533) -- 0:04:40
122500 -- [-2259.847] (-2271.913) (-2270.156) (-2268.771) * (-2270.839) [-2271.174] (-2273.638) (-2272.086) -- 0:04:39
123000 -- [-2271.504] (-2274.915) (-2272.046) (-2267.145) * (-2270.966) (-2275.319) [-2263.420] (-2271.322) -- 0:04:38
123500 -- [-2257.547] (-2274.793) (-2263.150) (-2268.699) * (-2261.038) (-2259.779) (-2271.564) [-2271.907] -- 0:04:36
124000 -- (-2272.554) [-2264.734] (-2268.515) (-2268.306) * (-2266.586) [-2260.355] (-2279.662) (-2270.108) -- 0:04:35
124500 -- (-2264.547) (-2269.452) (-2265.367) [-2254.107] * (-2264.175) (-2264.020) [-2264.584] (-2256.581) -- 0:04:41
125000 -- (-2270.830) (-2267.486) (-2262.519) [-2265.318] * (-2260.052) (-2275.662) [-2267.158] (-2268.884) -- 0:04:40
Average standard deviation of split frequencies: 0.020702
125500 -- [-2261.744] (-2267.083) (-2269.360) (-2270.859) * (-2260.728) (-2265.967) (-2273.533) [-2258.443] -- 0:04:38
126000 -- (-2262.623) [-2263.009] (-2259.853) (-2261.729) * (-2273.624) (-2265.705) [-2272.283] (-2279.746) -- 0:04:37
126500 -- (-2265.813) [-2270.069] (-2270.477) (-2271.084) * (-2270.374) (-2265.612) (-2258.397) [-2264.790] -- 0:04:36
127000 -- (-2264.036) [-2267.838] (-2266.936) (-2264.684) * (-2265.651) (-2262.018) (-2262.161) [-2274.633] -- 0:04:41
127500 -- [-2271.831] (-2273.563) (-2265.746) (-2276.118) * (-2267.529) (-2264.454) [-2270.379] (-2267.560) -- 0:04:40
128000 -- (-2277.548) (-2282.400) (-2272.825) [-2264.061] * (-2270.711) [-2260.742] (-2271.438) (-2260.392) -- 0:04:39
128500 -- [-2269.413] (-2267.218) (-2265.783) (-2260.774) * (-2271.081) [-2253.975] (-2271.947) (-2266.411) -- 0:04:38
129000 -- (-2261.016) (-2285.379) [-2258.663] (-2267.829) * (-2259.570) (-2267.707) [-2273.278] (-2280.843) -- 0:04:36
129500 -- (-2262.730) (-2267.870) [-2267.055] (-2278.538) * [-2260.961] (-2268.259) (-2271.518) (-2266.151) -- 0:04:35
130000 -- (-2263.236) (-2271.816) (-2277.911) [-2269.755] * (-2262.454) [-2272.492] (-2267.182) (-2262.845) -- 0:04:41
Average standard deviation of split frequencies: 0.020925
130500 -- (-2260.723) (-2279.244) [-2268.430] (-2266.474) * (-2264.108) (-2274.298) (-2263.009) [-2261.008] -- 0:04:39
131000 -- [-2258.881] (-2260.679) (-2271.478) (-2263.399) * (-2261.742) (-2271.039) (-2272.386) [-2259.673] -- 0:04:38
131500 -- [-2259.909] (-2256.724) (-2271.092) (-2276.834) * (-2264.089) (-2282.760) (-2263.994) [-2261.773] -- 0:04:37
132000 -- (-2268.823) [-2261.541] (-2272.391) (-2263.318) * [-2263.072] (-2268.134) (-2273.581) (-2263.511) -- 0:04:36
132500 -- [-2260.780] (-2264.521) (-2265.391) (-2270.826) * (-2269.466) [-2262.696] (-2266.077) (-2266.669) -- 0:04:34
133000 -- [-2265.851] (-2264.607) (-2273.616) (-2268.749) * (-2271.819) (-2271.736) [-2267.134] (-2271.390) -- 0:04:40
133500 -- (-2263.791) (-2276.549) [-2266.951] (-2279.891) * [-2266.342] (-2265.403) (-2273.361) (-2275.744) -- 0:04:39
134000 -- (-2269.185) [-2260.141] (-2268.663) (-2280.486) * (-2272.697) (-2263.003) (-2273.364) [-2257.930] -- 0:04:37
134500 -- (-2262.188) (-2264.659) [-2273.047] (-2267.032) * (-2265.651) [-2267.313] (-2263.976) (-2283.152) -- 0:04:36
135000 -- (-2261.448) [-2261.620] (-2276.063) (-2268.136) * [-2258.933] (-2273.983) (-2264.169) (-2272.155) -- 0:04:35
Average standard deviation of split frequencies: 0.023570
135500 -- [-2259.243] (-2264.228) (-2258.383) (-2262.454) * [-2261.677] (-2273.540) (-2276.901) (-2267.377) -- 0:04:40
136000 -- (-2268.229) (-2267.450) [-2266.032] (-2264.889) * (-2265.326) (-2273.814) [-2267.964] (-2267.467) -- 0:04:39
136500 -- (-2260.423) (-2268.436) [-2263.548] (-2269.420) * (-2265.479) (-2273.550) [-2266.202] (-2262.510) -- 0:04:38
137000 -- [-2263.841] (-2256.973) (-2262.016) (-2272.995) * (-2276.855) (-2267.744) [-2266.544] (-2264.859) -- 0:04:37
137500 -- (-2266.133) (-2268.649) [-2263.208] (-2265.712) * (-2265.952) (-2266.450) [-2260.887] (-2276.092) -- 0:04:36
138000 -- [-2258.415] (-2264.401) (-2270.908) (-2271.083) * (-2279.072) (-2270.176) [-2258.387] (-2263.163) -- 0:04:41
138500 -- (-2260.727) [-2266.627] (-2270.282) (-2269.752) * [-2255.798] (-2260.926) (-2257.166) (-2273.301) -- 0:04:39
139000 -- (-2264.415) (-2264.333) (-2271.152) [-2263.785] * (-2275.630) [-2261.554] (-2256.297) (-2269.028) -- 0:04:38
139500 -- [-2256.716] (-2285.194) (-2258.887) (-2261.647) * [-2263.479] (-2281.707) (-2261.435) (-2259.719) -- 0:04:37
140000 -- [-2261.568] (-2267.475) (-2266.615) (-2268.947) * (-2267.998) (-2262.710) [-2259.764] (-2258.433) -- 0:04:36
Average standard deviation of split frequencies: 0.021671
140500 -- [-2264.413] (-2266.323) (-2259.366) (-2272.274) * (-2267.379) [-2269.604] (-2263.235) (-2265.580) -- 0:04:35
141000 -- (-2270.390) [-2271.312] (-2263.347) (-2273.099) * (-2274.945) (-2265.633) (-2279.918) [-2268.921] -- 0:04:40
141500 -- (-2271.180) (-2260.550) (-2267.407) [-2255.770] * (-2275.093) (-2265.202) [-2273.515] (-2268.840) -- 0:04:39
142000 -- (-2274.112) [-2276.269] (-2263.848) (-2261.436) * (-2269.658) (-2294.489) (-2269.046) [-2262.145] -- 0:04:37
142500 -- (-2261.369) (-2268.118) [-2268.268] (-2272.275) * (-2271.618) (-2272.327) (-2275.104) [-2261.917] -- 0:04:36
143000 -- (-2269.799) (-2266.752) [-2264.561] (-2260.272) * (-2264.398) (-2281.352) (-2252.430) [-2263.909] -- 0:04:35
143500 -- (-2261.233) (-2261.958) [-2263.869] (-2260.646) * (-2264.193) [-2266.394] (-2262.435) (-2261.167) -- 0:04:34
144000 -- [-2267.110] (-2264.079) (-2262.272) (-2281.475) * (-2262.684) [-2261.584] (-2257.234) (-2266.102) -- 0:04:39
144500 -- (-2268.903) (-2270.010) [-2263.072] (-2270.612) * [-2259.940] (-2271.084) (-2255.972) (-2266.004) -- 0:04:38
145000 -- (-2266.320) [-2270.323] (-2260.745) (-2266.033) * [-2264.140] (-2274.769) (-2267.564) (-2273.882) -- 0:04:37
Average standard deviation of split frequencies: 0.021310
145500 -- (-2263.253) [-2273.792] (-2259.894) (-2280.313) * [-2261.102] (-2265.662) (-2266.547) (-2267.425) -- 0:04:36
146000 -- (-2258.368) (-2264.159) [-2267.644] (-2268.920) * (-2263.964) (-2261.623) (-2268.863) [-2264.238] -- 0:04:34
146500 -- [-2266.466] (-2280.801) (-2277.599) (-2267.360) * [-2267.158] (-2273.494) (-2267.492) (-2272.848) -- 0:04:39
147000 -- [-2267.069] (-2286.534) (-2268.573) (-2268.971) * (-2276.245) (-2273.801) (-2269.179) [-2262.766] -- 0:04:38
147500 -- (-2262.906) (-2267.433) (-2268.541) [-2268.409] * (-2274.850) (-2270.788) [-2253.770] (-2273.553) -- 0:04:37
148000 -- (-2263.576) (-2269.038) (-2272.019) [-2277.252] * [-2262.682] (-2274.185) (-2263.747) (-2283.888) -- 0:04:36
148500 -- (-2261.905) [-2255.222] (-2277.866) (-2263.245) * (-2265.304) (-2264.957) (-2284.777) [-2259.416] -- 0:04:35
149000 -- (-2262.898) [-2260.319] (-2283.516) (-2257.964) * (-2273.650) (-2270.423) [-2262.446] (-2265.529) -- 0:04:39
149500 -- (-2260.879) (-2269.376) [-2265.412] (-2268.791) * (-2268.842) (-2267.677) (-2261.511) [-2263.798] -- 0:04:38
150000 -- (-2261.283) (-2276.098) (-2271.316) [-2259.664] * (-2265.803) (-2276.438) (-2265.441) [-2265.588] -- 0:04:37
Average standard deviation of split frequencies: 0.018981
150500 -- (-2269.858) [-2265.703] (-2258.135) (-2261.854) * (-2269.014) (-2272.582) [-2259.249] (-2263.975) -- 0:04:36
151000 -- [-2264.270] (-2259.939) (-2266.751) (-2268.204) * (-2281.607) (-2258.351) [-2263.906] (-2265.904) -- 0:04:35
151500 -- [-2272.620] (-2270.728) (-2270.187) (-2259.943) * (-2277.626) (-2268.516) [-2266.405] (-2272.074) -- 0:04:40
152000 -- (-2268.641) (-2262.482) (-2270.305) [-2259.776] * (-2276.787) (-2279.414) (-2270.400) [-2263.601] -- 0:04:38
152500 -- (-2260.208) [-2270.431] (-2272.791) (-2267.416) * (-2276.299) (-2286.898) [-2265.154] (-2263.822) -- 0:04:37
153000 -- [-2260.899] (-2271.133) (-2275.575) (-2265.971) * (-2282.622) [-2265.773] (-2266.180) (-2272.106) -- 0:04:36
153500 -- (-2259.697) (-2259.171) (-2272.338) [-2263.667] * (-2276.661) [-2258.611] (-2291.291) (-2262.722) -- 0:04:35
154000 -- [-2266.284] (-2266.467) (-2265.357) (-2264.475) * [-2264.803] (-2275.710) (-2260.537) (-2278.021) -- 0:04:34
154500 -- (-2264.677) [-2262.521] (-2275.444) (-2261.800) * (-2265.060) (-2270.376) [-2259.825] (-2274.531) -- 0:04:39
155000 -- (-2263.941) [-2255.637] (-2260.685) (-2273.021) * (-2273.516) (-2266.435) [-2270.224] (-2266.471) -- 0:04:38
Average standard deviation of split frequencies: 0.020145
155500 -- [-2269.321] (-2265.857) (-2270.959) (-2265.877) * [-2263.865] (-2271.594) (-2265.263) (-2273.108) -- 0:04:36
156000 -- (-2278.458) [-2263.266] (-2262.271) (-2271.332) * [-2269.734] (-2275.627) (-2263.717) (-2261.901) -- 0:04:35
156500 -- (-2264.789) (-2271.846) (-2277.479) [-2270.216] * (-2264.878) (-2269.255) [-2260.701] (-2273.623) -- 0:04:34
157000 -- (-2264.913) [-2265.969] (-2268.828) (-2272.661) * (-2261.367) [-2264.034] (-2262.769) (-2262.371) -- 0:04:33
157500 -- (-2267.846) [-2261.501] (-2266.328) (-2272.146) * [-2258.103] (-2272.604) (-2270.549) (-2272.016) -- 0:04:38
158000 -- (-2263.561) (-2266.053) [-2266.335] (-2265.184) * (-2267.064) [-2267.132] (-2276.566) (-2268.654) -- 0:04:37
158500 -- [-2270.382] (-2274.706) (-2262.100) (-2269.288) * [-2264.828] (-2268.716) (-2264.491) (-2263.728) -- 0:04:36
159000 -- (-2271.685) [-2267.435] (-2265.328) (-2285.209) * (-2272.374) [-2282.566] (-2275.663) (-2278.851) -- 0:04:35
159500 -- (-2269.721) (-2259.175) [-2262.152] (-2268.641) * (-2261.934) (-2267.572) [-2264.875] (-2267.811) -- 0:04:34
160000 -- (-2262.091) (-2267.648) (-2261.365) [-2270.293] * [-2265.993] (-2268.241) (-2259.212) (-2269.234) -- 0:04:33
Average standard deviation of split frequencies: 0.016431
160500 -- [-2268.642] (-2267.131) (-2266.111) (-2264.794) * [-2270.634] (-2270.594) (-2266.737) (-2263.919) -- 0:04:31
161000 -- (-2272.327) (-2260.553) [-2267.064] (-2256.033) * (-2266.983) [-2258.859] (-2274.285) (-2269.405) -- 0:04:36
161500 -- [-2255.454] (-2272.757) (-2261.356) (-2274.047) * (-2278.557) [-2259.814] (-2269.148) (-2264.353) -- 0:04:35
162000 -- (-2264.125) (-2275.409) (-2265.853) [-2267.478] * [-2263.196] (-2264.028) (-2285.580) (-2269.880) -- 0:04:34
162500 -- (-2264.924) [-2263.882] (-2278.448) (-2258.658) * (-2269.755) [-2265.894] (-2299.539) (-2271.858) -- 0:04:33
163000 -- (-2277.059) (-2278.370) (-2275.756) [-2263.200] * (-2274.661) (-2267.158) [-2270.752] (-2270.918) -- 0:04:32
163500 -- (-2263.054) (-2260.367) (-2267.009) [-2269.509] * (-2265.745) [-2265.508] (-2274.812) (-2267.805) -- 0:04:36
164000 -- [-2270.712] (-2277.475) (-2268.858) (-2263.266) * [-2268.384] (-2264.923) (-2261.504) (-2269.286) -- 0:04:35
164500 -- (-2265.630) [-2260.647] (-2282.252) (-2264.343) * (-2272.749) (-2260.727) [-2264.698] (-2268.257) -- 0:04:34
165000 -- [-2266.365] (-2263.530) (-2285.563) (-2262.988) * (-2269.477) (-2269.298) [-2258.214] (-2269.801) -- 0:04:33
Average standard deviation of split frequencies: 0.017228
165500 -- (-2269.324) (-2267.307) (-2282.720) [-2259.583] * [-2268.743] (-2266.681) (-2263.283) (-2282.286) -- 0:04:32
166000 -- (-2266.113) [-2259.546] (-2271.280) (-2277.998) * (-2268.153) [-2267.727] (-2268.421) (-2276.424) -- 0:04:31
166500 -- (-2276.096) (-2265.732) [-2264.817] (-2266.256) * (-2265.021) [-2268.838] (-2262.934) (-2268.330) -- 0:04:35
167000 -- (-2266.889) (-2255.249) (-2265.557) [-2268.095] * (-2257.930) (-2284.644) [-2271.467] (-2279.866) -- 0:04:34
167500 -- (-2279.820) (-2260.452) [-2267.859] (-2277.061) * (-2266.539) (-2271.489) [-2268.157] (-2273.559) -- 0:04:33
168000 -- (-2269.259) (-2271.640) [-2253.067] (-2269.943) * (-2275.752) (-2256.030) [-2266.656] (-2263.160) -- 0:04:32
168500 -- (-2265.319) (-2271.954) [-2267.043] (-2270.250) * [-2270.016] (-2260.788) (-2271.480) (-2272.782) -- 0:04:31
169000 -- (-2263.989) [-2259.573] (-2270.395) (-2276.164) * (-2265.149) [-2255.896] (-2264.619) (-2268.729) -- 0:04:30
169500 -- (-2276.490) (-2261.389) (-2268.714) [-2264.784] * (-2270.783) (-2286.850) [-2266.941] (-2256.612) -- 0:04:34
170000 -- [-2253.522] (-2262.248) (-2261.869) (-2268.614) * (-2264.250) (-2275.583) (-2262.946) [-2260.910] -- 0:04:33
Average standard deviation of split frequencies: 0.018598
170500 -- [-2265.129] (-2271.790) (-2266.759) (-2269.022) * (-2263.648) (-2270.392) (-2271.234) [-2255.736] -- 0:04:32
171000 -- (-2263.453) [-2262.537] (-2257.787) (-2275.945) * [-2258.477] (-2266.491) (-2279.470) (-2270.526) -- 0:04:31
171500 -- (-2272.955) (-2261.610) [-2268.210] (-2272.236) * (-2265.550) (-2274.425) (-2278.215) [-2268.732] -- 0:04:30
172000 -- [-2265.060] (-2274.467) (-2261.110) (-2268.014) * [-2264.233] (-2282.993) (-2266.434) (-2261.617) -- 0:04:34
172500 -- (-2275.209) [-2260.304] (-2263.408) (-2263.841) * (-2257.174) (-2272.891) [-2275.570] (-2274.233) -- 0:04:33
173000 -- (-2262.174) [-2264.390] (-2268.058) (-2265.817) * (-2261.096) (-2274.749) [-2258.132] (-2264.839) -- 0:04:32
173500 -- [-2262.949] (-2275.878) (-2254.677) (-2267.665) * [-2257.724] (-2264.671) (-2260.166) (-2267.556) -- 0:04:31
174000 -- (-2269.044) [-2263.422] (-2273.623) (-2274.872) * (-2268.279) [-2260.486] (-2265.348) (-2274.561) -- 0:04:30
174500 -- (-2281.010) (-2276.252) [-2259.384] (-2275.829) * (-2266.906) (-2263.587) [-2267.139] (-2257.715) -- 0:04:29
175000 -- (-2273.725) (-2263.360) [-2267.269] (-2267.970) * [-2257.358] (-2279.804) (-2271.651) (-2260.333) -- 0:04:28
Average standard deviation of split frequencies: 0.016963
175500 -- [-2265.929] (-2256.883) (-2268.966) (-2266.819) * (-2272.131) (-2262.270) (-2262.633) [-2258.194] -- 0:04:32
176000 -- (-2267.695) (-2262.840) [-2267.440] (-2276.778) * (-2277.684) (-2278.246) (-2268.931) [-2258.597] -- 0:04:31
176500 -- (-2264.659) (-2273.896) [-2270.156] (-2292.646) * (-2276.284) (-2271.288) [-2263.612] (-2267.983) -- 0:04:30
177000 -- [-2265.585] (-2274.738) (-2262.467) (-2271.416) * (-2263.565) (-2269.844) (-2274.322) [-2266.670] -- 0:04:29
177500 -- (-2271.958) [-2270.377] (-2272.839) (-2260.864) * (-2262.283) (-2270.666) (-2279.766) [-2260.550] -- 0:04:28
178000 -- [-2254.360] (-2268.416) (-2264.664) (-2266.099) * [-2259.922] (-2268.223) (-2262.378) (-2265.690) -- 0:04:27
178500 -- (-2266.679) (-2271.817) [-2262.397] (-2273.415) * (-2278.943) (-2271.793) (-2264.230) [-2262.824] -- 0:04:26
179000 -- (-2264.377) (-2274.217) (-2270.637) [-2269.992] * [-2265.761] (-2260.495) (-2255.459) (-2270.932) -- 0:04:30
179500 -- (-2270.446) [-2267.222] (-2268.167) (-2266.914) * (-2283.115) (-2272.610) (-2266.966) [-2262.614] -- 0:04:29
180000 -- (-2269.113) (-2270.821) (-2262.936) [-2265.429] * (-2265.290) (-2263.224) (-2262.237) [-2270.463] -- 0:04:28
Average standard deviation of split frequencies: 0.019656
180500 -- [-2255.277] (-2266.082) (-2266.014) (-2279.340) * (-2274.591) (-2268.424) (-2266.532) [-2262.646] -- 0:04:27
181000 -- (-2279.274) (-2272.469) (-2263.951) [-2261.817] * (-2266.482) (-2281.737) (-2270.688) [-2261.349] -- 0:04:26
181500 -- (-2280.746) [-2261.475] (-2268.936) (-2259.861) * (-2269.814) (-2270.697) (-2267.453) [-2263.122] -- 0:04:30
182000 -- (-2275.897) [-2265.757] (-2266.249) (-2270.846) * (-2264.323) (-2276.893) (-2266.856) [-2262.726] -- 0:04:29
182500 -- (-2259.317) [-2263.226] (-2268.963) (-2280.080) * [-2262.206] (-2269.378) (-2270.252) (-2268.120) -- 0:04:28
183000 -- (-2267.532) (-2262.270) (-2285.581) [-2268.222] * (-2261.460) [-2268.646] (-2266.672) (-2266.513) -- 0:04:27
183500 -- (-2268.148) (-2264.630) [-2264.997] (-2272.107) * [-2259.126] (-2266.596) (-2266.141) (-2264.046) -- 0:04:26
184000 -- [-2271.205] (-2271.127) (-2260.378) (-2268.964) * (-2260.739) (-2281.309) (-2279.130) [-2267.119] -- 0:04:26
184500 -- (-2260.682) (-2277.023) (-2265.250) [-2267.187] * (-2277.021) (-2269.577) (-2278.326) [-2261.973] -- 0:04:25
185000 -- [-2270.614] (-2276.716) (-2266.122) (-2261.712) * (-2270.263) (-2269.381) [-2268.931] (-2267.437) -- 0:04:28
Average standard deviation of split frequencies: 0.017910
185500 -- [-2268.011] (-2270.587) (-2265.032) (-2253.698) * (-2268.250) [-2261.040] (-2266.729) (-2273.862) -- 0:04:27
186000 -- (-2265.891) (-2263.732) [-2264.485] (-2262.670) * (-2266.301) (-2263.508) (-2262.055) [-2266.491] -- 0:04:26
186500 -- (-2276.091) (-2265.663) (-2275.625) [-2269.369] * (-2277.204) [-2267.149] (-2264.117) (-2272.902) -- 0:04:26
187000 -- [-2267.046] (-2264.878) (-2267.390) (-2265.563) * (-2271.279) [-2264.752] (-2256.951) (-2265.178) -- 0:04:25
187500 -- [-2262.128] (-2259.317) (-2269.457) (-2264.635) * [-2263.108] (-2271.836) (-2265.193) (-2272.549) -- 0:04:24
188000 -- [-2269.840] (-2272.227) (-2259.160) (-2263.638) * (-2270.309) (-2265.332) (-2275.584) [-2266.660] -- 0:04:23
188500 -- (-2277.412) (-2271.552) (-2262.324) [-2272.362] * (-2275.506) (-2256.785) [-2259.721] (-2268.416) -- 0:04:26
189000 -- (-2270.978) [-2266.514] (-2287.472) (-2260.930) * (-2263.466) (-2272.255) [-2268.446] (-2266.498) -- 0:04:26
189500 -- (-2268.263) [-2265.015] (-2270.051) (-2273.955) * [-2263.765] (-2260.854) (-2270.037) (-2263.995) -- 0:04:25
190000 -- [-2264.870] (-2265.838) (-2266.037) (-2264.712) * (-2267.664) (-2272.078) (-2280.211) [-2271.000] -- 0:04:24
Average standard deviation of split frequencies: 0.016812
190500 -- [-2270.501] (-2269.761) (-2265.737) (-2265.333) * (-2260.789) [-2270.725] (-2261.577) (-2267.338) -- 0:04:23
191000 -- (-2264.979) (-2270.305) (-2264.475) [-2267.105] * (-2270.511) (-2269.601) (-2270.510) [-2271.181] -- 0:04:22
191500 -- (-2262.145) (-2276.703) (-2264.740) [-2269.139] * (-2259.644) [-2263.692] (-2258.894) (-2280.670) -- 0:04:25
192000 -- (-2270.724) (-2274.785) (-2266.353) [-2261.846] * (-2262.944) (-2276.743) [-2259.960] (-2269.811) -- 0:04:25
192500 -- (-2275.235) (-2264.053) (-2268.604) [-2270.598] * (-2262.202) [-2265.604] (-2268.246) (-2271.631) -- 0:04:24
193000 -- (-2268.984) (-2271.617) [-2255.801] (-2262.497) * (-2274.400) [-2267.241] (-2271.715) (-2279.092) -- 0:04:23
193500 -- (-2287.640) [-2267.055] (-2260.463) (-2264.851) * [-2258.849] (-2270.179) (-2279.081) (-2267.528) -- 0:04:22
194000 -- (-2278.320) (-2257.270) (-2260.439) [-2260.677] * [-2261.102] (-2267.098) (-2283.891) (-2267.764) -- 0:04:25
194500 -- (-2264.983) (-2266.865) [-2257.894] (-2267.439) * [-2262.946] (-2273.582) (-2267.874) (-2263.253) -- 0:04:25
195000 -- [-2261.747] (-2271.376) (-2263.369) (-2277.209) * (-2264.995) [-2258.659] (-2269.997) (-2266.171) -- 0:04:24
Average standard deviation of split frequencies: 0.016836
195500 -- [-2269.693] (-2262.964) (-2274.031) (-2253.114) * [-2261.733] (-2283.083) (-2260.276) (-2275.449) -- 0:04:23
196000 -- (-2269.452) (-2263.408) (-2269.224) [-2261.706] * [-2267.278] (-2269.554) (-2275.217) (-2271.052) -- 0:04:26
196500 -- (-2266.166) [-2265.109] (-2278.640) (-2275.841) * (-2277.703) [-2270.570] (-2270.813) (-2282.244) -- 0:04:25
197000 -- (-2266.348) (-2269.836) (-2267.082) [-2259.914] * [-2259.732] (-2268.049) (-2275.987) (-2262.963) -- 0:04:24
197500 -- (-2265.184) (-2259.001) [-2264.124] (-2261.708) * [-2267.580] (-2277.544) (-2271.792) (-2269.051) -- 0:04:24
198000 -- (-2291.526) (-2265.837) (-2265.225) [-2259.215] * [-2271.269] (-2272.877) (-2265.888) (-2277.073) -- 0:04:23
198500 -- (-2269.583) [-2269.536] (-2269.677) (-2258.556) * (-2273.219) [-2268.644] (-2274.885) (-2267.170) -- 0:04:22
199000 -- (-2282.410) (-2262.823) (-2282.396) [-2264.057] * [-2258.935] (-2266.725) (-2268.896) (-2273.409) -- 0:04:25
199500 -- (-2269.762) [-2268.823] (-2263.744) (-2274.384) * (-2273.009) (-2263.573) [-2260.689] (-2267.961) -- 0:04:24
200000 -- (-2266.747) (-2269.853) (-2271.845) [-2265.145] * [-2265.680] (-2268.373) (-2267.117) (-2266.450) -- 0:04:24
Average standard deviation of split frequencies: 0.016444
200500 -- (-2264.941) (-2269.191) (-2273.847) [-2259.458] * [-2263.981] (-2266.606) (-2276.835) (-2276.139) -- 0:04:23
201000 -- (-2268.960) (-2279.782) (-2271.342) [-2268.038] * (-2261.862) [-2267.894] (-2265.887) (-2288.102) -- 0:04:22
201500 -- (-2266.200) (-2264.433) [-2255.046] (-2273.674) * (-2275.193) (-2266.459) (-2267.159) [-2270.210] -- 0:04:21
202000 -- (-2273.411) (-2275.076) (-2268.235) [-2263.323] * [-2266.715] (-2273.496) (-2268.150) (-2265.054) -- 0:04:24
202500 -- [-2261.836] (-2271.072) (-2267.265) (-2285.770) * (-2266.769) [-2264.584] (-2266.297) (-2257.460) -- 0:04:23
203000 -- (-2268.300) (-2275.058) (-2264.254) [-2264.400] * (-2265.149) (-2275.959) [-2269.562] (-2270.825) -- 0:04:23
203500 -- (-2259.120) (-2270.662) (-2260.102) [-2256.457] * [-2264.473] (-2266.553) (-2277.566) (-2280.837) -- 0:04:22
204000 -- (-2270.014) (-2261.727) (-2263.020) [-2257.259] * (-2267.345) [-2266.841] (-2263.738) (-2274.144) -- 0:04:21
204500 -- [-2267.873] (-2271.487) (-2269.969) (-2269.312) * (-2263.351) (-2262.618) (-2271.636) [-2268.176] -- 0:04:20
205000 -- (-2270.866) (-2271.004) (-2267.391) [-2267.834] * (-2282.613) [-2261.073] (-2271.502) (-2272.595) -- 0:04:23
Average standard deviation of split frequencies: 0.015713
205500 -- (-2261.894) (-2264.441) [-2257.066] (-2266.562) * (-2266.873) [-2264.029] (-2263.199) (-2270.962) -- 0:04:22
206000 -- [-2266.286] (-2277.106) (-2262.509) (-2265.936) * (-2274.370) (-2269.199) [-2257.650] (-2266.543) -- 0:04:22
206500 -- (-2262.821) (-2268.383) [-2260.287] (-2260.962) * (-2264.489) (-2273.150) [-2262.577] (-2258.479) -- 0:04:21
207000 -- (-2274.633) (-2282.889) [-2268.886] (-2265.729) * [-2259.276] (-2266.153) (-2272.274) (-2258.311) -- 0:04:20
207500 -- (-2273.618) (-2271.925) (-2266.566) [-2261.440] * (-2261.384) [-2262.733] (-2276.283) (-2271.929) -- 0:04:19
208000 -- (-2271.601) (-2256.154) [-2266.422] (-2276.684) * (-2265.766) (-2273.670) (-2278.258) [-2261.797] -- 0:04:22
208500 -- (-2264.109) [-2260.726] (-2271.884) (-2272.182) * (-2267.731) (-2266.275) (-2273.964) [-2266.647] -- 0:04:21
209000 -- (-2263.256) [-2260.812] (-2272.533) (-2270.852) * [-2254.127] (-2256.817) (-2278.318) (-2265.075) -- 0:04:21
209500 -- [-2265.301] (-2273.182) (-2271.287) (-2273.395) * (-2264.241) [-2266.294] (-2261.218) (-2267.551) -- 0:04:20
210000 -- (-2261.724) (-2262.441) (-2271.324) [-2261.056] * [-2261.449] (-2280.197) (-2265.124) (-2272.434) -- 0:04:19
Average standard deviation of split frequencies: 0.018051
210500 -- (-2259.386) (-2262.725) [-2262.090] (-2273.179) * (-2266.564) (-2289.570) [-2263.367] (-2276.851) -- 0:04:18
211000 -- (-2268.374) [-2266.834] (-2268.097) (-2277.695) * (-2264.032) (-2264.451) (-2264.374) [-2267.989] -- 0:04:21
211500 -- (-2257.338) [-2271.345] (-2264.207) (-2268.702) * [-2265.822] (-2277.318) (-2265.559) (-2265.329) -- 0:04:20
212000 -- [-2258.200] (-2262.350) (-2271.848) (-2262.063) * (-2276.961) (-2269.522) [-2257.672] (-2262.315) -- 0:04:20
212500 -- [-2270.031] (-2263.753) (-2259.766) (-2257.887) * (-2277.310) [-2268.176] (-2267.495) (-2264.549) -- 0:04:19
213000 -- (-2262.051) (-2264.820) [-2255.173] (-2267.137) * [-2263.776] (-2282.617) (-2276.720) (-2264.711) -- 0:04:18
213500 -- (-2269.920) (-2267.801) (-2262.348) [-2263.562] * (-2268.898) (-2268.981) [-2270.902] (-2278.309) -- 0:04:21
214000 -- (-2269.972) [-2275.132] (-2262.644) (-2266.193) * (-2278.146) (-2276.502) (-2268.709) [-2266.914] -- 0:04:20
214500 -- (-2259.893) (-2276.378) [-2265.147] (-2267.742) * (-2267.754) (-2267.736) [-2262.082] (-2274.184) -- 0:04:20
215000 -- (-2264.066) (-2263.166) [-2266.627] (-2268.597) * (-2271.248) (-2268.731) (-2265.726) [-2265.248] -- 0:04:19
Average standard deviation of split frequencies: 0.019351
215500 -- [-2267.004] (-2258.445) (-2273.958) (-2269.288) * (-2277.614) (-2272.126) (-2261.017) [-2259.294] -- 0:04:18
216000 -- (-2273.999) (-2271.727) [-2266.411] (-2268.657) * (-2280.224) (-2268.242) (-2260.558) [-2269.539] -- 0:04:17
216500 -- (-2269.472) (-2277.299) [-2268.223] (-2269.494) * (-2276.438) (-2268.635) (-2270.884) [-2268.684] -- 0:04:16
217000 -- (-2284.311) (-2263.162) (-2271.149) [-2259.046] * [-2264.663] (-2266.347) (-2277.224) (-2272.860) -- 0:04:19
217500 -- [-2263.344] (-2277.101) (-2276.022) (-2272.628) * (-2275.743) [-2270.307] (-2259.698) (-2264.426) -- 0:04:19
218000 -- (-2265.015) (-2272.282) [-2266.284] (-2260.254) * (-2261.507) (-2282.494) (-2274.058) [-2264.300] -- 0:04:18
218500 -- [-2261.219] (-2281.940) (-2264.980) (-2262.101) * [-2263.836] (-2275.874) (-2268.744) (-2270.921) -- 0:04:17
219000 -- [-2262.380] (-2266.027) (-2272.272) (-2277.683) * [-2265.054] (-2279.905) (-2261.729) (-2260.154) -- 0:04:16
219500 -- [-2263.460] (-2271.314) (-2269.642) (-2264.868) * [-2269.996] (-2261.676) (-2272.301) (-2288.072) -- 0:04:16
220000 -- [-2267.032] (-2275.232) (-2265.125) (-2264.327) * (-2288.250) [-2256.810] (-2263.507) (-2259.788) -- 0:04:15
Average standard deviation of split frequencies: 0.016093
220500 -- (-2267.277) (-2270.631) [-2271.686] (-2264.039) * (-2288.093) (-2271.453) (-2266.701) [-2260.433] -- 0:04:18
221000 -- (-2258.367) (-2270.349) [-2261.006] (-2268.647) * (-2278.263) [-2266.929] (-2270.015) (-2265.774) -- 0:04:17
221500 -- (-2262.032) (-2280.214) (-2272.655) [-2262.270] * (-2279.017) [-2270.885] (-2262.509) (-2264.593) -- 0:04:16
222000 -- [-2264.557] (-2269.262) (-2269.895) (-2254.144) * (-2271.432) [-2256.058] (-2263.581) (-2264.663) -- 0:04:15
222500 -- (-2264.761) [-2261.330] (-2261.211) (-2268.230) * [-2261.537] (-2271.889) (-2282.821) (-2265.713) -- 0:04:15
223000 -- [-2260.365] (-2262.835) (-2278.342) (-2266.430) * (-2267.572) (-2263.397) (-2261.380) [-2257.023] -- 0:04:14
223500 -- (-2269.099) (-2268.179) (-2269.235) [-2266.370] * (-2274.347) (-2269.704) (-2260.642) [-2265.771] -- 0:04:13
224000 -- (-2282.909) [-2262.327] (-2264.277) (-2264.813) * (-2281.166) [-2260.422] (-2264.354) (-2273.436) -- 0:04:16
224500 -- (-2264.919) (-2260.537) [-2268.912] (-2265.772) * (-2270.296) (-2265.110) (-2265.563) [-2261.278] -- 0:04:15
225000 -- (-2274.901) (-2266.293) (-2262.215) [-2267.385] * [-2262.158] (-2261.669) (-2262.363) (-2266.185) -- 0:04:14
Average standard deviation of split frequencies: 0.016131
225500 -- [-2265.699] (-2270.780) (-2264.036) (-2272.046) * [-2262.617] (-2277.678) (-2263.278) (-2263.177) -- 0:04:14
226000 -- (-2262.373) [-2261.305] (-2277.399) (-2265.081) * [-2265.123] (-2272.542) (-2265.013) (-2276.101) -- 0:04:13
226500 -- (-2265.951) [-2263.621] (-2275.816) (-2279.843) * (-2281.560) (-2271.293) [-2267.296] (-2268.425) -- 0:04:12
227000 -- [-2258.090] (-2261.337) (-2267.550) (-2270.463) * (-2272.581) (-2257.125) (-2266.510) [-2264.886] -- 0:04:11
227500 -- [-2257.678] (-2279.165) (-2266.915) (-2267.868) * (-2274.450) (-2262.733) (-2269.717) [-2266.986] -- 0:04:14
228000 -- (-2272.129) (-2265.727) [-2268.079] (-2273.718) * (-2263.785) (-2267.026) (-2267.160) [-2266.394] -- 0:04:13
228500 -- (-2277.908) (-2259.452) [-2265.348] (-2262.965) * [-2273.655] (-2273.165) (-2265.752) (-2263.282) -- 0:04:13
229000 -- (-2266.263) (-2269.637) [-2266.401] (-2257.773) * (-2270.875) [-2277.482] (-2266.018) (-2270.797) -- 0:04:12
229500 -- (-2268.081) (-2258.256) [-2260.842] (-2268.865) * (-2269.342) (-2266.156) (-2262.939) [-2269.055] -- 0:04:11
230000 -- (-2262.871) (-2264.749) [-2270.228] (-2265.251) * [-2269.028] (-2277.672) (-2265.148) (-2257.141) -- 0:04:11
Average standard deviation of split frequencies: 0.016349
230500 -- [-2264.988] (-2276.855) (-2266.217) (-2264.914) * (-2279.670) (-2262.889) [-2263.288] (-2265.086) -- 0:04:10
231000 -- (-2258.894) (-2289.511) (-2264.323) [-2259.426] * (-2277.507) (-2262.942) [-2254.542] (-2264.634) -- 0:04:13
231500 -- [-2263.750] (-2259.875) (-2261.374) (-2267.503) * (-2269.528) (-2271.056) [-2264.586] (-2260.010) -- 0:04:12
232000 -- (-2261.767) (-2274.379) [-2266.713] (-2270.729) * (-2283.985) (-2270.237) (-2264.953) [-2264.298] -- 0:04:11
232500 -- [-2261.521] (-2262.061) (-2267.812) (-2266.328) * (-2280.827) [-2257.078] (-2265.018) (-2276.166) -- 0:04:10
233000 -- (-2263.856) (-2276.479) [-2266.540] (-2259.138) * (-2272.521) (-2262.623) [-2262.960] (-2277.251) -- 0:04:10
233500 -- [-2270.286] (-2276.622) (-2265.285) (-2266.231) * (-2278.093) [-2259.608] (-2275.978) (-2278.448) -- 0:04:09
234000 -- (-2282.679) (-2266.836) [-2271.948] (-2276.431) * (-2265.346) (-2269.434) (-2263.947) [-2260.719] -- 0:04:08
234500 -- (-2268.329) [-2264.527] (-2275.843) (-2270.161) * (-2277.762) (-2270.892) [-2263.445] (-2279.017) -- 0:04:11
235000 -- (-2268.498) (-2263.648) [-2268.825] (-2270.903) * (-2274.254) (-2277.952) (-2272.246) [-2269.589] -- 0:04:10
Average standard deviation of split frequencies: 0.015847
235500 -- (-2254.606) (-2276.518) [-2258.001] (-2269.429) * [-2267.981] (-2263.176) (-2263.209) (-2265.918) -- 0:04:09
236000 -- (-2260.870) [-2256.111] (-2266.696) (-2281.428) * (-2271.226) (-2267.908) [-2265.101] (-2259.192) -- 0:04:09
236500 -- (-2261.869) [-2263.837] (-2266.017) (-2282.392) * (-2261.526) [-2271.862] (-2271.213) (-2264.725) -- 0:04:08
237000 -- (-2263.906) (-2279.200) [-2261.447] (-2288.368) * (-2271.739) (-2275.537) (-2285.063) [-2257.557] -- 0:04:07
237500 -- (-2277.099) (-2260.332) [-2265.723] (-2269.861) * (-2265.192) [-2267.196] (-2265.660) (-2261.795) -- 0:04:07
238000 -- (-2266.849) (-2273.842) (-2265.316) [-2275.136] * (-2275.151) [-2256.030] (-2270.161) (-2265.556) -- 0:04:09
238500 -- (-2267.816) [-2262.568] (-2262.116) (-2281.432) * (-2263.085) (-2283.288) (-2266.744) [-2262.820] -- 0:04:09
239000 -- (-2270.184) (-2258.810) (-2278.671) [-2268.549] * [-2261.506] (-2260.563) (-2275.578) (-2265.496) -- 0:04:08
239500 -- (-2265.586) (-2261.444) [-2257.730] (-2281.284) * [-2260.062] (-2255.302) (-2270.092) (-2278.649) -- 0:04:07
240000 -- (-2267.081) (-2262.604) (-2269.074) [-2261.332] * [-2260.489] (-2264.531) (-2262.473) (-2261.910) -- 0:04:07
Average standard deviation of split frequencies: 0.015801
240500 -- (-2273.497) (-2281.507) [-2263.600] (-2263.235) * (-2270.810) (-2279.230) (-2268.578) [-2264.697] -- 0:04:06
241000 -- [-2262.834] (-2279.707) (-2263.669) (-2275.008) * [-2258.142] (-2262.938) (-2261.077) (-2286.291) -- 0:04:05
241500 -- (-2266.647) (-2275.018) [-2258.147] (-2272.064) * [-2266.851] (-2276.968) (-2264.809) (-2265.891) -- 0:04:04
242000 -- (-2268.173) [-2262.034] (-2265.768) (-2269.941) * [-2269.043] (-2269.407) (-2266.634) (-2266.374) -- 0:04:07
242500 -- (-2280.184) (-2270.721) (-2268.819) [-2260.573] * (-2281.852) [-2257.085] (-2264.805) (-2261.915) -- 0:04:06
243000 -- (-2263.510) (-2271.769) (-2258.990) [-2262.735] * (-2280.787) [-2261.123] (-2267.464) (-2269.752) -- 0:04:06
243500 -- (-2274.266) [-2263.888] (-2269.220) (-2256.243) * (-2272.698) (-2259.288) [-2259.466] (-2272.555) -- 0:04:05
244000 -- (-2263.982) [-2259.992] (-2264.712) (-2255.037) * [-2262.720] (-2265.596) (-2264.975) (-2270.120) -- 0:04:04
244500 -- (-2270.677) [-2265.956] (-2257.999) (-2270.432) * (-2268.251) (-2264.071) [-2267.617] (-2282.879) -- 0:04:04
245000 -- (-2270.313) [-2255.220] (-2263.510) (-2270.554) * (-2267.717) [-2269.760] (-2261.748) (-2275.417) -- 0:04:03
Average standard deviation of split frequencies: 0.015841
245500 -- (-2265.314) (-2267.196) [-2258.358] (-2269.310) * (-2264.254) [-2265.623] (-2270.803) (-2275.038) -- 0:04:05
246000 -- (-2273.874) [-2257.670] (-2263.847) (-2267.939) * (-2276.125) (-2271.071) (-2271.679) [-2257.084] -- 0:04:05
246500 -- (-2276.885) (-2281.955) (-2256.013) [-2260.238] * (-2270.340) [-2263.836] (-2263.785) (-2261.241) -- 0:04:04
247000 -- (-2271.001) (-2272.603) [-2265.578] (-2262.063) * (-2272.043) (-2266.504) (-2262.349) [-2264.418] -- 0:04:03
247500 -- [-2258.361] (-2275.489) (-2277.081) (-2276.862) * (-2263.162) [-2260.191] (-2269.686) (-2269.173) -- 0:04:03
248000 -- (-2272.494) (-2272.987) (-2278.971) [-2275.752] * (-2269.382) (-2267.977) [-2263.634] (-2278.128) -- 0:04:02
248500 -- [-2271.850] (-2282.892) (-2268.542) (-2277.816) * (-2256.075) (-2267.465) [-2269.572] (-2267.986) -- 0:04:04
249000 -- (-2255.996) (-2262.538) (-2273.815) [-2273.334] * [-2255.932] (-2258.256) (-2260.642) (-2262.553) -- 0:04:04
249500 -- (-2265.829) (-2275.059) (-2274.970) [-2267.393] * (-2261.612) (-2271.823) (-2267.354) [-2258.887] -- 0:04:03
250000 -- [-2263.033] (-2265.113) (-2267.252) (-2275.459) * (-2265.101) (-2269.029) [-2258.991] (-2271.010) -- 0:04:03
Average standard deviation of split frequencies: 0.015045
250500 -- (-2261.130) (-2271.719) [-2279.184] (-2270.579) * (-2265.048) [-2271.038] (-2268.771) (-2269.012) -- 0:04:02
251000 -- [-2274.185] (-2267.947) (-2272.446) (-2271.567) * [-2259.443] (-2271.354) (-2269.787) (-2269.003) -- 0:04:01
251500 -- (-2267.221) [-2273.206] (-2277.463) (-2271.832) * (-2261.056) [-2261.962] (-2268.195) (-2272.791) -- 0:04:01
252000 -- (-2272.161) [-2270.775] (-2283.543) (-2277.100) * (-2266.850) (-2267.412) (-2259.141) [-2263.728] -- 0:04:03
252500 -- [-2262.609] (-2267.783) (-2270.516) (-2281.507) * (-2263.170) (-2261.050) (-2270.457) [-2266.744] -- 0:04:02
253000 -- (-2260.534) (-2261.286) (-2266.964) [-2270.767] * (-2272.373) (-2260.374) [-2266.790] (-2271.671) -- 0:04:02
253500 -- (-2260.568) [-2278.213] (-2262.456) (-2271.620) * (-2272.004) [-2270.337] (-2276.595) (-2272.205) -- 0:04:01
254000 -- (-2271.067) (-2258.265) [-2267.705] (-2272.201) * (-2265.280) [-2263.305] (-2263.981) (-2260.869) -- 0:04:00
254500 -- (-2279.862) [-2257.970] (-2270.063) (-2261.992) * (-2265.963) [-2273.421] (-2262.596) (-2272.482) -- 0:04:03
255000 -- [-2260.545] (-2270.004) (-2276.887) (-2266.189) * (-2275.787) [-2258.942] (-2262.569) (-2259.988) -- 0:04:02
Average standard deviation of split frequencies: 0.013872
255500 -- (-2282.598) [-2262.833] (-2263.231) (-2264.205) * [-2267.579] (-2259.476) (-2268.561) (-2256.329) -- 0:04:01
256000 -- (-2275.664) (-2263.552) (-2262.909) [-2265.864] * [-2261.134] (-2269.529) (-2270.931) (-2262.062) -- 0:04:01
256500 -- (-2265.442) (-2267.178) [-2259.421] (-2272.234) * [-2258.930] (-2265.852) (-2275.544) (-2276.498) -- 0:04:00
257000 -- (-2268.913) (-2270.892) (-2272.856) [-2268.807] * [-2264.488] (-2264.807) (-2267.984) (-2264.955) -- 0:03:59
257500 -- (-2256.793) [-2263.519] (-2268.444) (-2276.122) * (-2261.513) (-2280.933) (-2263.433) [-2270.343] -- 0:03:59
258000 -- (-2263.783) [-2255.257] (-2267.526) (-2275.012) * [-2263.108] (-2272.762) (-2271.910) (-2271.720) -- 0:04:01
258500 -- [-2258.588] (-2263.754) (-2269.995) (-2267.359) * (-2263.635) (-2272.091) [-2265.463] (-2269.843) -- 0:04:00
259000 -- (-2275.346) [-2264.898] (-2269.615) (-2263.850) * (-2266.919) [-2270.345] (-2257.030) (-2265.374) -- 0:04:00
259500 -- (-2277.467) (-2260.312) [-2261.689] (-2270.650) * (-2263.271) (-2271.963) [-2264.976] (-2264.225) -- 0:03:59
260000 -- (-2289.276) (-2261.271) (-2264.601) [-2261.512] * (-2265.213) [-2259.170] (-2270.558) (-2268.212) -- 0:03:59
Average standard deviation of split frequencies: 0.013262
260500 -- (-2257.599) (-2282.240) (-2276.088) [-2252.453] * [-2260.715] (-2252.474) (-2282.622) (-2269.222) -- 0:03:58
261000 -- (-2262.466) (-2264.616) [-2267.132] (-2261.500) * (-2273.452) [-2265.672] (-2261.740) (-2266.296) -- 0:03:57
261500 -- (-2264.222) (-2272.645) [-2260.013] (-2265.815) * (-2267.938) (-2259.146) (-2269.316) [-2261.900] -- 0:04:00
262000 -- (-2279.545) (-2258.073) (-2268.592) [-2265.216] * (-2269.995) [-2267.790] (-2280.262) (-2270.933) -- 0:03:59
262500 -- [-2261.179] (-2265.179) (-2267.061) (-2276.420) * [-2263.124] (-2270.889) (-2265.097) (-2277.037) -- 0:03:58
263000 -- (-2272.570) (-2268.291) (-2276.377) [-2279.251] * (-2272.656) (-2270.668) (-2263.409) [-2273.667] -- 0:03:58
263500 -- (-2264.904) (-2259.494) [-2268.314] (-2272.927) * (-2264.785) [-2257.798] (-2262.463) (-2285.962) -- 0:03:57
264000 -- (-2260.265) [-2268.801] (-2269.663) (-2282.286) * (-2263.975) (-2267.263) (-2272.426) [-2267.378] -- 0:03:56
264500 -- (-2270.647) [-2265.987] (-2279.436) (-2269.349) * [-2262.221] (-2256.551) (-2268.080) (-2278.649) -- 0:03:56
265000 -- (-2262.073) [-2259.243] (-2263.892) (-2277.535) * (-2257.868) [-2264.718] (-2263.213) (-2271.803) -- 0:03:58
Average standard deviation of split frequencies: 0.012760
265500 -- (-2269.412) [-2273.263] (-2254.725) (-2267.610) * [-2261.902] (-2259.780) (-2264.562) (-2278.018) -- 0:03:57
266000 -- (-2259.127) (-2275.611) [-2264.962] (-2279.326) * [-2258.909] (-2267.541) (-2259.695) (-2271.153) -- 0:03:57
266500 -- (-2265.499) (-2261.884) [-2262.907] (-2283.732) * (-2268.915) (-2272.128) (-2266.456) [-2263.617] -- 0:03:56
267000 -- [-2262.517] (-2265.030) (-2263.556) (-2273.632) * (-2263.253) (-2280.125) (-2265.997) [-2260.175] -- 0:03:58
267500 -- (-2267.788) (-2264.488) (-2266.782) [-2268.461] * (-2276.357) (-2267.950) [-2266.123] (-2272.370) -- 0:03:58
268000 -- [-2251.668] (-2276.832) (-2260.658) (-2278.629) * (-2272.788) [-2263.219] (-2270.276) (-2264.102) -- 0:03:57
268500 -- (-2268.618) [-2271.347] (-2269.675) (-2278.569) * [-2270.301] (-2267.135) (-2267.268) (-2267.539) -- 0:03:57
269000 -- [-2270.805] (-2268.753) (-2264.600) (-2269.567) * (-2271.397) (-2258.546) [-2262.351] (-2264.080) -- 0:03:56
269500 -- (-2269.329) (-2270.715) (-2272.284) [-2267.672] * (-2266.196) (-2268.646) (-2268.370) [-2256.024] -- 0:03:55
270000 -- (-2277.297) (-2283.984) (-2278.040) [-2259.400] * (-2275.586) [-2262.119] (-2272.490) (-2265.281) -- 0:03:57
Average standard deviation of split frequencies: 0.011379
270500 -- (-2263.201) (-2277.131) [-2267.168] (-2264.177) * [-2277.735] (-2275.492) (-2261.683) (-2269.361) -- 0:03:57
271000 -- (-2265.466) (-2259.022) [-2270.590] (-2267.290) * (-2264.678) [-2267.019] (-2274.111) (-2263.762) -- 0:03:56
271500 -- [-2271.509] (-2265.939) (-2275.721) (-2262.987) * (-2271.560) (-2265.760) [-2267.057] (-2265.391) -- 0:03:56
272000 -- [-2261.291] (-2258.698) (-2272.564) (-2260.406) * (-2277.962) (-2260.965) (-2263.846) [-2260.746] -- 0:03:55
272500 -- (-2268.374) [-2265.519] (-2271.596) (-2267.659) * (-2262.498) [-2268.370] (-2261.400) (-2259.419) -- 0:03:54
273000 -- [-2258.591] (-2274.194) (-2276.724) (-2260.121) * (-2274.281) (-2278.003) [-2266.201] (-2265.074) -- 0:03:57
273500 -- (-2270.403) (-2268.737) (-2266.743) [-2265.649] * (-2264.518) (-2270.418) (-2282.300) [-2254.255] -- 0:03:56
274000 -- (-2264.795) (-2258.203) (-2285.425) [-2258.986] * (-2256.494) (-2268.350) [-2266.794] (-2269.219) -- 0:03:55
274500 -- (-2280.529) [-2262.533] (-2281.184) (-2254.831) * (-2270.975) [-2259.384] (-2271.473) (-2271.574) -- 0:03:55
275000 -- (-2266.878) [-2263.916] (-2283.685) (-2266.751) * (-2265.342) (-2279.307) (-2271.652) [-2256.708] -- 0:03:54
Average standard deviation of split frequencies: 0.011045
275500 -- (-2261.889) (-2272.329) (-2281.056) [-2263.826] * [-2258.715] (-2270.073) (-2276.564) (-2270.164) -- 0:03:54
276000 -- [-2258.991] (-2262.658) (-2274.377) (-2282.686) * (-2265.746) (-2260.138) (-2269.318) [-2257.892] -- 0:03:56
276500 -- [-2263.582] (-2261.317) (-2269.263) (-2265.255) * (-2264.331) (-2264.017) (-2267.380) [-2254.878] -- 0:03:55
277000 -- (-2275.657) (-2263.291) [-2261.653] (-2262.476) * (-2276.130) [-2268.333] (-2270.559) (-2273.942) -- 0:03:54
277500 -- (-2264.153) (-2267.432) (-2264.740) [-2261.312] * (-2274.544) (-2276.056) (-2260.108) [-2263.037] -- 0:03:54
278000 -- (-2275.220) (-2258.240) (-2262.806) [-2256.476] * (-2275.118) [-2265.622] (-2260.500) (-2263.920) -- 0:03:53
278500 -- [-2263.002] (-2272.111) (-2275.166) (-2272.527) * (-2268.079) (-2271.233) (-2272.348) [-2271.139] -- 0:03:55
279000 -- [-2263.395] (-2265.881) (-2264.154) (-2275.861) * (-2255.988) (-2271.806) [-2267.313] (-2270.003) -- 0:03:55
279500 -- (-2274.064) [-2262.377] (-2260.871) (-2264.703) * (-2259.353) (-2271.176) [-2256.741] (-2264.736) -- 0:03:54
280000 -- (-2276.196) (-2266.501) (-2271.550) [-2263.562] * (-2266.189) (-2275.178) [-2265.897] (-2258.395) -- 0:03:54
Average standard deviation of split frequencies: 0.012205
280500 -- (-2257.046) [-2264.629] (-2274.051) (-2259.056) * (-2269.525) (-2269.155) (-2265.952) [-2264.021] -- 0:03:53
281000 -- (-2266.596) [-2264.985] (-2266.127) (-2273.140) * (-2262.254) (-2266.889) (-2263.874) [-2269.590] -- 0:03:52
281500 -- (-2277.360) (-2269.796) (-2263.420) [-2259.976] * (-2263.665) (-2265.435) (-2276.496) [-2269.439] -- 0:03:52
282000 -- (-2272.656) (-2269.991) (-2263.368) [-2261.762] * (-2276.691) [-2258.220] (-2274.046) (-2266.951) -- 0:03:51
282500 -- (-2272.556) (-2258.827) [-2261.377] (-2274.943) * (-2269.510) (-2266.103) (-2262.103) [-2267.530] -- 0:03:53
283000 -- (-2270.633) (-2264.066) [-2262.578] (-2261.108) * (-2275.448) (-2264.679) (-2277.354) [-2257.709] -- 0:03:53
283500 -- (-2276.475) (-2265.167) [-2264.056] (-2264.502) * [-2268.925] (-2263.211) (-2274.864) (-2261.688) -- 0:03:52
284000 -- (-2263.723) [-2264.990] (-2268.302) (-2267.928) * (-2256.360) (-2275.162) (-2257.237) [-2261.831] -- 0:03:51
284500 -- [-2269.798] (-2263.229) (-2275.238) (-2269.179) * (-2266.406) (-2265.458) [-2271.201] (-2264.897) -- 0:03:51
285000 -- [-2269.505] (-2267.611) (-2269.713) (-2277.224) * [-2258.733] (-2258.365) (-2264.716) (-2264.962) -- 0:03:50
Average standard deviation of split frequencies: 0.013296
285500 -- (-2267.374) (-2277.015) [-2272.824] (-2270.319) * (-2264.703) (-2260.712) [-2270.246] (-2273.175) -- 0:03:50
286000 -- (-2263.106) (-2276.473) (-2261.355) [-2263.204] * [-2262.374] (-2270.816) (-2266.051) (-2276.969) -- 0:03:52
286500 -- [-2270.895] (-2272.773) (-2258.581) (-2264.389) * (-2257.570) (-2271.227) (-2269.048) [-2260.777] -- 0:03:51
287000 -- (-2277.506) (-2273.804) [-2258.699] (-2273.544) * (-2266.790) (-2268.413) [-2275.991] (-2270.388) -- 0:03:51
287500 -- (-2272.797) (-2270.666) [-2259.738] (-2267.539) * (-2260.759) (-2268.208) (-2278.523) [-2260.288] -- 0:03:50
288000 -- (-2272.801) (-2268.366) [-2261.769] (-2268.600) * (-2272.622) [-2267.983] (-2278.064) (-2279.802) -- 0:03:49
288500 -- (-2269.539) [-2267.427] (-2265.900) (-2263.278) * (-2270.845) [-2259.172] (-2279.957) (-2275.472) -- 0:03:49
289000 -- (-2276.190) (-2266.194) [-2266.752] (-2271.821) * (-2265.200) [-2259.992] (-2273.659) (-2265.420) -- 0:03:48
289500 -- (-2273.288) (-2263.662) (-2266.306) [-2265.512] * [-2258.363] (-2273.798) (-2273.272) (-2257.373) -- 0:03:48
290000 -- (-2262.850) (-2261.139) (-2273.636) [-2264.096] * (-2267.802) (-2262.973) (-2280.202) [-2252.417] -- 0:03:50
Average standard deviation of split frequencies: 0.013839
290500 -- (-2264.070) [-2268.896] (-2288.953) (-2274.471) * (-2272.035) (-2263.879) (-2265.706) [-2264.840] -- 0:03:49
291000 -- (-2263.435) (-2267.612) [-2267.458] (-2271.723) * (-2268.660) [-2263.705] (-2269.609) (-2270.024) -- 0:03:49
291500 -- (-2266.840) (-2271.828) [-2276.715] (-2265.661) * (-2261.782) (-2262.042) [-2267.027] (-2270.973) -- 0:03:48
292000 -- (-2262.093) (-2266.324) [-2259.851] (-2276.076) * (-2265.979) [-2262.395] (-2282.909) (-2265.096) -- 0:03:47
292500 -- (-2260.391) (-2268.744) (-2267.946) [-2258.976] * (-2267.808) (-2269.927) [-2251.209] (-2268.771) -- 0:03:47
293000 -- (-2268.817) (-2272.961) [-2258.827] (-2262.908) * (-2267.399) [-2272.284] (-2267.834) (-2279.544) -- 0:03:46
293500 -- (-2275.026) [-2258.422] (-2267.301) (-2264.729) * (-2259.797) (-2277.550) (-2262.973) [-2266.110] -- 0:03:48
294000 -- (-2270.638) [-2263.787] (-2264.726) (-2279.642) * (-2265.861) (-2267.280) [-2261.758] (-2274.264) -- 0:03:48
294500 -- (-2267.941) (-2266.559) [-2265.585] (-2271.442) * (-2271.717) (-2263.284) (-2271.508) [-2267.966] -- 0:03:47
295000 -- (-2272.294) (-2263.712) [-2260.772] (-2264.649) * (-2266.341) (-2270.946) [-2270.680] (-2270.224) -- 0:03:47
Average standard deviation of split frequencies: 0.013378
295500 -- (-2257.535) (-2268.296) (-2267.007) [-2266.518] * (-2267.252) (-2270.369) (-2272.474) [-2266.776] -- 0:03:46
296000 -- (-2259.555) (-2272.566) [-2263.557] (-2261.411) * (-2268.335) (-2267.427) (-2268.461) [-2264.970] -- 0:03:45
296500 -- [-2265.251] (-2268.582) (-2280.224) (-2267.484) * (-2272.358) (-2262.757) (-2275.064) [-2260.070] -- 0:03:45
297000 -- (-2278.894) [-2269.845] (-2264.114) (-2266.997) * (-2266.998) (-2266.446) (-2269.647) [-2259.276] -- 0:03:47
297500 -- (-2281.398) (-2278.447) (-2269.303) [-2264.465] * (-2278.113) (-2262.998) (-2263.679) [-2264.289] -- 0:03:46
298000 -- (-2260.139) (-2265.307) (-2268.272) [-2268.568] * (-2287.108) (-2265.209) (-2270.051) [-2262.064] -- 0:03:46
298500 -- [-2273.128] (-2271.819) (-2266.046) (-2261.059) * [-2266.982] (-2264.983) (-2263.422) (-2265.525) -- 0:03:45
299000 -- (-2260.368) (-2264.786) [-2259.342] (-2274.346) * (-2264.274) (-2267.800) [-2266.168] (-2262.082) -- 0:03:45
299500 -- (-2262.190) (-2267.123) [-2263.075] (-2262.952) * (-2287.455) (-2264.500) (-2263.275) [-2271.954] -- 0:03:44
300000 -- (-2259.578) (-2269.451) (-2265.555) [-2260.291] * (-2271.968) (-2257.295) [-2270.171] (-2266.061) -- 0:03:44
Average standard deviation of split frequencies: 0.013902
300500 -- (-2269.118) (-2271.513) (-2261.321) [-2260.251] * (-2268.208) (-2268.851) (-2266.773) [-2258.812] -- 0:03:45
301000 -- [-2260.871] (-2261.241) (-2273.880) (-2268.778) * (-2268.210) (-2267.246) (-2276.316) [-2264.766] -- 0:03:45
301500 -- (-2270.492) (-2262.372) (-2265.482) [-2269.512] * [-2272.044] (-2263.088) (-2267.905) (-2272.272) -- 0:03:44
302000 -- (-2265.499) (-2263.764) [-2259.587] (-2273.296) * (-2268.019) [-2253.917] (-2275.686) (-2268.436) -- 0:03:44
302500 -- [-2265.299] (-2275.569) (-2272.024) (-2266.235) * (-2266.671) [-2258.161] (-2272.380) (-2266.338) -- 0:03:43
303000 -- (-2268.155) (-2267.118) (-2275.788) [-2266.293] * (-2268.475) (-2263.866) (-2277.051) [-2262.850] -- 0:03:43
303500 -- (-2276.716) (-2266.638) (-2266.252) [-2264.601] * (-2280.720) [-2262.239] (-2262.287) (-2270.151) -- 0:03:42
304000 -- [-2257.018] (-2262.260) (-2264.426) (-2258.826) * (-2264.860) (-2259.462) [-2266.575] (-2267.545) -- 0:03:44
304500 -- [-2265.445] (-2271.082) (-2258.289) (-2274.464) * (-2260.639) [-2263.824] (-2260.143) (-2263.734) -- 0:03:43
305000 -- (-2259.782) (-2294.043) [-2265.104] (-2264.101) * (-2268.587) (-2262.756) (-2262.392) [-2260.497] -- 0:03:43
Average standard deviation of split frequencies: 0.013351
305500 -- (-2263.021) (-2269.689) [-2267.577] (-2263.648) * (-2275.925) (-2273.178) [-2262.196] (-2267.717) -- 0:03:42
306000 -- [-2263.774] (-2278.795) (-2286.090) (-2264.288) * [-2259.621] (-2261.635) (-2268.007) (-2273.710) -- 0:03:42
306500 -- [-2268.902] (-2269.931) (-2276.485) (-2263.956) * (-2271.000) (-2283.578) (-2274.517) [-2264.418] -- 0:03:41
307000 -- (-2276.155) (-2265.850) [-2269.556] (-2270.961) * (-2274.566) (-2263.321) (-2268.237) [-2263.228] -- 0:03:41
307500 -- (-2267.056) [-2263.113] (-2273.186) (-2269.074) * (-2268.717) [-2260.475] (-2268.462) (-2271.842) -- 0:03:42
308000 -- (-2271.762) (-2267.826) [-2263.577] (-2276.617) * (-2268.471) (-2272.590) [-2261.563] (-2265.018) -- 0:03:42
308500 -- [-2261.035] (-2272.921) (-2265.805) (-2266.577) * [-2268.754] (-2271.083) (-2267.561) (-2267.423) -- 0:03:41
309000 -- (-2264.698) (-2260.305) (-2272.241) [-2269.223] * [-2261.086] (-2267.304) (-2258.595) (-2270.290) -- 0:03:41
309500 -- (-2275.708) (-2263.911) (-2271.460) [-2262.588] * (-2271.815) (-2253.767) (-2265.286) [-2271.390] -- 0:03:40
310000 -- [-2262.477] (-2275.537) (-2276.989) (-2258.694) * (-2270.439) [-2261.280] (-2265.630) (-2265.081) -- 0:03:40
Average standard deviation of split frequencies: 0.013657
310500 -- (-2263.622) (-2270.933) [-2266.163] (-2273.863) * (-2269.397) [-2258.783] (-2272.033) (-2261.688) -- 0:03:42
311000 -- (-2263.456) (-2267.674) [-2257.961] (-2266.598) * [-2269.327] (-2270.847) (-2264.435) (-2266.315) -- 0:03:41
311500 -- [-2269.850] (-2271.328) (-2279.176) (-2262.705) * [-2273.061] (-2269.550) (-2261.384) (-2275.672) -- 0:03:41
312000 -- (-2263.893) (-2273.842) (-2263.418) [-2261.934] * [-2262.431] (-2263.491) (-2263.859) (-2273.466) -- 0:03:40
312500 -- [-2275.013] (-2280.082) (-2267.970) (-2270.101) * (-2281.631) [-2263.006] (-2266.129) (-2260.013) -- 0:03:40
313000 -- [-2282.875] (-2272.336) (-2274.871) (-2263.952) * (-2270.723) (-2257.972) [-2257.897] (-2265.933) -- 0:03:39
313500 -- (-2286.848) (-2263.252) [-2267.424] (-2269.246) * (-2261.553) [-2263.443] (-2271.302) (-2262.312) -- 0:03:41
314000 -- (-2268.425) (-2258.702) (-2266.483) [-2269.453] * [-2256.931] (-2263.220) (-2277.547) (-2270.771) -- 0:03:40
314500 -- (-2271.390) (-2259.141) (-2266.903) [-2259.693] * [-2263.753] (-2272.133) (-2264.713) (-2266.235) -- 0:03:40
315000 -- (-2272.818) (-2288.453) [-2257.681] (-2261.185) * [-2266.158] (-2268.125) (-2265.347) (-2271.000) -- 0:03:39
Average standard deviation of split frequencies: 0.011636
315500 -- (-2269.627) (-2262.405) (-2262.468) [-2264.232] * (-2260.181) (-2269.429) [-2259.097] (-2275.101) -- 0:03:39
316000 -- (-2271.968) (-2271.269) (-2266.825) [-2259.282] * [-2267.224] (-2267.781) (-2269.719) (-2272.280) -- 0:03:38
316500 -- (-2272.444) (-2262.951) (-2269.453) [-2259.319] * (-2272.085) (-2268.125) (-2267.819) [-2265.467] -- 0:03:38
317000 -- (-2272.118) (-2260.959) [-2266.565] (-2265.732) * [-2264.518] (-2269.797) (-2275.117) (-2269.101) -- 0:03:39
317500 -- (-2268.336) [-2265.855] (-2270.295) (-2273.180) * [-2266.435] (-2275.311) (-2270.757) (-2269.948) -- 0:03:39
318000 -- [-2260.428] (-2268.007) (-2275.497) (-2268.248) * (-2267.102) (-2268.442) [-2261.266] (-2272.718) -- 0:03:38
318500 -- (-2260.967) (-2269.882) [-2263.208] (-2270.970) * (-2271.346) (-2270.531) [-2258.941] (-2263.895) -- 0:03:38
319000 -- (-2272.832) [-2267.638] (-2270.139) (-2262.881) * (-2265.058) (-2258.918) (-2269.029) [-2258.455] -- 0:03:37
319500 -- (-2261.798) (-2261.320) [-2265.064] (-2269.531) * (-2261.564) (-2267.033) [-2268.205] (-2266.621) -- 0:03:39
320000 -- [-2269.379] (-2265.024) (-2264.661) (-2267.542) * (-2267.486) [-2260.790] (-2271.779) (-2270.780) -- 0:03:38
Average standard deviation of split frequencies: 0.010781
320500 -- (-2263.444) (-2266.534) [-2263.129] (-2281.037) * (-2267.239) (-2277.356) (-2272.950) [-2261.857] -- 0:03:38
321000 -- [-2275.826] (-2264.156) (-2270.831) (-2265.919) * (-2262.356) (-2272.368) (-2268.270) [-2269.542] -- 0:03:37
321500 -- (-2271.379) (-2258.948) [-2258.754] (-2270.330) * (-2268.865) (-2268.512) [-2267.856] (-2273.976) -- 0:03:37
322000 -- [-2274.542] (-2263.965) (-2264.481) (-2276.300) * [-2277.345] (-2265.815) (-2271.119) (-2273.941) -- 0:03:36
322500 -- (-2275.126) (-2270.279) [-2265.210] (-2261.178) * (-2265.485) (-2265.145) [-2270.491] (-2264.438) -- 0:03:36
323000 -- [-2270.009] (-2271.983) (-2265.841) (-2262.851) * (-2267.696) [-2270.646] (-2271.331) (-2267.576) -- 0:03:37
323500 -- (-2259.381) [-2263.956] (-2259.646) (-2277.209) * (-2260.201) (-2266.524) [-2263.926] (-2274.298) -- 0:03:37
324000 -- (-2270.226) (-2270.430) [-2264.145] (-2269.269) * (-2261.637) (-2272.323) [-2259.233] (-2263.997) -- 0:03:36
324500 -- (-2281.487) (-2262.278) [-2265.086] (-2278.929) * (-2270.882) (-2265.803) [-2258.693] (-2268.499) -- 0:03:36
325000 -- [-2265.293] (-2269.274) (-2266.229) (-2258.890) * (-2274.393) [-2261.941] (-2273.791) (-2278.372) -- 0:03:36
Average standard deviation of split frequencies: 0.010797
325500 -- (-2281.121) [-2272.589] (-2264.603) (-2264.646) * [-2263.849] (-2260.298) (-2281.513) (-2266.940) -- 0:03:35
326000 -- (-2271.685) [-2265.232] (-2261.813) (-2263.637) * (-2273.756) (-2269.717) (-2261.272) [-2269.825] -- 0:03:35
326500 -- (-2269.153) (-2274.654) (-2268.225) [-2267.410] * (-2269.887) (-2265.714) (-2257.790) [-2267.655] -- 0:03:36
327000 -- (-2265.885) (-2262.377) (-2264.882) [-2263.802] * (-2259.578) (-2267.444) [-2262.479] (-2264.489) -- 0:03:36
327500 -- (-2267.212) [-2272.478] (-2269.267) (-2271.424) * (-2268.469) [-2258.257] (-2276.175) (-2257.295) -- 0:03:35
328000 -- [-2265.551] (-2264.502) (-2271.688) (-2272.729) * [-2261.337] (-2266.761) (-2280.083) (-2270.505) -- 0:03:35
328500 -- (-2280.182) [-2259.087] (-2261.690) (-2265.911) * (-2264.476) (-2277.954) (-2266.326) [-2266.363] -- 0:03:34
329000 -- (-2269.113) (-2273.606) [-2259.809] (-2274.295) * (-2256.731) (-2264.581) [-2262.499] (-2278.194) -- 0:03:36
329500 -- (-2266.560) [-2261.161] (-2265.842) (-2264.637) * (-2265.070) [-2266.588] (-2270.358) (-2265.294) -- 0:03:35
330000 -- (-2260.005) (-2266.011) (-2257.229) [-2261.856] * (-2263.636) (-2257.197) (-2262.091) [-2260.891] -- 0:03:35
Average standard deviation of split frequencies: 0.011975
330500 -- [-2261.223] (-2272.880) (-2263.845) (-2271.314) * (-2275.026) [-2262.665] (-2258.320) (-2273.139) -- 0:03:34
331000 -- (-2258.484) (-2278.001) (-2277.555) [-2268.565] * (-2262.061) [-2255.986] (-2268.281) (-2272.235) -- 0:03:34
331500 -- (-2269.410) (-2286.056) (-2265.819) [-2266.292] * (-2265.646) (-2265.279) (-2279.893) [-2264.569] -- 0:03:35
332000 -- [-2260.401] (-2275.719) (-2270.085) (-2266.473) * (-2266.839) [-2263.763] (-2278.920) (-2271.764) -- 0:03:35
332500 -- (-2272.506) (-2268.905) (-2270.031) [-2259.270] * (-2260.518) (-2274.635) [-2260.998] (-2267.889) -- 0:03:34
333000 -- (-2271.724) [-2264.875] (-2269.737) (-2262.788) * [-2264.314] (-2274.331) (-2272.722) (-2271.547) -- 0:03:34
333500 -- (-2259.378) (-2273.739) [-2258.889] (-2270.216) * (-2271.616) (-2264.532) [-2260.045] (-2274.039) -- 0:03:33
334000 -- [-2261.254] (-2263.357) (-2273.129) (-2267.258) * (-2269.369) (-2268.785) (-2264.341) [-2263.787] -- 0:03:33
334500 -- (-2267.583) (-2262.424) [-2266.524] (-2272.085) * (-2274.611) (-2275.189) [-2262.917] (-2279.616) -- 0:03:34
335000 -- [-2266.665] (-2264.323) (-2267.206) (-2269.640) * (-2276.465) (-2265.283) [-2264.084] (-2258.658) -- 0:03:34
Average standard deviation of split frequencies: 0.012627
335500 -- [-2257.788] (-2269.465) (-2268.310) (-2289.989) * (-2274.782) (-2266.566) [-2263.844] (-2269.928) -- 0:03:33
336000 -- (-2259.580) (-2256.262) [-2260.554] (-2283.387) * (-2260.581) [-2270.668] (-2272.219) (-2256.999) -- 0:03:33
336500 -- (-2254.794) [-2265.051] (-2270.841) (-2274.108) * (-2269.094) (-2267.826) (-2265.910) [-2262.595] -- 0:03:32
337000 -- (-2274.674) (-2264.620) [-2261.009] (-2265.899) * (-2266.981) (-2261.999) (-2260.174) [-2257.492] -- 0:03:32
337500 -- [-2255.335] (-2262.926) (-2269.805) (-2274.286) * (-2270.913) (-2269.605) (-2262.529) [-2256.889] -- 0:03:32
338000 -- (-2267.235) (-2277.221) [-2258.574] (-2279.567) * [-2256.375] (-2264.029) (-2269.980) (-2265.481) -- 0:03:33
338500 -- [-2263.003] (-2270.824) (-2263.101) (-2265.602) * (-2264.447) [-2264.827] (-2272.449) (-2266.713) -- 0:03:33
339000 -- (-2261.338) [-2259.387] (-2263.781) (-2275.821) * [-2269.418] (-2263.159) (-2271.483) (-2265.092) -- 0:03:32
339500 -- [-2264.781] (-2265.263) (-2272.605) (-2273.680) * (-2261.783) (-2280.942) (-2265.849) [-2258.258] -- 0:03:32
340000 -- (-2266.735) (-2267.420) (-2278.581) [-2270.743] * (-2268.113) (-2271.571) [-2270.842] (-2257.415) -- 0:03:31
Average standard deviation of split frequencies: 0.012731
340500 -- (-2267.258) (-2263.823) [-2260.128] (-2268.473) * (-2271.567) (-2262.121) (-2298.303) [-2264.904] -- 0:03:31
341000 -- (-2265.781) (-2272.673) (-2266.910) [-2256.048] * [-2260.987] (-2265.667) (-2264.618) (-2260.309) -- 0:03:30
341500 -- (-2266.835) (-2268.725) (-2265.397) [-2269.976] * (-2266.630) (-2272.653) (-2270.013) [-2260.072] -- 0:03:32
342000 -- [-2259.205] (-2268.847) (-2261.365) (-2279.859) * (-2272.292) [-2262.016] (-2264.552) (-2269.770) -- 0:03:31
342500 -- (-2276.080) (-2258.324) [-2263.219] (-2264.940) * (-2265.018) [-2258.881] (-2267.214) (-2264.262) -- 0:03:31
343000 -- (-2266.919) (-2269.972) [-2265.128] (-2259.852) * (-2263.999) [-2259.354] (-2276.817) (-2269.401) -- 0:03:30
343500 -- (-2264.844) (-2271.999) [-2273.249] (-2269.784) * (-2267.289) [-2256.397] (-2263.242) (-2276.849) -- 0:03:30
344000 -- (-2266.935) (-2266.571) [-2265.111] (-2264.045) * (-2262.284) [-2261.283] (-2268.728) (-2275.769) -- 0:03:29
344500 -- (-2274.150) [-2260.499] (-2271.007) (-2270.889) * [-2262.960] (-2262.794) (-2263.263) (-2269.915) -- 0:03:29
345000 -- (-2273.032) [-2264.321] (-2269.526) (-2277.835) * (-2288.024) (-2259.850) [-2260.533] (-2273.120) -- 0:03:30
Average standard deviation of split frequencies: 0.011535
345500 -- [-2260.170] (-2272.425) (-2262.384) (-2264.391) * (-2266.745) (-2266.495) [-2263.838] (-2273.200) -- 0:03:30
346000 -- (-2271.213) (-2264.454) (-2268.025) [-2265.192] * (-2267.240) [-2263.341] (-2271.054) (-2263.906) -- 0:03:29
346500 -- (-2268.191) (-2266.737) [-2263.808] (-2264.615) * (-2259.501) (-2268.846) (-2258.598) [-2261.561] -- 0:03:29
347000 -- (-2264.489) [-2266.600] (-2273.455) (-2269.841) * [-2266.399] (-2271.171) (-2261.258) (-2277.876) -- 0:03:28
347500 -- (-2266.937) (-2260.723) [-2265.168] (-2266.629) * (-2263.573) (-2276.182) [-2267.436] (-2265.035) -- 0:03:28
348000 -- [-2267.494] (-2265.215) (-2266.026) (-2263.359) * (-2264.817) (-2272.553) [-2262.559] (-2274.656) -- 0:03:27
348500 -- (-2273.311) (-2277.103) (-2262.180) [-2268.129] * (-2269.526) [-2276.590] (-2271.883) (-2271.406) -- 0:03:29
349000 -- (-2265.688) (-2258.117) (-2258.617) [-2267.450] * [-2263.277] (-2272.849) (-2266.388) (-2259.529) -- 0:03:28
349500 -- (-2271.505) (-2273.718) (-2284.656) [-2269.079] * (-2266.722) (-2264.824) (-2262.898) [-2270.795] -- 0:03:28
350000 -- (-2262.115) (-2266.562) (-2263.788) [-2264.751] * (-2282.801) (-2256.079) (-2262.312) [-2260.011] -- 0:03:28
Average standard deviation of split frequencies: 0.011292
350500 -- (-2275.124) [-2262.185] (-2262.076) (-2277.254) * (-2269.559) (-2271.035) (-2283.025) [-2265.339] -- 0:03:27
351000 -- (-2267.567) [-2265.327] (-2262.106) (-2264.703) * (-2268.101) (-2261.989) (-2290.000) [-2258.409] -- 0:03:27
351500 -- [-2258.902] (-2264.635) (-2276.392) (-2268.959) * [-2270.434] (-2263.193) (-2272.418) (-2268.915) -- 0:03:26
352000 -- (-2271.232) (-2264.708) [-2268.789] (-2280.129) * (-2263.751) [-2262.499] (-2263.585) (-2273.361) -- 0:03:28
352500 -- (-2263.433) [-2266.925] (-2260.351) (-2274.928) * (-2268.605) (-2278.373) [-2268.320] (-2287.767) -- 0:03:27
353000 -- (-2264.644) [-2261.551] (-2262.367) (-2264.847) * (-2259.803) (-2270.448) [-2262.121] (-2273.260) -- 0:03:27
353500 -- (-2267.085) [-2267.167] (-2266.932) (-2273.029) * (-2264.406) (-2273.004) [-2261.329] (-2266.171) -- 0:03:26
354000 -- (-2264.970) (-2276.893) (-2266.698) [-2262.833] * (-2272.074) (-2262.110) [-2261.078] (-2263.153) -- 0:03:26
354500 -- (-2272.081) [-2258.950] (-2261.205) (-2269.805) * (-2262.042) (-2280.208) (-2276.604) [-2266.351] -- 0:03:25
355000 -- [-2260.148] (-2258.079) (-2258.748) (-2270.578) * [-2259.887] (-2263.336) (-2275.198) (-2275.163) -- 0:03:25
Average standard deviation of split frequencies: 0.012447
355500 -- (-2271.045) [-2269.482] (-2265.947) (-2265.874) * (-2262.041) (-2265.920) (-2265.904) [-2268.843] -- 0:03:26
356000 -- [-2258.548] (-2282.208) (-2272.056) (-2266.968) * (-2261.468) (-2268.250) [-2268.852] (-2261.960) -- 0:03:26
356500 -- (-2257.652) (-2272.424) (-2271.895) [-2261.792] * [-2262.998] (-2267.293) (-2269.545) (-2264.494) -- 0:03:25
357000 -- (-2268.061) (-2270.423) [-2270.621] (-2273.769) * [-2262.906] (-2264.163) (-2261.632) (-2276.489) -- 0:03:25
357500 -- [-2267.318] (-2287.237) (-2270.074) (-2264.025) * (-2272.239) (-2274.932) [-2256.705] (-2278.821) -- 0:03:24
358000 -- (-2266.855) (-2265.632) (-2270.424) [-2266.876] * [-2261.761] (-2268.326) (-2274.904) (-2284.768) -- 0:03:24
358500 -- (-2282.605) (-2272.592) [-2275.592] (-2274.910) * (-2266.767) (-2265.950) [-2263.653] (-2269.535) -- 0:03:23
359000 -- (-2279.068) (-2272.481) [-2269.933] (-2275.513) * (-2284.388) [-2264.367] (-2268.098) (-2263.258) -- 0:03:25
359500 -- [-2263.523] (-2265.550) (-2278.335) (-2266.635) * (-2278.497) [-2256.535] (-2269.301) (-2268.028) -- 0:03:24
360000 -- (-2284.823) [-2264.470] (-2262.979) (-2264.393) * (-2266.577) [-2264.177] (-2261.652) (-2265.155) -- 0:03:24
Average standard deviation of split frequencies: 0.011676
360500 -- [-2264.645] (-2269.988) (-2263.025) (-2271.953) * (-2271.643) [-2272.464] (-2257.235) (-2262.191) -- 0:03:24
361000 -- [-2267.046] (-2261.045) (-2271.636) (-2272.903) * [-2268.047] (-2266.566) (-2275.272) (-2266.664) -- 0:03:23
361500 -- (-2264.814) [-2261.545] (-2277.818) (-2275.872) * (-2267.311) (-2271.065) (-2275.855) [-2265.346] -- 0:03:23
362000 -- [-2269.761] (-2268.402) (-2272.690) (-2266.525) * (-2269.023) [-2268.393] (-2266.396) (-2261.564) -- 0:03:22
362500 -- (-2262.433) (-2271.093) (-2265.158) [-2255.499] * (-2267.715) (-2271.606) [-2256.437] (-2269.178) -- 0:03:24
363000 -- (-2268.204) [-2261.577] (-2271.525) (-2272.450) * (-2261.462) (-2267.709) [-2254.864] (-2272.640) -- 0:03:23
363500 -- (-2263.436) (-2275.512) (-2264.754) [-2271.431] * (-2279.594) [-2254.952] (-2272.634) (-2263.538) -- 0:03:23
364000 -- [-2266.218] (-2263.855) (-2267.169) (-2270.407) * (-2268.979) (-2269.926) [-2264.624] (-2264.853) -- 0:03:22
364500 -- [-2264.430] (-2267.769) (-2275.258) (-2274.143) * (-2259.379) [-2258.883] (-2268.576) (-2264.906) -- 0:03:22
365000 -- (-2265.925) (-2263.891) (-2273.248) [-2269.296] * [-2266.975] (-2259.723) (-2263.692) (-2275.020) -- 0:03:21
Average standard deviation of split frequencies: 0.011764
365500 -- (-2269.754) (-2259.995) (-2272.297) [-2275.087] * (-2256.039) [-2263.452] (-2257.542) (-2259.855) -- 0:03:21
366000 -- (-2269.491) (-2264.311) [-2261.326] (-2264.785) * [-2254.929] (-2263.645) (-2259.189) (-2274.128) -- 0:03:22
366500 -- (-2263.693) (-2260.034) [-2268.990] (-2273.480) * (-2269.759) (-2277.530) [-2260.364] (-2268.318) -- 0:03:22
367000 -- (-2262.370) (-2262.609) [-2268.688] (-2259.848) * (-2265.646) (-2268.117) (-2264.145) [-2261.361] -- 0:03:21
367500 -- (-2269.278) [-2262.666] (-2280.987) (-2280.163) * (-2272.378) (-2268.786) (-2262.837) [-2260.422] -- 0:03:21
368000 -- (-2266.114) [-2263.756] (-2266.237) (-2274.065) * (-2276.207) (-2252.016) (-2268.737) [-2266.671] -- 0:03:20
368500 -- [-2277.892] (-2278.872) (-2267.044) (-2275.082) * (-2264.328) (-2264.985) (-2268.893) [-2263.077] -- 0:03:20
369000 -- (-2269.168) (-2269.437) [-2268.260] (-2273.704) * (-2273.185) (-2269.275) [-2258.597] (-2267.065) -- 0:03:20
369500 -- [-2262.141] (-2270.610) (-2265.990) (-2269.935) * [-2263.656] (-2266.781) (-2269.023) (-2263.910) -- 0:03:21
370000 -- (-2273.567) (-2272.366) (-2279.152) [-2264.467] * [-2261.805] (-2259.339) (-2264.188) (-2266.219) -- 0:03:20
Average standard deviation of split frequencies: 0.011446
370500 -- (-2262.230) (-2271.536) [-2268.786] (-2268.190) * (-2261.704) [-2260.805] (-2260.493) (-2262.635) -- 0:03:20
371000 -- [-2260.539] (-2272.675) (-2261.203) (-2272.479) * [-2257.508] (-2259.559) (-2260.795) (-2261.669) -- 0:03:20
371500 -- (-2266.087) (-2270.687) (-2260.509) [-2264.858] * [-2256.647] (-2271.763) (-2264.770) (-2271.206) -- 0:03:19
372000 -- (-2271.722) (-2282.675) (-2265.507) [-2263.927] * [-2262.619] (-2270.898) (-2269.425) (-2273.063) -- 0:03:19
372500 -- [-2262.598] (-2270.000) (-2271.196) (-2265.567) * (-2264.507) (-2276.260) [-2266.748] (-2263.740) -- 0:03:18
373000 -- [-2268.583] (-2273.875) (-2267.282) (-2269.107) * [-2263.959] (-2277.743) (-2273.266) (-2265.533) -- 0:03:20
373500 -- [-2270.422] (-2274.485) (-2262.592) (-2264.531) * (-2267.653) (-2267.542) [-2263.036] (-2266.154) -- 0:03:19
374000 -- [-2262.110] (-2268.025) (-2266.337) (-2273.878) * (-2289.753) (-2255.667) (-2270.416) [-2266.625] -- 0:03:19
374500 -- (-2267.860) [-2260.101] (-2265.460) (-2265.382) * (-2288.759) (-2277.808) [-2261.780] (-2271.237) -- 0:03:18
375000 -- (-2264.818) [-2260.911] (-2258.907) (-2271.767) * (-2267.281) (-2266.008) (-2265.412) [-2268.452] -- 0:03:18
Average standard deviation of split frequencies: 0.010782
375500 -- (-2283.751) (-2271.263) [-2266.407] (-2271.172) * (-2263.388) [-2271.994] (-2267.551) (-2275.192) -- 0:03:17
376000 -- [-2266.798] (-2273.615) (-2273.289) (-2272.900) * (-2274.192) (-2263.721) (-2266.243) [-2257.781] -- 0:03:17
376500 -- (-2276.961) (-2277.618) (-2259.625) [-2268.779] * (-2264.856) [-2258.153] (-2256.701) (-2276.590) -- 0:03:18
377000 -- [-2265.489] (-2271.900) (-2258.225) (-2274.130) * [-2261.433] (-2269.729) (-2279.399) (-2280.831) -- 0:03:18
377500 -- [-2263.917] (-2266.052) (-2263.819) (-2272.887) * [-2267.811] (-2266.564) (-2263.049) (-2268.671) -- 0:03:17
378000 -- (-2254.403) (-2274.889) [-2260.694] (-2274.620) * (-2260.250) [-2260.472] (-2264.831) (-2273.430) -- 0:03:17
378500 -- [-2270.189] (-2270.890) (-2264.787) (-2262.803) * [-2274.062] (-2265.185) (-2263.713) (-2277.175) -- 0:03:17
379000 -- (-2260.507) (-2276.786) (-2259.467) [-2257.442] * (-2266.182) [-2268.201] (-2275.239) (-2266.432) -- 0:03:18
379500 -- (-2267.022) [-2269.364] (-2266.342) (-2272.229) * (-2258.389) (-2259.984) (-2276.480) [-2273.261] -- 0:03:17
380000 -- (-2268.338) [-2269.573] (-2271.235) (-2268.232) * [-2251.661] (-2265.674) (-2261.948) (-2266.287) -- 0:03:17
Average standard deviation of split frequencies: 0.011228
380500 -- (-2271.490) (-2265.153) [-2264.456] (-2268.082) * (-2265.951) (-2278.338) [-2263.872] (-2264.171) -- 0:03:17
381000 -- (-2279.819) (-2262.622) (-2263.145) [-2267.998] * (-2275.490) (-2266.634) [-2265.866] (-2273.835) -- 0:03:16
381500 -- (-2274.020) (-2278.417) [-2267.807] (-2264.109) * (-2271.966) [-2256.077] (-2267.376) (-2263.477) -- 0:03:17
382000 -- [-2263.471] (-2267.452) (-2269.429) (-2266.159) * (-2265.973) (-2265.745) (-2264.794) [-2263.376] -- 0:03:17
382500 -- (-2260.651) (-2258.709) [-2263.402] (-2266.943) * (-2267.238) (-2266.854) (-2279.089) [-2256.156] -- 0:03:16
383000 -- (-2273.185) (-2260.450) (-2278.268) [-2260.351] * (-2255.056) (-2269.072) [-2262.736] (-2265.036) -- 0:03:16
383500 -- [-2265.090] (-2266.307) (-2268.329) (-2264.535) * (-2265.993) [-2269.360] (-2268.258) (-2278.448) -- 0:03:16
384000 -- (-2262.084) (-2261.373) (-2267.571) [-2256.007] * (-2269.257) (-2263.496) (-2287.285) [-2267.643] -- 0:03:15
384500 -- [-2256.967] (-2270.691) (-2262.967) (-2261.637) * (-2270.393) [-2271.959] (-2280.043) (-2263.086) -- 0:03:16
385000 -- [-2262.180] (-2267.145) (-2272.048) (-2268.001) * [-2263.935] (-2270.684) (-2268.728) (-2267.908) -- 0:03:16
Average standard deviation of split frequencies: 0.010014
385500 -- (-2267.959) [-2262.945] (-2264.841) (-2267.715) * (-2258.810) [-2264.182] (-2282.307) (-2258.664) -- 0:03:16
386000 -- [-2267.050] (-2262.407) (-2269.643) (-2263.563) * (-2271.414) (-2262.681) (-2274.246) [-2258.668] -- 0:03:15
386500 -- [-2261.993] (-2267.930) (-2268.342) (-2258.466) * (-2266.492) (-2266.845) (-2280.323) [-2265.922] -- 0:03:15
387000 -- (-2271.483) (-2261.969) (-2270.245) [-2266.962] * (-2283.626) [-2272.238] (-2260.545) (-2266.182) -- 0:03:14
387500 -- [-2261.623] (-2273.164) (-2276.099) (-2275.683) * [-2262.365] (-2268.425) (-2265.686) (-2270.200) -- 0:03:16
388000 -- (-2265.149) (-2277.409) [-2262.731] (-2277.253) * (-2265.758) (-2268.613) [-2256.432] (-2278.097) -- 0:03:15
388500 -- (-2262.292) (-2273.843) (-2282.489) [-2269.667] * (-2262.601) (-2271.318) (-2262.435) [-2267.455] -- 0:03:15
389000 -- (-2271.387) (-2261.242) [-2267.910] (-2266.509) * [-2266.229] (-2272.221) (-2268.881) (-2262.180) -- 0:03:14
389500 -- (-2264.439) [-2265.299] (-2277.745) (-2271.676) * (-2264.119) [-2259.983] (-2260.207) (-2265.347) -- 0:03:14
390000 -- [-2269.712] (-2267.229) (-2266.771) (-2260.406) * (-2278.355) (-2262.120) (-2263.152) [-2262.253] -- 0:03:13
Average standard deviation of split frequencies: 0.009653
390500 -- (-2272.270) (-2259.888) [-2262.289] (-2264.253) * [-2267.304] (-2269.090) (-2269.295) (-2260.060) -- 0:03:13
391000 -- (-2271.617) (-2271.474) [-2262.353] (-2265.705) * (-2267.789) (-2261.507) [-2267.680] (-2262.824) -- 0:03:14
391500 -- (-2272.278) (-2269.728) (-2258.762) [-2264.723] * (-2272.429) (-2262.522) [-2262.049] (-2258.170) -- 0:03:14
392000 -- [-2272.794] (-2267.114) (-2276.412) (-2268.325) * (-2266.428) (-2266.592) (-2259.346) [-2259.562] -- 0:03:13
392500 -- [-2263.269] (-2268.251) (-2259.893) (-2263.478) * [-2261.938] (-2267.108) (-2264.942) (-2264.259) -- 0:03:13
393000 -- (-2271.728) (-2273.075) [-2270.329] (-2268.377) * (-2266.743) (-2260.861) (-2271.285) [-2267.216] -- 0:03:13
393500 -- (-2262.201) (-2270.906) [-2264.512] (-2266.507) * (-2276.945) [-2273.158] (-2268.780) (-2261.136) -- 0:03:14
394000 -- (-2270.200) (-2272.707) (-2266.719) [-2271.154] * (-2264.214) [-2264.797] (-2282.372) (-2260.873) -- 0:03:13
394500 -- (-2260.575) (-2269.250) [-2268.403] (-2267.018) * (-2258.483) (-2273.959) (-2265.363) [-2256.168] -- 0:03:13
395000 -- [-2262.981] (-2262.504) (-2262.400) (-2265.788) * (-2266.538) [-2271.884] (-2284.445) (-2266.189) -- 0:03:12
Average standard deviation of split frequencies: 0.010158
395500 -- [-2270.551] (-2272.180) (-2277.543) (-2278.249) * (-2271.135) (-2273.028) (-2266.894) [-2266.476] -- 0:03:12
396000 -- (-2270.416) [-2255.014] (-2258.932) (-2267.051) * (-2266.966) (-2270.238) [-2265.006] (-2267.386) -- 0:03:12
396500 -- [-2263.047] (-2260.494) (-2264.446) (-2263.200) * [-2266.390] (-2269.633) (-2276.833) (-2259.225) -- 0:03:13
397000 -- (-2267.340) (-2266.600) [-2259.562] (-2274.400) * (-2253.925) (-2277.231) (-2269.692) [-2263.457] -- 0:03:12
397500 -- (-2263.485) [-2262.777] (-2264.686) (-2283.482) * [-2266.666] (-2271.142) (-2271.333) (-2263.940) -- 0:03:12
398000 -- (-2262.490) [-2262.221] (-2266.916) (-2267.866) * [-2255.001] (-2268.074) (-2268.373) (-2265.440) -- 0:03:12
398500 -- (-2260.979) (-2268.940) [-2264.410] (-2263.463) * [-2260.577] (-2271.112) (-2265.926) (-2268.530) -- 0:03:11
399000 -- [-2256.789] (-2275.926) (-2266.034) (-2274.336) * (-2262.146) (-2270.532) (-2261.770) [-2265.113] -- 0:03:11
399500 -- (-2263.509) (-2269.774) [-2253.282] (-2265.480) * (-2269.060) (-2268.358) (-2266.240) [-2260.762] -- 0:03:12
400000 -- (-2265.521) [-2266.743] (-2268.456) (-2256.356) * (-2258.385) [-2258.389] (-2272.003) (-2262.567) -- 0:03:12
Average standard deviation of split frequencies: 0.010432
400500 -- (-2269.431) (-2282.316) (-2263.603) [-2260.994] * (-2268.752) [-2266.625] (-2278.864) (-2261.846) -- 0:03:11
401000 -- [-2265.125] (-2262.016) (-2260.784) (-2262.649) * (-2271.411) [-2263.539] (-2279.034) (-2262.494) -- 0:03:11
401500 -- [-2256.920] (-2261.032) (-2255.257) (-2274.459) * (-2271.334) (-2263.595) [-2259.162] (-2265.780) -- 0:03:10
402000 -- (-2262.249) [-2258.231] (-2269.393) (-2268.486) * (-2278.205) (-2265.890) [-2265.924] (-2275.721) -- 0:03:10
402500 -- (-2267.030) (-2277.084) [-2265.826] (-2261.936) * (-2269.043) (-2264.858) (-2260.005) [-2267.084] -- 0:03:10
403000 -- (-2266.893) (-2261.518) [-2259.142] (-2265.820) * (-2274.905) (-2261.931) (-2263.568) [-2273.496] -- 0:03:11
403500 -- (-2272.766) (-2269.765) [-2264.247] (-2264.989) * (-2281.750) [-2259.243] (-2264.751) (-2260.531) -- 0:03:10
404000 -- (-2269.226) (-2259.732) (-2269.905) [-2264.198] * (-2272.952) (-2263.715) (-2259.784) [-2267.977] -- 0:03:10
404500 -- (-2269.089) (-2258.751) (-2267.105) [-2265.806] * [-2261.749] (-2273.018) (-2274.813) (-2272.878) -- 0:03:09
405000 -- [-2267.886] (-2268.709) (-2271.864) (-2279.333) * (-2263.086) (-2269.728) [-2264.528] (-2264.144) -- 0:03:09
Average standard deviation of split frequencies: 0.010372
405500 -- (-2270.829) (-2274.185) (-2265.831) [-2260.435] * (-2270.652) (-2262.595) [-2258.477] (-2264.444) -- 0:03:10
406000 -- (-2267.792) (-2273.466) (-2265.558) [-2262.552] * (-2261.061) (-2273.042) [-2272.386] (-2261.604) -- 0:03:10
406500 -- (-2273.288) (-2265.215) [-2271.715] (-2265.901) * [-2271.816] (-2267.421) (-2260.058) (-2276.104) -- 0:03:09
407000 -- (-2272.241) [-2270.300] (-2267.748) (-2267.236) * (-2265.260) (-2265.699) (-2264.971) [-2265.766] -- 0:03:09
407500 -- (-2276.318) (-2271.061) [-2267.392] (-2275.126) * (-2266.040) [-2264.591] (-2263.900) (-2276.424) -- 0:03:09
408000 -- (-2273.147) (-2269.431) [-2270.083] (-2260.750) * [-2257.900] (-2260.105) (-2267.971) (-2273.331) -- 0:03:08
408500 -- (-2266.158) (-2272.873) (-2283.136) [-2260.321] * [-2265.873] (-2267.851) (-2265.911) (-2265.241) -- 0:03:09
409000 -- (-2267.856) (-2264.245) (-2281.996) [-2260.719] * (-2276.213) (-2263.596) (-2276.377) [-2256.275] -- 0:03:09
409500 -- [-2271.625] (-2270.571) (-2277.097) (-2275.062) * (-2271.767) (-2269.608) [-2263.695] (-2267.880) -- 0:03:08
410000 -- [-2264.593] (-2275.081) (-2262.694) (-2274.705) * (-2267.380) (-2268.516) (-2262.682) [-2261.858] -- 0:03:08
Average standard deviation of split frequencies: 0.010484
410500 -- (-2272.097) (-2276.390) [-2259.012] (-2262.812) * (-2269.429) [-2270.337] (-2268.765) (-2266.741) -- 0:03:08
411000 -- (-2267.191) (-2272.902) [-2261.350] (-2267.014) * (-2276.261) (-2265.025) (-2260.899) [-2259.447] -- 0:03:07
411500 -- (-2267.990) [-2278.567] (-2262.493) (-2271.158) * (-2276.681) (-2263.393) (-2264.111) [-2265.685] -- 0:03:07
412000 -- (-2274.503) (-2263.066) (-2259.909) [-2269.136] * [-2265.237] (-2272.491) (-2268.531) (-2266.608) -- 0:03:08
412500 -- (-2266.215) (-2261.364) (-2276.961) [-2266.667] * [-2266.334] (-2270.052) (-2268.018) (-2277.645) -- 0:03:08
413000 -- (-2273.662) [-2264.280] (-2274.684) (-2271.715) * (-2262.996) (-2279.029) (-2274.965) [-2262.491] -- 0:03:07
413500 -- (-2270.942) (-2268.023) (-2261.461) [-2262.762] * (-2281.106) (-2264.074) (-2270.353) [-2264.264] -- 0:03:07
414000 -- [-2269.727] (-2279.704) (-2263.439) (-2266.878) * [-2263.883] (-2269.368) (-2274.660) (-2270.365) -- 0:03:06
414500 -- (-2271.239) (-2279.610) [-2260.299] (-2268.380) * (-2273.947) [-2262.567] (-2264.067) (-2257.322) -- 0:03:06
415000 -- (-2263.683) (-2269.126) [-2258.671] (-2269.945) * [-2267.137] (-2281.913) (-2281.414) (-2268.453) -- 0:03:06
Average standard deviation of split frequencies: 0.010350
415500 -- (-2272.394) [-2269.057] (-2271.106) (-2263.733) * [-2261.631] (-2268.581) (-2273.768) (-2268.296) -- 0:03:07
416000 -- (-2271.736) (-2266.361) [-2266.632] (-2269.633) * (-2266.484) (-2270.455) [-2267.309] (-2276.360) -- 0:03:06
416500 -- [-2261.740] (-2266.691) (-2265.616) (-2265.445) * [-2270.602] (-2274.480) (-2267.922) (-2270.693) -- 0:03:06
417000 -- (-2268.835) (-2269.211) (-2263.743) [-2271.405] * [-2264.400] (-2254.144) (-2273.677) (-2276.069) -- 0:03:05
417500 -- (-2276.397) (-2265.103) [-2256.961] (-2277.818) * (-2272.439) [-2266.790] (-2270.968) (-2276.384) -- 0:03:05
418000 -- (-2272.710) [-2265.027] (-2263.497) (-2274.801) * (-2264.546) (-2267.371) (-2276.571) [-2264.457] -- 0:03:05
418500 -- (-2269.269) [-2273.428] (-2265.225) (-2265.700) * [-2262.504] (-2272.465) (-2287.556) (-2271.486) -- 0:03:04
419000 -- (-2274.719) (-2267.960) [-2258.936] (-2265.968) * [-2263.070] (-2261.175) (-2270.673) (-2263.362) -- 0:03:05
419500 -- (-2272.617) [-2258.568] (-2271.280) (-2262.992) * (-2274.596) [-2261.751] (-2275.291) (-2259.199) -- 0:03:05
420000 -- (-2276.203) (-2263.580) [-2261.685] (-2266.669) * (-2268.311) (-2267.526) [-2269.703] (-2265.613) -- 0:03:05
Average standard deviation of split frequencies: 0.009787
420500 -- [-2258.716] (-2275.207) (-2258.087) (-2269.068) * [-2260.036] (-2265.075) (-2270.514) (-2266.884) -- 0:03:04
421000 -- [-2261.942] (-2267.996) (-2265.972) (-2288.063) * (-2258.165) (-2270.225) [-2278.589] (-2280.515) -- 0:03:04
421500 -- (-2265.662) [-2262.212] (-2263.673) (-2268.443) * [-2258.683] (-2264.923) (-2261.652) (-2281.642) -- 0:03:03
422000 -- (-2254.209) [-2264.904] (-2262.383) (-2266.131) * [-2267.309] (-2262.195) (-2279.495) (-2271.657) -- 0:03:03
422500 -- (-2269.348) (-2270.613) (-2270.417) [-2264.937] * [-2270.174] (-2267.375) (-2272.697) (-2260.639) -- 0:03:04
423000 -- (-2263.780) (-2263.851) (-2266.362) [-2265.304] * (-2264.750) (-2265.632) (-2260.693) [-2259.931] -- 0:03:04
423500 -- (-2271.586) (-2267.666) [-2264.044] (-2270.946) * (-2271.044) (-2265.217) [-2265.343] (-2263.364) -- 0:03:03
424000 -- (-2271.794) (-2275.347) [-2264.061] (-2267.877) * (-2257.528) (-2267.828) (-2259.163) [-2266.753] -- 0:03:03
424500 -- [-2268.378] (-2259.221) (-2267.756) (-2270.811) * (-2259.185) (-2283.681) (-2263.326) [-2266.350] -- 0:03:03
425000 -- [-2258.832] (-2279.012) (-2267.649) (-2268.331) * (-2266.026) (-2281.493) (-2261.638) [-2256.005] -- 0:03:04
Average standard deviation of split frequencies: 0.009000
425500 -- [-2264.116] (-2259.538) (-2261.519) (-2265.950) * (-2268.942) [-2264.823] (-2269.387) (-2265.002) -- 0:03:03
426000 -- (-2263.162) (-2265.651) (-2261.976) [-2268.687] * (-2271.979) (-2264.549) (-2264.901) [-2264.916] -- 0:03:03
426500 -- (-2262.509) (-2270.211) [-2266.174] (-2279.570) * (-2264.873) (-2281.028) (-2262.113) [-2264.530] -- 0:03:02
427000 -- (-2265.772) (-2267.553) (-2263.322) [-2264.749] * (-2269.051) (-2273.841) (-2269.552) [-2267.825] -- 0:03:02
427500 -- (-2271.316) (-2266.320) (-2269.419) [-2267.427] * [-2261.757] (-2270.483) (-2276.676) (-2270.350) -- 0:03:02
428000 -- [-2277.304] (-2272.600) (-2268.422) (-2267.463) * (-2274.654) [-2265.201] (-2266.355) (-2280.957) -- 0:03:01
428500 -- (-2265.360) [-2270.501] (-2257.785) (-2272.262) * [-2255.012] (-2274.508) (-2285.331) (-2277.754) -- 0:03:02
429000 -- (-2268.002) (-2288.422) [-2259.302] (-2275.513) * (-2258.327) (-2269.066) (-2265.243) [-2265.245] -- 0:03:02
429500 -- (-2274.567) (-2263.982) (-2263.216) [-2266.781] * (-2271.635) (-2258.640) [-2258.248] (-2280.121) -- 0:03:01
430000 -- (-2261.853) (-2269.928) [-2265.428] (-2267.677) * (-2260.278) (-2266.474) [-2266.628] (-2270.096) -- 0:03:01
Average standard deviation of split frequencies: 0.008976
430500 -- [-2267.394] (-2285.615) (-2270.940) (-2260.725) * (-2267.569) (-2267.640) (-2266.672) [-2258.272] -- 0:03:01
431000 -- (-2275.576) (-2276.426) (-2267.207) [-2262.574] * (-2267.487) [-2264.815] (-2277.428) (-2262.030) -- 0:03:00
431500 -- (-2276.592) (-2278.502) [-2263.401] (-2264.741) * (-2278.724) (-2263.750) [-2258.279] (-2268.960) -- 0:03:01
432000 -- (-2272.080) (-2274.660) (-2268.875) [-2261.521] * (-2261.190) [-2258.714] (-2272.026) (-2269.093) -- 0:03:01
432500 -- (-2266.304) (-2275.439) [-2263.467] (-2275.013) * (-2282.665) [-2268.557] (-2276.840) (-2273.344) -- 0:03:01
433000 -- (-2287.245) (-2278.773) [-2259.724] (-2279.771) * (-2275.923) [-2256.796] (-2265.158) (-2275.685) -- 0:03:00
433500 -- (-2266.224) (-2275.894) (-2269.298) [-2271.874] * (-2273.880) (-2274.719) (-2274.233) [-2265.188] -- 0:03:00
434000 -- (-2273.869) [-2264.490] (-2268.830) (-2268.016) * (-2259.861) [-2260.062] (-2261.537) (-2270.421) -- 0:02:59
434500 -- (-2274.481) (-2271.009) (-2267.468) [-2264.796] * [-2266.615] (-2275.909) (-2267.837) (-2269.358) -- 0:03:00
435000 -- (-2277.145) (-2280.359) (-2266.894) [-2262.175] * (-2264.755) (-2267.184) [-2261.935] (-2274.767) -- 0:03:00
Average standard deviation of split frequencies: 0.009082
435500 -- (-2261.919) (-2272.707) (-2268.916) [-2261.928] * (-2262.985) (-2270.897) (-2264.874) [-2261.415] -- 0:03:00
436000 -- (-2279.218) (-2277.375) (-2261.664) [-2267.588] * (-2262.655) (-2273.903) (-2267.523) [-2263.257] -- 0:02:59
436500 -- (-2271.476) (-2278.722) (-2268.051) [-2269.299] * (-2263.950) (-2276.627) [-2260.505] (-2267.620) -- 0:02:59
437000 -- [-2263.985] (-2274.355) (-2275.470) (-2266.563) * (-2270.062) (-2272.440) [-2263.806] (-2272.126) -- 0:02:59
437500 -- [-2260.676] (-2278.331) (-2264.311) (-2269.550) * (-2276.949) (-2266.280) (-2266.939) [-2262.800] -- 0:02:58
438000 -- [-2265.444] (-2280.827) (-2266.267) (-2269.093) * (-2282.068) (-2263.351) (-2260.072) [-2259.879] -- 0:02:59
438500 -- (-2264.293) (-2272.323) (-2281.088) [-2260.900] * (-2269.761) (-2262.404) (-2258.205) [-2263.553] -- 0:02:59
439000 -- (-2265.728) (-2272.415) (-2279.041) [-2265.465] * (-2269.949) [-2275.399] (-2260.198) (-2269.152) -- 0:02:58
439500 -- [-2262.840] (-2265.434) (-2260.503) (-2268.092) * (-2275.967) [-2261.768] (-2262.798) (-2259.942) -- 0:02:58
440000 -- (-2262.694) [-2262.034] (-2270.407) (-2265.662) * (-2268.129) (-2271.107) (-2265.604) [-2259.164] -- 0:02:58
Average standard deviation of split frequencies: 0.008273
440500 -- [-2268.305] (-2276.684) (-2261.287) (-2261.482) * [-2264.152] (-2261.667) (-2260.658) (-2263.818) -- 0:02:59
441000 -- (-2262.795) (-2268.200) (-2262.009) [-2269.914] * (-2265.882) [-2260.191] (-2268.850) (-2277.002) -- 0:02:58
441500 -- (-2265.618) (-2269.090) [-2257.033] (-2257.014) * [-2267.496] (-2269.881) (-2264.001) (-2266.081) -- 0:02:58
442000 -- [-2266.607] (-2275.081) (-2253.835) (-2258.985) * (-2273.491) (-2273.884) [-2264.096] (-2275.523) -- 0:02:58
442500 -- [-2267.878] (-2260.706) (-2266.772) (-2285.092) * (-2264.445) [-2263.435] (-2275.182) (-2273.974) -- 0:02:57
443000 -- [-2277.734] (-2267.095) (-2264.844) (-2280.404) * (-2263.768) (-2267.056) [-2266.442] (-2262.930) -- 0:02:58
443500 -- (-2272.088) [-2255.448] (-2288.230) (-2269.757) * (-2264.939) [-2266.626] (-2265.838) (-2266.036) -- 0:02:58
444000 -- [-2274.907] (-2265.229) (-2271.469) (-2268.292) * (-2273.788) (-2284.008) (-2278.770) [-2259.649] -- 0:02:57
444500 -- (-2261.442) (-2262.000) (-2270.976) [-2258.193] * [-2260.352] (-2268.897) (-2270.572) (-2260.540) -- 0:02:57
445000 -- (-2266.177) (-2275.129) [-2257.161] (-2272.773) * [-2270.761] (-2276.905) (-2272.509) (-2266.585) -- 0:02:57
Average standard deviation of split frequencies: 0.008103
445500 -- [-2259.716] (-2269.878) (-2273.198) (-2267.626) * (-2260.752) (-2261.116) [-2264.889] (-2272.592) -- 0:02:56
446000 -- (-2270.530) (-2273.062) (-2267.562) [-2265.161] * (-2287.022) (-2267.328) (-2271.737) [-2270.004] -- 0:02:56
446500 -- (-2267.726) (-2273.338) [-2267.773] (-2268.760) * (-2265.963) (-2269.961) [-2255.897] (-2266.707) -- 0:02:57
447000 -- (-2265.663) [-2264.237] (-2273.282) (-2277.463) * (-2269.720) (-2261.592) (-2270.465) [-2259.514] -- 0:02:56
447500 -- (-2273.787) [-2272.329] (-2266.369) (-2271.081) * (-2262.584) (-2263.512) (-2269.345) [-2255.167] -- 0:02:56
448000 -- (-2263.396) [-2261.575] (-2269.206) (-2267.479) * (-2265.341) (-2267.967) (-2278.724) [-2260.576] -- 0:02:56
448500 -- (-2271.824) (-2270.411) (-2273.800) [-2262.430] * [-2260.907] (-2259.951) (-2274.264) (-2269.978) -- 0:02:55
449000 -- (-2266.393) (-2276.804) [-2256.476] (-2268.341) * [-2267.846] (-2266.084) (-2262.210) (-2278.977) -- 0:02:55
449500 -- (-2269.304) [-2275.818] (-2268.968) (-2276.541) * [-2264.270] (-2269.494) (-2263.485) (-2268.538) -- 0:02:55
450000 -- (-2261.312) (-2268.832) (-2263.054) [-2261.630] * (-2258.690) (-2274.733) [-2260.715] (-2265.231) -- 0:02:56
Average standard deviation of split frequencies: 0.007601
450500 -- (-2265.047) [-2266.983] (-2271.641) (-2261.456) * (-2272.986) (-2279.472) [-2264.838] (-2256.168) -- 0:02:55
451000 -- (-2260.767) (-2269.629) (-2268.036) [-2257.043] * (-2264.436) (-2279.717) (-2277.983) [-2258.630] -- 0:02:55
451500 -- [-2263.723] (-2254.649) (-2262.290) (-2278.662) * (-2274.358) [-2266.250] (-2271.302) (-2257.578) -- 0:02:54
452000 -- (-2275.064) [-2260.826] (-2264.665) (-2262.958) * (-2263.881) [-2269.702] (-2263.752) (-2258.746) -- 0:02:54
452500 -- (-2268.229) [-2269.893] (-2267.250) (-2260.796) * (-2273.477) (-2278.564) (-2265.748) [-2264.682] -- 0:02:54
453000 -- (-2270.409) (-2267.663) [-2255.979] (-2265.453) * (-2275.201) (-2275.835) [-2269.266] (-2267.083) -- 0:02:53
453500 -- (-2278.050) (-2274.797) [-2261.266] (-2254.195) * (-2271.640) (-2259.958) (-2270.823) [-2264.415] -- 0:02:53
454000 -- (-2269.473) (-2264.221) [-2264.583] (-2263.499) * (-2280.047) [-2256.722] (-2262.341) (-2270.762) -- 0:02:54
454500 -- (-2271.031) [-2262.463] (-2284.700) (-2261.751) * (-2283.018) (-2259.828) [-2266.975] (-2272.307) -- 0:02:54
455000 -- (-2276.944) (-2262.554) (-2256.256) [-2263.929] * (-2288.033) (-2267.137) [-2259.468] (-2267.802) -- 0:02:53
Average standard deviation of split frequencies: 0.008132
455500 -- (-2255.413) (-2274.636) [-2260.793] (-2269.244) * (-2266.745) [-2268.948] (-2271.499) (-2263.300) -- 0:02:53
456000 -- (-2267.167) [-2271.528] (-2268.078) (-2269.313) * [-2260.150] (-2273.808) (-2272.297) (-2259.420) -- 0:02:52
456500 -- (-2271.790) (-2264.649) (-2267.228) [-2262.230] * (-2267.704) [-2260.923] (-2267.999) (-2273.248) -- 0:02:52
457000 -- (-2265.295) (-2263.140) [-2271.581] (-2268.181) * (-2277.255) (-2265.807) (-2264.894) [-2264.171] -- 0:02:52
457500 -- (-2270.545) (-2272.727) [-2262.591] (-2263.038) * (-2260.538) [-2265.674] (-2270.505) (-2268.181) -- 0:02:53
458000 -- [-2256.384] (-2270.372) (-2266.329) (-2287.513) * (-2273.286) (-2279.196) (-2264.783) [-2257.725] -- 0:02:52
458500 -- (-2275.654) [-2260.908] (-2283.659) (-2276.711) * (-2268.592) [-2264.151] (-2267.064) (-2268.186) -- 0:02:52
459000 -- [-2256.542] (-2266.819) (-2271.677) (-2267.119) * [-2273.757] (-2267.063) (-2263.966) (-2278.651) -- 0:02:52
459500 -- [-2255.887] (-2265.560) (-2258.893) (-2261.080) * [-2267.493] (-2263.189) (-2269.728) (-2278.333) -- 0:02:51
460000 -- (-2261.654) [-2260.384] (-2272.877) (-2269.654) * [-2261.975] (-2268.480) (-2271.482) (-2283.448) -- 0:02:51
Average standard deviation of split frequencies: 0.008118
460500 -- (-2275.918) (-2266.617) [-2257.137] (-2270.062) * (-2284.494) (-2264.296) [-2259.495] (-2278.397) -- 0:02:51
461000 -- [-2253.286] (-2266.075) (-2270.364) (-2262.557) * [-2259.732] (-2266.493) (-2262.489) (-2273.285) -- 0:02:51
461500 -- (-2264.321) [-2258.945] (-2265.822) (-2273.399) * [-2258.405] (-2265.496) (-2266.655) (-2279.696) -- 0:02:51
462000 -- [-2258.092] (-2263.273) (-2279.207) (-2267.187) * [-2266.754] (-2273.047) (-2268.953) (-2285.190) -- 0:02:51
462500 -- (-2278.242) [-2260.575] (-2272.548) (-2265.872) * (-2263.137) (-2276.749) [-2273.177] (-2273.278) -- 0:02:50
463000 -- [-2267.275] (-2277.441) (-2261.651) (-2275.316) * (-2265.020) [-2261.189] (-2271.453) (-2271.413) -- 0:02:50
463500 -- (-2270.305) [-2261.018] (-2270.687) (-2270.177) * (-2262.526) (-2266.613) [-2265.294] (-2262.031) -- 0:02:50
464000 -- (-2280.851) [-2267.912] (-2265.163) (-2267.323) * (-2274.462) (-2266.537) [-2260.654] (-2270.104) -- 0:02:49
464500 -- (-2272.296) [-2267.580] (-2265.737) (-2261.693) * [-2267.063] (-2275.389) (-2270.964) (-2259.712) -- 0:02:50
465000 -- (-2275.538) (-2266.856) (-2267.442) [-2278.126] * (-2259.878) (-2267.019) [-2261.209] (-2264.185) -- 0:02:50
Average standard deviation of split frequencies: 0.008565
465500 -- (-2270.152) (-2268.835) [-2261.006] (-2267.116) * (-2270.467) (-2285.274) (-2260.616) [-2256.403] -- 0:02:49
466000 -- (-2268.019) (-2259.669) [-2268.469] (-2264.077) * (-2276.462) (-2275.781) (-2276.091) [-2258.715] -- 0:02:49
466500 -- (-2261.557) (-2262.516) (-2270.795) [-2256.340] * (-2281.356) (-2271.210) (-2268.915) [-2267.946] -- 0:02:49
467000 -- [-2267.904] (-2262.889) (-2291.883) (-2274.524) * (-2272.066) [-2259.154] (-2262.967) (-2270.516) -- 0:02:48
467500 -- (-2269.612) (-2258.967) [-2270.976] (-2271.945) * (-2268.639) [-2270.378] (-2267.772) (-2262.355) -- 0:02:49
468000 -- (-2255.977) [-2265.517] (-2280.476) (-2271.016) * (-2262.333) [-2261.870] (-2270.279) (-2267.463) -- 0:02:49
468500 -- [-2253.732] (-2271.206) (-2284.764) (-2267.898) * (-2274.474) (-2275.521) (-2275.588) [-2263.053] -- 0:02:49
469000 -- (-2269.025) (-2274.203) (-2262.667) [-2266.599] * (-2268.420) [-2255.502] (-2272.563) (-2270.428) -- 0:02:48
469500 -- (-2261.284) [-2276.724] (-2262.537) (-2271.854) * (-2268.389) (-2261.264) (-2267.170) [-2261.153] -- 0:02:48
470000 -- (-2283.559) (-2275.968) (-2265.777) [-2269.919] * (-2259.189) [-2263.141] (-2266.308) (-2269.525) -- 0:02:49
Average standard deviation of split frequencies: 0.008947
470500 -- (-2265.981) (-2285.315) [-2264.783] (-2274.483) * (-2269.365) (-2262.543) [-2264.445] (-2266.820) -- 0:02:48
471000 -- [-2263.790] (-2279.994) (-2259.614) (-2269.273) * [-2266.215] (-2272.163) (-2272.277) (-2263.421) -- 0:02:48
471500 -- (-2284.261) [-2257.999] (-2279.778) (-2269.504) * (-2263.767) (-2268.647) (-2260.000) [-2265.714] -- 0:02:48
472000 -- (-2272.385) [-2268.844] (-2283.806) (-2263.898) * (-2268.884) (-2263.986) (-2260.720) [-2263.299] -- 0:02:47
472500 -- (-2268.624) [-2270.912] (-2272.562) (-2262.695) * (-2269.877) (-2261.012) (-2268.326) [-2265.042] -- 0:02:47
473000 -- (-2267.880) (-2264.561) (-2271.729) [-2264.024] * (-2273.821) (-2270.161) [-2261.627] (-2274.284) -- 0:02:48
473500 -- (-2258.970) (-2270.585) [-2266.504] (-2270.712) * [-2266.635] (-2268.010) (-2267.062) (-2262.005) -- 0:02:47
474000 -- (-2266.043) (-2275.373) (-2271.238) [-2275.211] * (-2263.797) [-2260.783] (-2263.384) (-2272.003) -- 0:02:47
474500 -- [-2259.411] (-2277.323) (-2263.508) (-2276.260) * [-2261.243] (-2261.674) (-2274.668) (-2266.219) -- 0:02:47
475000 -- (-2265.695) (-2263.492) [-2264.073] (-2270.762) * (-2260.602) (-2266.389) [-2271.498] (-2262.106) -- 0:02:46
Average standard deviation of split frequencies: 0.009507
475500 -- [-2256.987] (-2278.849) (-2269.585) (-2259.455) * (-2257.868) (-2265.374) [-2258.315] (-2278.087) -- 0:02:46
476000 -- (-2267.973) (-2264.117) [-2261.551] (-2274.426) * [-2265.033] (-2271.665) (-2274.618) (-2281.034) -- 0:02:46
476500 -- [-2267.840] (-2273.022) (-2272.980) (-2272.499) * (-2266.134) [-2278.087] (-2271.680) (-2270.011) -- 0:02:46
477000 -- (-2262.175) (-2279.617) (-2279.318) [-2276.087] * (-2265.285) (-2263.225) (-2265.355) [-2266.652] -- 0:02:46
477500 -- (-2268.789) (-2278.065) [-2280.854] (-2269.783) * (-2278.084) (-2270.848) [-2261.525] (-2261.413) -- 0:02:46
478000 -- [-2262.694] (-2263.319) (-2272.922) (-2264.952) * [-2265.977] (-2271.799) (-2258.768) (-2267.386) -- 0:02:45
478500 -- [-2261.346] (-2269.808) (-2264.597) (-2258.027) * (-2264.472) (-2271.609) (-2271.821) [-2256.834] -- 0:02:45
479000 -- [-2266.666] (-2275.986) (-2267.769) (-2278.827) * (-2275.260) (-2267.122) (-2265.515) [-2268.208] -- 0:02:45
479500 -- (-2285.989) (-2272.024) [-2265.116] (-2268.376) * (-2269.183) (-2265.841) [-2267.344] (-2271.383) -- 0:02:44
480000 -- (-2282.541) (-2266.591) (-2270.689) [-2267.441] * (-2272.456) (-2275.729) [-2259.629] (-2277.487) -- 0:02:45
Average standard deviation of split frequencies: 0.009023
480500 -- (-2288.208) [-2274.163] (-2266.780) (-2263.688) * (-2271.015) (-2269.020) [-2266.044] (-2272.370) -- 0:02:45
481000 -- (-2266.190) [-2262.996] (-2264.869) (-2278.460) * (-2265.453) (-2264.588) [-2263.816] (-2263.347) -- 0:02:45
481500 -- (-2277.923) (-2268.538) (-2262.438) [-2275.347] * [-2263.215] (-2258.737) (-2271.285) (-2270.366) -- 0:02:44
482000 -- (-2276.058) (-2264.530) (-2259.038) [-2259.498] * [-2269.557] (-2260.149) (-2262.775) (-2266.735) -- 0:02:44
482500 -- (-2260.567) (-2266.784) [-2260.872] (-2276.525) * [-2261.510] (-2261.001) (-2278.538) (-2265.688) -- 0:02:44
483000 -- (-2265.396) [-2268.946] (-2278.209) (-2262.597) * (-2265.584) [-2262.644] (-2268.672) (-2262.460) -- 0:02:43
483500 -- (-2270.190) [-2267.984] (-2272.156) (-2281.858) * (-2277.767) (-2280.229) (-2267.561) [-2263.444] -- 0:02:44
484000 -- (-2267.996) (-2274.937) (-2262.720) [-2260.288] * (-2258.185) (-2277.856) (-2281.570) [-2268.367] -- 0:02:44
484500 -- (-2264.783) (-2259.473) (-2274.203) [-2257.588] * (-2266.548) (-2278.515) (-2263.730) [-2264.969] -- 0:02:43
485000 -- (-2275.426) (-2262.008) [-2262.996] (-2263.718) * (-2258.641) (-2269.624) [-2264.232] (-2274.400) -- 0:02:43
Average standard deviation of split frequencies: 0.008859
485500 -- [-2261.361] (-2266.890) (-2269.404) (-2267.515) * (-2296.110) [-2271.116] (-2267.314) (-2264.474) -- 0:02:43
486000 -- [-2265.845] (-2275.127) (-2271.279) (-2260.504) * (-2269.120) [-2263.285] (-2264.795) (-2261.825) -- 0:02:42
486500 -- (-2279.611) (-2276.871) (-2264.250) [-2265.175] * (-2264.757) (-2272.764) [-2252.747] (-2268.441) -- 0:02:42
487000 -- (-2264.591) [-2268.412] (-2267.637) (-2270.606) * (-2262.680) (-2275.098) [-2263.522] (-2272.612) -- 0:02:43
487500 -- (-2268.000) (-2261.466) [-2259.634] (-2277.256) * (-2269.039) (-2284.507) (-2268.610) [-2270.717] -- 0:02:42
488000 -- (-2267.687) [-2264.315] (-2272.128) (-2268.539) * [-2264.367] (-2270.223) (-2291.141) (-2280.610) -- 0:02:42
488500 -- (-2267.541) (-2261.649) (-2265.362) [-2263.981] * [-2269.675] (-2273.260) (-2271.440) (-2262.499) -- 0:02:42
489000 -- (-2263.988) (-2272.361) [-2258.343] (-2277.778) * (-2266.494) (-2272.717) (-2267.734) [-2264.235] -- 0:02:41
489500 -- (-2272.114) (-2265.221) (-2265.450) [-2264.340] * (-2270.176) (-2272.000) (-2282.688) [-2258.316] -- 0:02:41
490000 -- [-2268.414] (-2271.070) (-2263.398) (-2278.737) * (-2275.771) (-2272.576) [-2257.223] (-2269.987) -- 0:02:41
Average standard deviation of split frequencies: 0.007622
490500 -- (-2266.334) [-2258.219] (-2267.458) (-2270.775) * [-2255.858] (-2260.978) (-2264.916) (-2281.620) -- 0:02:42
491000 -- (-2262.728) [-2272.668] (-2266.863) (-2269.049) * (-2265.662) (-2277.079) [-2266.044] (-2279.364) -- 0:02:41
491500 -- (-2272.054) [-2274.112] (-2270.097) (-2271.643) * (-2269.725) [-2263.303] (-2263.503) (-2265.089) -- 0:02:41
492000 -- [-2266.452] (-2268.172) (-2271.002) (-2278.780) * (-2268.762) (-2268.757) (-2260.758) [-2261.183] -- 0:02:41
492500 -- (-2265.569) [-2261.855] (-2262.276) (-2275.970) * (-2274.435) (-2280.097) [-2264.715] (-2277.735) -- 0:02:40
493000 -- [-2269.307] (-2263.127) (-2259.674) (-2268.803) * (-2266.571) (-2275.731) [-2272.061] (-2264.136) -- 0:02:40
493500 -- (-2262.793) (-2269.412) [-2261.300] (-2286.820) * [-2272.492] (-2280.139) (-2282.183) (-2279.585) -- 0:02:41
494000 -- (-2262.500) (-2268.738) [-2267.350] (-2284.088) * (-2286.654) [-2264.598] (-2268.747) (-2272.716) -- 0:02:40
494500 -- [-2264.283] (-2270.086) (-2262.113) (-2274.926) * (-2282.525) [-2265.049] (-2265.084) (-2268.189) -- 0:02:40
495000 -- (-2273.451) (-2259.680) (-2275.171) [-2265.270] * (-2279.703) (-2267.785) (-2260.589) [-2282.902] -- 0:02:40
Average standard deviation of split frequencies: 0.007413
495500 -- (-2263.563) (-2268.596) (-2268.062) [-2274.422] * (-2277.338) (-2261.431) (-2271.594) [-2277.926] -- 0:02:39
496000 -- (-2266.927) [-2259.645] (-2275.702) (-2267.118) * (-2267.018) [-2256.243] (-2272.752) (-2273.720) -- 0:02:39
496500 -- (-2265.958) [-2265.149] (-2272.231) (-2263.588) * (-2275.290) (-2270.502) [-2261.532] (-2263.162) -- 0:02:39
497000 -- (-2256.463) [-2262.474] (-2271.432) (-2267.638) * (-2272.696) [-2275.075] (-2265.687) (-2266.733) -- 0:02:39
497500 -- (-2263.444) (-2265.573) [-2265.115] (-2258.286) * (-2280.341) (-2280.763) [-2259.781] (-2264.706) -- 0:02:39
498000 -- (-2268.079) [-2266.222] (-2267.492) (-2266.717) * (-2277.557) (-2274.573) [-2267.174] (-2269.369) -- 0:02:39
498500 -- (-2262.886) [-2266.213] (-2266.840) (-2265.363) * (-2272.740) (-2256.431) (-2267.498) [-2261.833] -- 0:02:38
499000 -- (-2269.026) [-2257.438] (-2277.262) (-2265.133) * (-2279.272) [-2263.173] (-2273.907) (-2258.803) -- 0:02:38
499500 -- (-2258.088) (-2271.592) [-2265.385] (-2268.617) * (-2281.381) (-2269.259) [-2269.296] (-2269.703) -- 0:02:38
500000 -- [-2261.981] (-2271.327) (-2271.408) (-2270.743) * (-2288.487) (-2263.765) [-2268.487] (-2269.003) -- 0:02:38
Average standard deviation of split frequencies: 0.007219
500500 -- (-2281.790) (-2282.874) (-2273.425) [-2264.332] * (-2266.338) [-2266.400] (-2258.097) (-2267.618) -- 0:02:38
501000 -- (-2276.739) (-2270.530) (-2265.206) [-2264.987] * (-2262.303) [-2264.873] (-2268.237) (-2268.038) -- 0:02:38
501500 -- (-2269.471) (-2269.882) (-2275.136) [-2266.987] * [-2266.279] (-2268.777) (-2263.103) (-2262.940) -- 0:02:38
502000 -- (-2263.717) (-2265.358) (-2272.492) [-2264.381] * (-2270.394) (-2270.413) [-2261.826] (-2274.766) -- 0:02:37
502500 -- (-2265.753) (-2279.394) [-2268.640] (-2268.695) * (-2262.514) (-2271.073) [-2256.608] (-2274.208) -- 0:02:37
503000 -- [-2267.304] (-2277.109) (-2260.798) (-2264.115) * (-2274.595) (-2270.786) [-2259.637] (-2271.553) -- 0:02:37
503500 -- (-2275.887) (-2270.089) [-2262.526] (-2260.538) * [-2266.464] (-2273.274) (-2263.103) (-2261.223) -- 0:02:36
504000 -- (-2278.032) (-2270.716) (-2271.371) [-2267.358] * [-2259.453] (-2268.044) (-2283.795) (-2267.500) -- 0:02:37
504500 -- (-2270.784) [-2263.980] (-2269.941) (-2280.707) * [-2264.068] (-2262.032) (-2265.783) (-2271.653) -- 0:02:37
505000 -- (-2269.314) [-2262.263] (-2268.860) (-2285.100) * (-2262.688) [-2263.028] (-2273.897) (-2275.132) -- 0:02:36
Average standard deviation of split frequencies: 0.007515
505500 -- (-2270.232) (-2263.729) (-2268.465) [-2263.885] * (-2278.236) [-2266.853] (-2280.172) (-2259.761) -- 0:02:36
506000 -- (-2271.334) (-2268.403) (-2263.469) [-2269.530] * [-2263.359] (-2274.784) (-2267.126) (-2270.508) -- 0:02:36
506500 -- (-2264.822) [-2258.716] (-2271.996) (-2261.659) * (-2262.826) [-2258.773] (-2278.779) (-2268.734) -- 0:02:35
507000 -- (-2264.228) (-2264.810) (-2261.418) [-2259.915] * [-2265.567] (-2267.033) (-2265.084) (-2277.988) -- 0:02:35
507500 -- (-2264.065) (-2263.682) [-2260.021] (-2274.818) * [-2270.200] (-2262.137) (-2272.964) (-2269.900) -- 0:02:36
508000 -- [-2263.237] (-2269.152) (-2267.823) (-2262.536) * (-2265.145) (-2277.060) [-2272.749] (-2274.659) -- 0:02:35
508500 -- (-2269.581) [-2256.777] (-2275.608) (-2260.869) * (-2259.822) [-2256.249] (-2272.586) (-2272.348) -- 0:02:35
509000 -- (-2278.257) (-2274.109) [-2259.177] (-2267.345) * (-2267.393) [-2259.701] (-2259.331) (-2268.738) -- 0:02:35
509500 -- (-2281.791) [-2262.933] (-2274.969) (-2263.193) * (-2275.435) [-2259.773] (-2257.769) (-2263.609) -- 0:02:34
510000 -- [-2267.505] (-2276.897) (-2279.364) (-2264.154) * (-2271.325) (-2270.747) (-2267.999) [-2264.866] -- 0:02:34
Average standard deviation of split frequencies: 0.007385
510500 -- (-2270.438) [-2261.415] (-2278.325) (-2263.615) * (-2276.927) (-2264.263) (-2273.634) [-2262.431] -- 0:02:35
511000 -- (-2269.668) (-2270.907) [-2263.798] (-2261.212) * (-2289.482) (-2262.894) [-2257.001] (-2262.575) -- 0:02:35
511500 -- (-2266.781) (-2278.719) [-2256.883] (-2266.664) * [-2263.028] (-2270.027) (-2264.363) (-2268.776) -- 0:02:34
512000 -- (-2266.038) (-2264.794) (-2264.484) [-2261.928] * [-2265.494] (-2268.124) (-2265.066) (-2264.711) -- 0:02:34
512500 -- (-2271.371) [-2265.171] (-2277.189) (-2261.850) * [-2258.411] (-2276.307) (-2272.311) (-2282.615) -- 0:02:34
513000 -- (-2293.244) (-2264.021) [-2276.495] (-2267.910) * (-2276.457) (-2258.227) [-2271.146] (-2275.976) -- 0:02:34
513500 -- (-2274.499) (-2263.617) [-2267.752] (-2265.274) * (-2275.813) [-2270.075] (-2273.634) (-2257.667) -- 0:02:34
514000 -- (-2277.300) (-2273.809) [-2268.370] (-2264.020) * [-2279.274] (-2263.215) (-2277.242) (-2273.407) -- 0:02:34
514500 -- [-2264.963] (-2270.453) (-2268.369) (-2260.714) * (-2274.157) (-2269.508) [-2272.373] (-2269.705) -- 0:02:33
515000 -- (-2263.024) (-2269.754) [-2257.591] (-2266.624) * (-2266.623) [-2260.363] (-2264.346) (-2269.246) -- 0:02:33
Average standard deviation of split frequencies: 0.007065
515500 -- (-2275.378) (-2273.579) [-2273.540] (-2264.823) * (-2263.486) [-2256.620] (-2267.490) (-2275.508) -- 0:02:33
516000 -- (-2265.083) (-2270.625) [-2263.156] (-2265.916) * (-2271.417) [-2257.930] (-2272.416) (-2269.722) -- 0:02:32
516500 -- (-2270.914) (-2257.871) (-2280.033) [-2259.049] * (-2283.960) (-2278.003) (-2267.868) [-2265.296] -- 0:02:33
517000 -- (-2271.312) (-2268.259) (-2268.667) [-2263.319] * [-2259.195] (-2263.211) (-2263.941) (-2268.947) -- 0:02:33
517500 -- (-2274.047) (-2268.268) (-2266.073) [-2264.738] * (-2264.584) (-2266.894) [-2261.276] (-2268.390) -- 0:02:32
518000 -- (-2268.828) [-2261.806] (-2269.404) (-2282.823) * (-2274.129) (-2277.069) [-2258.224] (-2263.095) -- 0:02:32
518500 -- (-2277.784) (-2262.078) (-2268.101) [-2267.730] * [-2267.136] (-2263.806) (-2265.650) (-2261.493) -- 0:02:32
519000 -- (-2272.284) [-2264.419] (-2265.639) (-2274.255) * (-2271.405) (-2275.463) [-2260.658] (-2267.575) -- 0:02:31
519500 -- (-2266.704) (-2266.540) (-2264.867) [-2265.592] * (-2266.144) (-2267.282) [-2261.294] (-2277.073) -- 0:02:31
520000 -- (-2269.814) (-2271.545) (-2269.567) [-2262.028] * (-2257.319) [-2265.124] (-2266.055) (-2275.061) -- 0:02:32
Average standard deviation of split frequencies: 0.007183
520500 -- (-2270.261) (-2279.228) [-2266.298] (-2271.118) * (-2267.047) [-2265.764] (-2280.243) (-2265.031) -- 0:02:32
521000 -- (-2259.176) (-2268.084) (-2270.487) [-2272.368] * [-2265.269] (-2256.272) (-2265.297) (-2270.650) -- 0:02:31
521500 -- (-2282.305) (-2260.203) [-2254.007] (-2274.872) * [-2264.635] (-2257.205) (-2275.872) (-2267.050) -- 0:02:31
522000 -- (-2267.357) (-2263.469) [-2263.259] (-2273.857) * (-2272.829) (-2262.429) [-2258.707] (-2271.710) -- 0:02:31
522500 -- (-2266.780) (-2261.098) (-2265.187) [-2273.074] * (-2273.509) [-2256.155] (-2267.754) (-2265.669) -- 0:02:30
523000 -- [-2261.371] (-2270.304) (-2264.608) (-2268.939) * (-2265.175) [-2261.252] (-2275.838) (-2260.615) -- 0:02:30
523500 -- (-2273.861) [-2260.127] (-2265.380) (-2276.774) * (-2273.014) (-2278.589) [-2263.980] (-2271.563) -- 0:02:30
524000 -- (-2268.901) [-2265.619] (-2285.450) (-2270.644) * (-2274.618) (-2279.913) [-2269.341] (-2271.067) -- 0:02:30
524500 -- (-2258.442) (-2279.614) (-2261.510) [-2261.602] * [-2268.076] (-2271.415) (-2276.102) (-2262.964) -- 0:02:30
525000 -- (-2265.589) (-2262.435) (-2264.800) [-2270.142] * (-2278.146) (-2265.953) (-2273.573) [-2256.467] -- 0:02:30
Average standard deviation of split frequencies: 0.007528
525500 -- [-2266.541] (-2273.410) (-2280.044) (-2263.852) * (-2271.928) (-2266.489) [-2262.305] (-2265.177) -- 0:02:29
526000 -- [-2258.791] (-2277.215) (-2273.098) (-2259.677) * [-2264.733] (-2263.165) (-2260.337) (-2272.620) -- 0:02:29
526500 -- (-2268.559) [-2266.652] (-2270.859) (-2275.874) * (-2276.469) (-2266.586) (-2265.406) [-2270.981] -- 0:02:29
527000 -- [-2270.748] (-2268.189) (-2278.053) (-2259.375) * [-2261.636] (-2263.645) (-2256.618) (-2268.210) -- 0:02:28
527500 -- (-2264.324) (-2263.434) [-2261.225] (-2279.390) * (-2265.881) (-2267.788) (-2267.056) [-2265.994] -- 0:02:29
528000 -- (-2281.890) [-2263.087] (-2271.792) (-2279.943) * (-2265.235) (-2261.582) [-2266.728] (-2265.790) -- 0:02:29
528500 -- (-2268.839) (-2293.437) [-2262.029] (-2268.721) * (-2271.521) (-2263.616) [-2271.648] (-2266.934) -- 0:02:28
529000 -- (-2262.095) [-2269.393] (-2262.331) (-2270.229) * (-2267.694) [-2256.945] (-2259.400) (-2263.472) -- 0:02:28
529500 -- [-2257.419] (-2266.626) (-2273.492) (-2267.739) * (-2280.712) [-2255.302] (-2251.410) (-2269.137) -- 0:02:28
530000 -- [-2254.470] (-2271.923) (-2287.026) (-2269.547) * (-2272.328) (-2275.559) (-2268.398) [-2260.162] -- 0:02:28
Average standard deviation of split frequencies: 0.008054
530500 -- (-2265.248) (-2266.805) (-2273.180) [-2260.321] * (-2264.799) (-2272.162) [-2271.702] (-2262.956) -- 0:02:28
531000 -- [-2265.151] (-2268.726) (-2266.225) (-2269.534) * (-2264.525) (-2276.525) [-2268.529] (-2259.896) -- 0:02:28
531500 -- (-2291.942) [-2263.417] (-2269.923) (-2273.490) * (-2265.649) [-2266.885] (-2281.399) (-2261.817) -- 0:02:28
532000 -- (-2270.755) (-2269.555) [-2266.764] (-2270.016) * [-2265.827] (-2295.467) (-2268.772) (-2258.771) -- 0:02:27
532500 -- [-2268.211] (-2275.764) (-2273.601) (-2260.243) * [-2264.114] (-2265.725) (-2275.421) (-2265.089) -- 0:02:27
533000 -- [-2267.098] (-2264.666) (-2264.160) (-2259.463) * (-2259.307) (-2272.344) (-2276.804) [-2275.573] -- 0:02:27
533500 -- (-2274.302) [-2263.638] (-2277.985) (-2269.384) * [-2259.741] (-2277.394) (-2260.495) (-2268.099) -- 0:02:27
534000 -- (-2272.234) (-2268.905) (-2273.804) [-2266.070] * (-2264.488) (-2269.842) (-2273.145) [-2267.719] -- 0:02:27
534500 -- (-2264.818) (-2265.818) (-2267.273) [-2259.120] * (-2269.468) (-2262.669) [-2271.050] (-2262.258) -- 0:02:27
535000 -- (-2263.185) (-2273.876) [-2262.128] (-2260.940) * (-2271.617) (-2267.863) [-2267.211] (-2260.674) -- 0:02:26
Average standard deviation of split frequencies: 0.007857
535500 -- [-2269.188] (-2272.608) (-2260.589) (-2269.754) * (-2263.434) (-2261.108) (-2286.699) [-2262.744] -- 0:02:26
536000 -- (-2262.219) (-2274.473) [-2262.553] (-2280.460) * (-2262.165) [-2261.904] (-2275.361) (-2260.760) -- 0:02:26
536500 -- [-2263.673] (-2264.249) (-2274.619) (-2283.703) * (-2271.943) (-2267.950) [-2268.239] (-2267.970) -- 0:02:26
537000 -- (-2263.454) [-2271.749] (-2262.053) (-2274.432) * (-2262.536) [-2261.287] (-2270.889) (-2268.043) -- 0:02:26
537500 -- (-2267.014) (-2267.153) [-2262.605] (-2271.848) * (-2282.860) [-2264.784] (-2279.633) (-2267.998) -- 0:02:26
538000 -- (-2262.341) (-2269.087) (-2269.341) [-2274.725] * (-2264.297) (-2279.074) [-2260.556] (-2272.553) -- 0:02:25
538500 -- [-2273.354] (-2276.618) (-2273.654) (-2269.161) * (-2265.490) [-2267.433] (-2262.282) (-2290.493) -- 0:02:25
539000 -- (-2263.431) (-2275.341) [-2262.601] (-2280.259) * (-2279.080) (-2262.869) (-2266.150) [-2270.657] -- 0:02:25
539500 -- (-2273.118) (-2271.828) (-2280.577) [-2272.121] * (-2270.359) (-2261.315) [-2267.162] (-2260.688) -- 0:02:25
540000 -- (-2266.204) [-2281.657] (-2270.502) (-2263.160) * [-2260.541] (-2281.729) (-2258.991) (-2255.193) -- 0:02:24
Average standard deviation of split frequencies: 0.007731
540500 -- [-2268.292] (-2264.085) (-2277.164) (-2261.888) * [-2274.821] (-2260.884) (-2270.468) (-2273.498) -- 0:02:25
541000 -- [-2264.459] (-2268.138) (-2270.475) (-2264.072) * (-2268.577) (-2265.205) [-2259.482] (-2268.226) -- 0:02:25
541500 -- (-2268.984) [-2266.061] (-2286.499) (-2266.117) * (-2265.013) (-2263.244) [-2266.168] (-2267.878) -- 0:02:24
542000 -- [-2266.832] (-2277.057) (-2282.713) (-2261.696) * (-2278.462) (-2272.184) [-2265.410] (-2265.499) -- 0:02:24
542500 -- (-2271.965) (-2270.907) (-2278.770) [-2260.351] * (-2271.238) (-2275.915) (-2265.552) [-2269.872] -- 0:02:24
543000 -- (-2262.723) (-2278.506) (-2278.258) [-2267.840] * (-2267.533) (-2279.381) [-2266.903] (-2261.670) -- 0:02:24
543500 -- (-2272.180) (-2267.421) (-2283.912) [-2266.767] * [-2264.531] (-2264.938) (-2273.294) (-2264.263) -- 0:02:24
544000 -- (-2275.173) [-2261.460] (-2271.135) (-2264.139) * [-2257.433] (-2266.645) (-2271.173) (-2278.136) -- 0:02:24
544500 -- (-2260.357) (-2254.774) [-2261.640] (-2261.863) * (-2274.502) (-2268.345) [-2273.806] (-2273.007) -- 0:02:23
545000 -- (-2275.683) (-2273.033) (-2266.716) [-2254.864] * (-2277.348) (-2272.162) (-2270.997) [-2269.263] -- 0:02:23
Average standard deviation of split frequencies: 0.007713
545500 -- [-2260.269] (-2264.416) (-2265.092) (-2286.573) * (-2270.394) [-2266.702] (-2262.634) (-2273.170) -- 0:02:23
546000 -- (-2270.271) (-2276.216) [-2268.354] (-2266.693) * (-2263.976) [-2259.114] (-2270.167) (-2270.804) -- 0:02:23
546500 -- [-2261.006] (-2271.462) (-2271.381) (-2278.329) * (-2268.476) (-2266.777) [-2267.536] (-2274.872) -- 0:02:23
547000 -- (-2275.369) (-2270.110) (-2261.146) [-2264.078] * (-2269.496) [-2272.387] (-2263.287) (-2284.356) -- 0:02:23
547500 -- (-2270.775) (-2273.245) (-2265.210) [-2256.920] * (-2268.529) [-2264.212] (-2271.242) (-2274.749) -- 0:02:22
548000 -- (-2272.563) (-2273.772) (-2263.076) [-2264.477] * (-2269.695) (-2262.086) [-2266.228] (-2274.733) -- 0:02:22
548500 -- (-2277.332) (-2278.286) [-2259.814] (-2274.080) * (-2275.653) (-2258.143) [-2259.218] (-2270.511) -- 0:02:22
549000 -- [-2260.033] (-2285.881) (-2272.519) (-2275.871) * (-2269.449) [-2263.720] (-2281.513) (-2274.879) -- 0:02:22
549500 -- [-2267.466] (-2285.245) (-2264.133) (-2272.996) * (-2259.030) (-2271.265) (-2273.589) [-2268.654] -- 0:02:22
550000 -- (-2261.778) (-2269.018) [-2274.210] (-2260.910) * (-2261.079) (-2270.383) [-2264.249] (-2274.475) -- 0:02:22
Average standard deviation of split frequencies: 0.008275
550500 -- [-2263.859] (-2259.954) (-2277.406) (-2269.947) * (-2272.434) (-2262.446) [-2264.900] (-2280.268) -- 0:02:22
551000 -- (-2265.698) [-2265.963] (-2273.527) (-2266.319) * (-2272.412) (-2269.074) [-2263.262] (-2276.610) -- 0:02:21
551500 -- (-2274.490) (-2264.179) (-2278.184) [-2267.447] * (-2258.645) (-2281.109) (-2258.499) [-2264.623] -- 0:02:21
552000 -- [-2257.217] (-2271.326) (-2271.613) (-2262.185) * (-2273.630) (-2266.808) [-2261.112] (-2260.539) -- 0:02:22
552500 -- (-2273.735) (-2259.618) [-2260.588] (-2269.427) * (-2270.560) (-2267.731) [-2263.575] (-2267.726) -- 0:02:21
553000 -- (-2263.513) (-2268.706) [-2263.014] (-2263.866) * [-2256.351] (-2275.541) (-2261.609) (-2266.091) -- 0:02:21
553500 -- (-2262.619) (-2264.504) [-2268.176] (-2263.763) * (-2263.622) [-2261.527] (-2272.499) (-2265.476) -- 0:02:21
554000 -- (-2271.869) [-2263.329] (-2261.331) (-2281.528) * (-2262.049) (-2280.058) [-2268.351] (-2273.395) -- 0:02:20
554500 -- [-2262.595] (-2267.709) (-2280.259) (-2273.042) * (-2261.091) (-2271.827) (-2265.579) [-2265.546] -- 0:02:20
555000 -- (-2273.914) [-2261.661] (-2268.371) (-2269.040) * (-2271.326) (-2272.272) (-2263.680) [-2266.141] -- 0:02:20
Average standard deviation of split frequencies: 0.008987
555500 -- [-2267.731] (-2263.561) (-2275.137) (-2272.272) * (-2261.647) (-2276.568) (-2257.611) [-2260.236] -- 0:02:20
556000 -- (-2265.226) (-2259.755) [-2262.576] (-2266.936) * (-2267.387) (-2270.480) [-2261.636] (-2269.731) -- 0:02:20
556500 -- [-2256.344] (-2270.013) (-2259.504) (-2277.561) * (-2262.878) (-2278.087) (-2269.571) [-2262.169] -- 0:02:20
557000 -- (-2261.812) (-2261.723) (-2274.858) [-2259.423] * (-2254.383) [-2260.933] (-2265.494) (-2267.595) -- 0:02:19
557500 -- (-2264.127) (-2282.030) (-2263.518) [-2265.912] * (-2266.513) [-2267.577] (-2278.604) (-2261.147) -- 0:02:19
558000 -- (-2266.395) (-2274.143) [-2268.197] (-2263.134) * [-2264.426] (-2263.162) (-2275.604) (-2269.057) -- 0:02:19
558500 -- [-2259.994] (-2276.182) (-2263.693) (-2264.301) * (-2262.526) [-2272.144] (-2267.250) (-2275.654) -- 0:02:19
559000 -- [-2272.612] (-2285.704) (-2267.027) (-2268.841) * [-2263.240] (-2268.457) (-2264.928) (-2267.502) -- 0:02:19
559500 -- [-2256.458] (-2277.604) (-2265.857) (-2265.572) * (-2261.733) [-2271.436] (-2268.206) (-2295.040) -- 0:02:19
560000 -- [-2261.644] (-2273.340) (-2253.870) (-2264.558) * [-2272.800] (-2257.859) (-2267.098) (-2264.945) -- 0:02:19
Average standard deviation of split frequencies: 0.008744
560500 -- (-2273.467) [-2264.779] (-2266.390) (-2261.786) * (-2263.292) (-2268.105) [-2272.139] (-2271.647) -- 0:02:18
561000 -- [-2259.688] (-2270.052) (-2262.688) (-2258.888) * [-2258.381] (-2263.468) (-2276.630) (-2264.782) -- 0:02:18
561500 -- [-2261.203] (-2279.922) (-2265.817) (-2274.000) * (-2262.726) (-2266.196) (-2267.239) [-2264.911] -- 0:02:18
562000 -- [-2258.657] (-2283.778) (-2265.331) (-2280.520) * [-2266.527] (-2268.115) (-2270.384) (-2262.353) -- 0:02:17
562500 -- [-2262.364] (-2272.464) (-2263.134) (-2273.009) * (-2260.059) (-2255.176) (-2270.502) [-2262.002] -- 0:02:18
563000 -- [-2269.886] (-2290.496) (-2269.753) (-2265.050) * (-2265.576) (-2282.655) (-2260.180) [-2256.492] -- 0:02:18
563500 -- (-2272.744) [-2267.205] (-2273.432) (-2263.329) * (-2266.125) [-2259.682] (-2276.872) (-2264.540) -- 0:02:17
564000 -- (-2272.231) (-2266.309) (-2259.692) [-2261.303] * (-2269.738) [-2263.981] (-2258.150) (-2266.859) -- 0:02:17
564500 -- (-2271.613) (-2260.305) [-2266.256] (-2263.905) * [-2265.314] (-2266.011) (-2264.058) (-2264.528) -- 0:02:17
565000 -- (-2265.685) [-2263.621] (-2260.074) (-2274.500) * [-2263.310] (-2262.222) (-2268.761) (-2260.340) -- 0:02:17
Average standard deviation of split frequencies: 0.008495
565500 -- (-2263.123) (-2263.730) [-2264.723] (-2265.031) * (-2261.707) (-2264.945) [-2262.109] (-2271.852) -- 0:02:16
566000 -- [-2261.058] (-2271.998) (-2263.726) (-2264.807) * (-2269.683) (-2263.951) (-2272.609) [-2263.655] -- 0:02:17
566500 -- (-2268.579) (-2272.208) [-2264.516] (-2271.842) * [-2259.912] (-2265.912) (-2263.536) (-2260.389) -- 0:02:16
567000 -- (-2274.771) (-2279.366) (-2256.830) [-2260.744] * (-2271.862) (-2288.421) (-2265.648) [-2265.584] -- 0:02:16
567500 -- (-2268.205) (-2271.363) (-2259.418) [-2276.421] * (-2275.098) (-2261.587) (-2265.162) [-2269.137] -- 0:02:16
568000 -- (-2266.390) (-2275.525) [-2260.551] (-2280.186) * (-2273.483) [-2258.405] (-2263.306) (-2268.287) -- 0:02:16
568500 -- (-2271.097) [-2268.003] (-2279.746) (-2260.957) * [-2272.187] (-2273.888) (-2257.347) (-2267.709) -- 0:02:15
569000 -- (-2264.806) [-2257.916] (-2267.035) (-2266.982) * (-2275.356) [-2268.726] (-2263.507) (-2267.391) -- 0:02:15
569500 -- (-2273.176) (-2273.926) (-2273.885) [-2262.715] * (-2274.511) (-2267.521) (-2271.506) [-2256.912] -- 0:02:15
570000 -- (-2271.102) (-2273.367) (-2262.121) [-2262.451] * [-2263.692] (-2270.919) (-2270.201) (-2258.698) -- 0:02:15
Average standard deviation of split frequencies: 0.008646
570500 -- (-2274.816) [-2267.256] (-2266.486) (-2262.552) * (-2282.786) [-2260.080] (-2261.503) (-2267.172) -- 0:02:15
571000 -- (-2271.726) (-2281.724) (-2263.036) [-2264.173] * (-2282.048) [-2265.662] (-2278.221) (-2266.107) -- 0:02:15
571500 -- [-2266.682] (-2272.589) (-2262.836) (-2261.951) * (-2266.730) (-2261.003) [-2263.626] (-2264.694) -- 0:02:14
572000 -- [-2267.395] (-2258.986) (-2270.297) (-2258.164) * [-2265.244] (-2263.037) (-2277.756) (-2265.823) -- 0:02:14
572500 -- [-2269.254] (-2259.800) (-2271.697) (-2282.026) * (-2261.542) (-2275.297) (-2260.531) [-2276.819] -- 0:02:14
573000 -- (-2265.066) (-2275.598) [-2255.388] (-2270.896) * (-2275.226) [-2260.966] (-2270.342) (-2263.362) -- 0:02:14
573500 -- (-2269.752) [-2269.956] (-2262.248) (-2260.475) * (-2275.960) (-2268.575) [-2270.871] (-2258.391) -- 0:02:14
574000 -- (-2263.913) [-2274.537] (-2272.348) (-2261.929) * (-2262.655) [-2270.123] (-2263.344) (-2269.054) -- 0:02:14
574500 -- (-2267.798) (-2260.422) [-2261.451] (-2271.969) * (-2285.969) (-2269.264) [-2276.514] (-2278.618) -- 0:02:14
575000 -- [-2268.688] (-2266.186) (-2267.454) (-2275.145) * [-2263.918] (-2272.069) (-2265.326) (-2255.981) -- 0:02:13
Average standard deviation of split frequencies: 0.008839
575500 -- [-2266.859] (-2274.411) (-2274.673) (-2268.890) * [-2262.376] (-2266.741) (-2271.863) (-2262.623) -- 0:02:13
576000 -- [-2260.905] (-2264.889) (-2271.411) (-2281.116) * (-2267.330) (-2280.883) [-2275.207] (-2268.164) -- 0:02:13
576500 -- [-2260.777] (-2263.727) (-2266.313) (-2277.416) * (-2269.616) [-2262.948] (-2261.916) (-2270.302) -- 0:02:12
577000 -- (-2263.379) (-2267.449) (-2264.034) [-2269.779] * (-2258.336) [-2259.794] (-2265.017) (-2271.931) -- 0:02:13
577500 -- [-2255.706] (-2262.761) (-2270.557) (-2268.241) * (-2273.359) (-2259.853) [-2263.300] (-2272.014) -- 0:02:13
578000 -- (-2274.095) (-2266.720) [-2262.468] (-2262.448) * (-2275.338) (-2273.158) [-2268.063] (-2264.481) -- 0:02:12
578500 -- [-2258.244] (-2272.471) (-2270.363) (-2275.140) * (-2276.209) (-2262.709) (-2260.041) [-2268.941] -- 0:02:12
579000 -- (-2271.797) (-2261.790) [-2262.282] (-2264.433) * [-2261.858] (-2268.370) (-2259.740) (-2271.680) -- 0:02:12
579500 -- (-2272.610) (-2266.032) (-2269.300) [-2266.391] * [-2260.343] (-2268.867) (-2277.534) (-2271.859) -- 0:02:12
580000 -- (-2268.966) (-2280.355) (-2262.409) [-2270.878] * (-2262.658) (-2262.277) (-2273.354) [-2264.958] -- 0:02:12
Average standard deviation of split frequencies: 0.008605
580500 -- (-2267.438) (-2264.507) [-2252.791] (-2264.806) * (-2276.556) (-2278.788) [-2265.258] (-2272.885) -- 0:02:12
581000 -- (-2270.998) (-2270.677) [-2260.119] (-2266.174) * (-2268.957) [-2263.221] (-2265.533) (-2279.161) -- 0:02:11
581500 -- [-2259.575] (-2283.983) (-2270.632) (-2263.942) * [-2266.873] (-2288.718) (-2267.299) (-2270.643) -- 0:02:11
582000 -- [-2260.916] (-2270.835) (-2265.770) (-2271.246) * (-2281.453) [-2265.568] (-2262.510) (-2261.734) -- 0:02:12
582500 -- (-2266.552) [-2262.950] (-2271.108) (-2271.111) * [-2269.235] (-2279.592) (-2271.473) (-2260.707) -- 0:02:11
583000 -- [-2269.034] (-2272.839) (-2263.387) (-2274.714) * (-2262.473) [-2266.070] (-2266.060) (-2257.279) -- 0:02:11
583500 -- [-2272.213] (-2266.454) (-2268.917) (-2272.856) * (-2261.102) (-2284.436) (-2262.174) [-2263.603] -- 0:02:11
584000 -- [-2282.108] (-2273.087) (-2266.383) (-2278.645) * (-2266.199) (-2260.500) [-2265.279] (-2279.177) -- 0:02:11
584500 -- (-2265.918) (-2269.102) [-2254.588] (-2278.631) * (-2275.082) [-2268.531] (-2262.561) (-2282.922) -- 0:02:11
585000 -- (-2263.689) [-2263.937] (-2268.110) (-2278.070) * (-2264.166) [-2268.524] (-2269.995) (-2264.742) -- 0:02:11
Average standard deviation of split frequencies: 0.008473
585500 -- (-2264.154) (-2275.551) [-2270.679] (-2259.199) * (-2263.439) (-2258.622) [-2274.074] (-2271.774) -- 0:02:10
586000 -- (-2262.759) (-2263.879) [-2265.244] (-2284.167) * [-2268.723] (-2267.968) (-2269.102) (-2268.292) -- 0:02:10
586500 -- (-2265.087) (-2283.830) [-2270.087] (-2266.716) * (-2265.685) (-2267.775) (-2282.001) [-2276.648] -- 0:02:10
587000 -- (-2268.785) (-2258.875) [-2269.776] (-2263.389) * (-2270.761) (-2260.570) (-2273.108) [-2269.691] -- 0:02:10
587500 -- [-2264.910] (-2268.135) (-2280.345) (-2268.168) * [-2271.007] (-2271.905) (-2265.144) (-2268.606) -- 0:02:09
588000 -- (-2268.479) (-2275.943) (-2279.798) [-2266.258] * (-2263.980) (-2269.287) (-2275.143) [-2260.756] -- 0:02:10
588500 -- (-2282.331) [-2261.919] (-2265.612) (-2284.809) * [-2257.443] (-2271.724) (-2271.579) (-2267.882) -- 0:02:10
589000 -- (-2261.843) (-2265.683) (-2268.931) [-2268.363] * (-2260.291) [-2261.883] (-2271.255) (-2267.398) -- 0:02:09
589500 -- (-2260.562) (-2261.430) [-2261.502] (-2267.674) * (-2266.688) (-2262.785) (-2264.222) [-2262.263] -- 0:02:09
590000 -- (-2264.408) [-2264.640] (-2262.157) (-2273.873) * (-2257.310) (-2262.840) [-2266.013] (-2261.659) -- 0:02:09
Average standard deviation of split frequencies: 0.009098
590500 -- [-2260.717] (-2269.592) (-2272.700) (-2263.997) * (-2257.460) (-2262.681) (-2278.599) [-2265.710] -- 0:02:08
591000 -- [-2265.404] (-2276.935) (-2263.910) (-2268.134) * (-2260.683) [-2273.037] (-2266.180) (-2258.524) -- 0:02:08
591500 -- (-2276.875) (-2274.369) (-2265.132) [-2260.026] * (-2262.962) (-2286.846) [-2262.225] (-2265.780) -- 0:02:08
592000 -- (-2280.735) [-2258.939] (-2260.560) (-2267.027) * [-2256.421] (-2292.049) (-2262.253) (-2276.855) -- 0:02:08
592500 -- (-2272.004) [-2264.313] (-2263.344) (-2277.195) * [-2260.295] (-2276.998) (-2264.770) (-2271.703) -- 0:02:08
593000 -- (-2284.672) (-2256.286) [-2265.056] (-2266.756) * [-2255.310] (-2262.434) (-2258.866) (-2275.739) -- 0:02:08
593500 -- (-2289.619) [-2265.389] (-2261.570) (-2268.046) * [-2262.810] (-2263.314) (-2271.391) (-2273.257) -- 0:02:08
594000 -- (-2265.458) (-2272.434) (-2273.760) [-2268.278] * [-2258.936] (-2275.776) (-2262.763) (-2265.005) -- 0:02:07
594500 -- (-2266.351) (-2274.841) (-2270.995) [-2279.992] * (-2264.670) (-2258.660) [-2268.952] (-2261.365) -- 0:02:07
595000 -- [-2265.113] (-2274.722) (-2256.844) (-2281.083) * (-2267.855) [-2265.153] (-2263.113) (-2290.255) -- 0:02:07
Average standard deviation of split frequencies: 0.009544
595500 -- (-2274.325) (-2260.982) [-2259.241] (-2267.459) * (-2263.296) (-2265.892) [-2261.307] (-2281.369) -- 0:02:07
596000 -- [-2262.847] (-2263.089) (-2268.980) (-2271.702) * (-2260.691) (-2270.482) (-2263.622) [-2263.533] -- 0:02:07
596500 -- (-2266.306) (-2261.436) (-2271.323) [-2265.633] * [-2266.064] (-2272.938) (-2270.486) (-2268.605) -- 0:02:07
597000 -- (-2271.759) (-2271.851) (-2272.836) [-2255.322] * (-2269.438) [-2260.361] (-2269.466) (-2268.015) -- 0:02:06
597500 -- (-2265.467) (-2268.383) (-2264.501) [-2265.084] * [-2261.429] (-2259.519) (-2275.118) (-2274.583) -- 0:02:06
598000 -- (-2272.988) (-2282.194) [-2268.522] (-2270.463) * (-2271.019) [-2259.116] (-2272.044) (-2275.391) -- 0:02:07
598500 -- (-2262.569) (-2265.610) [-2254.801] (-2265.507) * (-2265.811) (-2270.183) (-2267.226) [-2264.265] -- 0:02:06
599000 -- [-2265.970] (-2264.990) (-2264.367) (-2278.142) * (-2263.531) (-2266.218) [-2264.483] (-2264.464) -- 0:02:06
599500 -- (-2269.462) (-2268.701) [-2263.885] (-2260.541) * (-2276.918) (-2263.290) [-2264.160] (-2262.739) -- 0:02:06
600000 -- (-2278.040) (-2263.073) [-2267.405] (-2267.051) * (-2276.060) (-2262.982) (-2266.847) [-2258.574] -- 0:02:06
Average standard deviation of split frequencies: 0.009522
600500 -- (-2267.996) (-2268.541) (-2264.543) [-2261.336] * (-2273.516) (-2263.875) [-2262.172] (-2270.509) -- 0:02:06
601000 -- (-2274.601) [-2256.191] (-2273.642) (-2277.513) * (-2275.454) (-2265.481) [-2264.050] (-2267.958) -- 0:02:06
601500 -- (-2273.039) (-2282.258) [-2264.441] (-2272.476) * (-2274.566) (-2287.694) [-2264.650] (-2272.521) -- 0:02:05
602000 -- [-2266.978] (-2264.415) (-2276.495) (-2264.824) * (-2276.851) (-2279.794) (-2261.161) [-2265.442] -- 0:02:05
602500 -- (-2262.896) (-2267.622) (-2268.173) [-2262.029] * [-2258.675] (-2287.101) (-2263.486) (-2268.330) -- 0:02:05
603000 -- (-2272.546) (-2279.239) (-2267.490) [-2258.439] * (-2263.919) (-2274.623) (-2273.207) [-2262.310] -- 0:02:05
603500 -- [-2259.856] (-2268.170) (-2271.070) (-2273.290) * (-2273.074) (-2274.354) (-2278.513) [-2261.891] -- 0:02:04
604000 -- (-2259.245) (-2266.956) [-2263.967] (-2281.098) * (-2259.837) (-2278.885) (-2266.305) [-2267.820] -- 0:02:05
604500 -- (-2264.365) [-2261.529] (-2267.792) (-2273.437) * [-2260.968] (-2276.589) (-2270.597) (-2263.608) -- 0:02:04
605000 -- (-2266.174) [-2270.007] (-2265.742) (-2273.193) * [-2258.365] (-2272.573) (-2261.150) (-2266.565) -- 0:02:04
Average standard deviation of split frequencies: 0.008972
605500 -- [-2268.332] (-2275.440) (-2269.825) (-2269.939) * (-2261.096) (-2262.774) [-2264.677] (-2257.706) -- 0:02:04
606000 -- (-2273.709) [-2264.934] (-2267.681) (-2270.596) * (-2262.043) (-2267.869) [-2256.565] (-2259.857) -- 0:02:04
606500 -- [-2266.605] (-2289.459) (-2268.172) (-2262.661) * (-2263.322) (-2266.071) [-2261.281] (-2264.321) -- 0:02:03
607000 -- (-2272.198) (-2276.498) [-2268.765] (-2263.633) * (-2264.755) (-2280.269) [-2264.211] (-2270.562) -- 0:02:03
607500 -- (-2268.892) (-2271.067) (-2277.381) [-2262.502] * (-2253.294) [-2257.487] (-2260.091) (-2266.345) -- 0:02:04
608000 -- (-2271.504) [-2264.494] (-2276.779) (-2257.001) * (-2267.472) [-2269.347] (-2265.472) (-2270.681) -- 0:02:03
608500 -- (-2269.344) (-2273.297) [-2265.641] (-2259.681) * (-2268.097) [-2253.324] (-2277.593) (-2274.100) -- 0:02:03
609000 -- (-2259.744) [-2268.589] (-2276.364) (-2272.099) * (-2270.449) (-2263.997) [-2267.367] (-2268.769) -- 0:02:03
609500 -- (-2255.094) [-2261.762] (-2265.315) (-2267.876) * [-2267.306] (-2266.522) (-2263.620) (-2265.533) -- 0:02:03
610000 -- (-2261.168) (-2273.385) [-2258.285] (-2266.705) * (-2262.161) [-2262.114] (-2265.840) (-2277.663) -- 0:02:02
Average standard deviation of split frequencies: 0.009418
610500 -- (-2264.329) [-2263.962] (-2261.076) (-2266.301) * (-2266.377) [-2265.706] (-2269.647) (-2258.242) -- 0:02:02
611000 -- (-2260.838) [-2266.160] (-2279.890) (-2263.293) * (-2276.109) (-2264.181) [-2263.593] (-2260.940) -- 0:02:02
611500 -- (-2272.371) (-2263.127) (-2265.917) [-2261.654] * [-2261.965] (-2254.495) (-2262.255) (-2272.699) -- 0:02:02
612000 -- (-2267.924) [-2253.111] (-2262.662) (-2282.027) * (-2271.164) (-2264.909) (-2260.620) [-2266.375] -- 0:02:02
612500 -- [-2261.173] (-2259.811) (-2265.099) (-2267.568) * [-2256.675] (-2257.816) (-2265.132) (-2282.574) -- 0:02:02
613000 -- (-2272.704) [-2264.318] (-2270.436) (-2260.026) * (-2268.743) (-2263.644) (-2265.102) [-2265.736] -- 0:02:01
613500 -- (-2258.949) (-2275.446) [-2258.371] (-2261.691) * (-2276.250) (-2265.336) [-2264.118] (-2256.418) -- 0:02:01
614000 -- (-2282.952) (-2272.899) (-2268.638) [-2261.542] * (-2272.714) [-2270.594] (-2257.392) (-2279.472) -- 0:02:01
614500 -- (-2257.319) [-2265.242] (-2274.473) (-2260.715) * (-2264.509) [-2267.600] (-2263.498) (-2274.057) -- 0:02:01
615000 -- (-2259.027) (-2282.655) (-2278.780) [-2272.282] * [-2261.505] (-2268.316) (-2271.830) (-2265.288) -- 0:02:01
Average standard deviation of split frequencies: 0.008316
615500 -- [-2261.130] (-2278.739) (-2266.860) (-2265.619) * (-2268.878) (-2268.141) [-2262.582] (-2267.518) -- 0:02:01
616000 -- (-2268.589) (-2270.915) (-2270.160) [-2262.788] * [-2265.925] (-2264.326) (-2261.852) (-2276.832) -- 0:02:00
616500 -- (-2258.739) (-2257.690) (-2276.571) [-2263.645] * (-2268.822) [-2269.564] (-2265.072) (-2269.634) -- 0:02:00
617000 -- (-2264.620) (-2269.197) (-2269.923) [-2267.365] * [-2258.002] (-2266.770) (-2262.258) (-2284.317) -- 0:02:00
617500 -- (-2280.284) [-2268.454] (-2260.566) (-2267.630) * (-2267.453) (-2274.336) [-2258.588] (-2275.216) -- 0:02:00
618000 -- (-2272.340) (-2270.512) (-2266.092) [-2268.746] * [-2273.632] (-2264.517) (-2262.563) (-2281.444) -- 0:01:59
618500 -- (-2271.770) (-2263.887) [-2258.068] (-2259.826) * (-2274.756) (-2267.232) [-2265.681] (-2261.126) -- 0:02:00
619000 -- (-2270.225) (-2265.421) (-2266.477) [-2258.450] * (-2279.202) [-2271.358] (-2264.011) (-2266.984) -- 0:02:00
619500 -- (-2261.936) (-2265.013) [-2258.196] (-2266.762) * (-2275.290) (-2271.254) [-2268.927] (-2260.036) -- 0:01:59
620000 -- (-2289.541) [-2260.167] (-2267.203) (-2267.732) * (-2271.817) (-2279.424) (-2263.873) [-2271.955] -- 0:01:59
Average standard deviation of split frequencies: 0.008355
620500 -- (-2271.701) (-2257.951) [-2268.423] (-2270.018) * (-2273.084) (-2268.463) (-2265.265) [-2257.803] -- 0:01:59
621000 -- (-2276.913) [-2268.833] (-2280.790) (-2276.320) * (-2268.609) (-2270.097) (-2260.552) [-2269.670] -- 0:01:59
621500 -- (-2263.964) (-2263.221) (-2287.114) [-2271.565] * (-2269.722) (-2277.416) [-2272.814] (-2269.036) -- 0:01:58
622000 -- (-2266.068) (-2265.545) (-2280.525) [-2270.634] * (-2268.135) (-2276.172) (-2269.331) [-2268.100] -- 0:01:59
622500 -- (-2272.801) (-2267.483) (-2264.890) [-2268.122] * [-2265.980] (-2262.847) (-2274.494) (-2260.946) -- 0:01:58
623000 -- (-2269.291) (-2270.479) (-2278.371) [-2263.511] * (-2260.582) (-2264.822) (-2276.328) [-2261.269] -- 0:01:58
623500 -- (-2270.690) (-2265.141) (-2271.382) [-2270.920] * (-2268.378) (-2264.144) [-2261.277] (-2268.162) -- 0:01:58
624000 -- (-2269.293) (-2267.432) (-2269.313) [-2253.248] * (-2266.012) [-2263.888] (-2263.397) (-2282.778) -- 0:01:58
624500 -- (-2266.100) (-2276.147) (-2285.577) [-2266.046] * [-2263.020] (-2277.701) (-2262.143) (-2267.502) -- 0:01:57
625000 -- (-2262.816) (-2264.872) [-2265.171] (-2265.073) * (-2266.136) (-2284.679) (-2273.939) [-2269.132] -- 0:01:57
Average standard deviation of split frequencies: 0.008233
625500 -- (-2264.445) (-2272.739) (-2264.685) [-2261.452] * [-2268.559] (-2271.190) (-2262.968) (-2277.254) -- 0:01:57
626000 -- (-2302.153) (-2257.037) [-2261.479] (-2269.224) * (-2275.827) [-2261.305] (-2260.622) (-2267.312) -- 0:01:57
626500 -- (-2277.676) (-2273.284) (-2258.511) [-2259.897] * (-2268.845) (-2264.271) (-2270.570) [-2263.548] -- 0:01:57
627000 -- [-2262.014] (-2262.721) (-2268.316) (-2270.393) * (-2265.778) [-2262.311] (-2266.684) (-2271.546) -- 0:01:57
627500 -- [-2256.765] (-2268.531) (-2260.757) (-2271.220) * (-2268.762) (-2279.398) (-2270.108) [-2272.253] -- 0:01:56
628000 -- (-2261.025) (-2269.837) [-2260.920] (-2276.270) * (-2269.372) (-2279.972) [-2260.548] (-2267.176) -- 0:01:56
628500 -- [-2270.537] (-2258.326) (-2262.064) (-2266.993) * (-2266.687) [-2265.938] (-2258.189) (-2272.380) -- 0:01:56
629000 -- (-2263.503) [-2256.659] (-2269.843) (-2269.199) * (-2272.890) [-2262.273] (-2261.907) (-2272.982) -- 0:01:56
629500 -- (-2265.574) (-2265.645) (-2273.842) [-2257.557] * (-2277.020) (-2263.973) [-2268.099] (-2258.429) -- 0:01:56
630000 -- (-2269.171) [-2262.040] (-2265.875) (-2255.771) * [-2263.974] (-2280.348) (-2279.831) (-2266.697) -- 0:01:56
Average standard deviation of split frequencies: 0.008272
630500 -- [-2256.446] (-2267.892) (-2289.465) (-2266.783) * [-2262.111] (-2269.412) (-2268.570) (-2267.232) -- 0:01:56
631000 -- (-2259.306) (-2268.504) (-2275.850) [-2261.860] * (-2261.982) (-2264.688) [-2269.019] (-2278.532) -- 0:01:55
631500 -- (-2266.928) (-2266.711) (-2259.335) [-2260.231] * [-2264.657] (-2262.853) (-2261.656) (-2276.218) -- 0:01:55
632000 -- (-2293.398) (-2262.852) (-2263.303) [-2269.421] * (-2268.918) (-2261.854) (-2275.921) [-2265.084] -- 0:01:55
632500 -- (-2268.392) (-2272.124) [-2262.081] (-2272.412) * (-2270.743) (-2276.780) [-2266.911] (-2264.768) -- 0:01:55
633000 -- [-2263.813] (-2266.719) (-2264.747) (-2264.943) * (-2273.373) (-2275.553) [-2272.565] (-2267.231) -- 0:01:55
633500 -- [-2254.021] (-2264.430) (-2271.537) (-2258.635) * [-2268.522] (-2262.871) (-2275.276) (-2266.167) -- 0:01:55
634000 -- (-2266.325) (-2264.181) [-2263.057] (-2284.831) * (-2263.961) (-2260.759) [-2264.147] (-2268.506) -- 0:01:54
634500 -- [-2261.474] (-2272.474) (-2275.391) (-2264.728) * (-2270.410) [-2264.315] (-2266.023) (-2275.314) -- 0:01:55
635000 -- (-2263.296) (-2282.663) (-2270.498) [-2263.820] * [-2258.684] (-2275.557) (-2267.838) (-2264.416) -- 0:01:54
Average standard deviation of split frequencies: 0.007709
635500 -- (-2258.795) (-2282.554) (-2272.405) [-2257.715] * (-2266.462) (-2267.760) (-2267.265) [-2268.473] -- 0:01:54
636000 -- [-2263.205] (-2271.257) (-2266.337) (-2257.390) * (-2262.495) (-2262.422) [-2260.745] (-2262.788) -- 0:01:54
636500 -- (-2259.026) (-2287.407) [-2266.806] (-2262.872) * (-2256.530) (-2257.150) (-2277.078) [-2266.499] -- 0:01:54
637000 -- [-2263.835] (-2277.395) (-2273.211) (-2277.880) * (-2263.361) [-2256.090] (-2272.352) (-2266.634) -- 0:01:53
637500 -- [-2265.465] (-2268.366) (-2273.963) (-2265.589) * (-2277.865) (-2264.176) (-2275.866) [-2258.569] -- 0:01:53
638000 -- [-2262.163] (-2259.716) (-2256.137) (-2262.951) * (-2271.735) [-2268.439] (-2269.964) (-2270.182) -- 0:01:54
638500 -- (-2282.338) (-2272.517) (-2270.683) [-2259.947] * (-2266.223) (-2279.411) [-2264.192] (-2264.823) -- 0:01:53
639000 -- (-2274.868) (-2275.572) (-2265.919) [-2258.759] * [-2257.812] (-2268.528) (-2280.452) (-2266.157) -- 0:01:53
639500 -- (-2279.357) (-2264.015) [-2260.317] (-2259.818) * (-2265.508) [-2258.036] (-2267.097) (-2262.468) -- 0:01:53
640000 -- (-2267.043) (-2271.223) (-2269.462) [-2259.848] * [-2263.030] (-2271.369) (-2269.228) (-2267.453) -- 0:01:53
Average standard deviation of split frequencies: 0.008290
640500 -- [-2274.045] (-2268.206) (-2271.565) (-2270.270) * [-2263.349] (-2266.923) (-2259.025) (-2273.401) -- 0:01:52
641000 -- (-2271.899) [-2259.201] (-2267.570) (-2261.154) * [-2260.926] (-2264.860) (-2268.718) (-2276.694) -- 0:01:52
641500 -- (-2276.391) (-2271.793) [-2255.886] (-2268.027) * [-2261.174] (-2275.071) (-2273.703) (-2267.385) -- 0:01:52
642000 -- (-2271.686) (-2268.801) [-2268.843] (-2261.960) * [-2259.995] (-2258.542) (-2274.908) (-2254.996) -- 0:01:52
642500 -- [-2258.132] (-2279.293) (-2264.398) (-2256.633) * [-2262.324] (-2264.842) (-2272.482) (-2267.859) -- 0:01:52
643000 -- [-2270.849] (-2259.108) (-2269.574) (-2264.078) * [-2269.813] (-2263.918) (-2273.222) (-2256.380) -- 0:01:52
643500 -- (-2269.158) (-2263.979) (-2276.221) [-2260.684] * [-2262.494] (-2269.432) (-2267.317) (-2258.695) -- 0:01:51
644000 -- [-2261.199] (-2267.849) (-2270.686) (-2264.278) * [-2260.456] (-2270.056) (-2266.009) (-2268.128) -- 0:01:51
644500 -- (-2263.752) (-2262.854) (-2264.474) [-2261.873] * (-2263.657) [-2261.240] (-2269.289) (-2266.312) -- 0:01:51
645000 -- [-2256.372] (-2269.442) (-2258.764) (-2275.989) * (-2263.534) (-2260.571) [-2261.850] (-2269.084) -- 0:01:51
Average standard deviation of split frequencies: 0.008708
645500 -- (-2264.645) (-2264.961) (-2269.200) [-2269.113] * (-2270.218) (-2265.359) (-2267.035) [-2269.142] -- 0:01:51
646000 -- [-2262.112] (-2274.557) (-2267.591) (-2270.985) * (-2288.341) [-2263.515] (-2268.631) (-2268.527) -- 0:01:51
646500 -- (-2266.736) (-2271.651) (-2265.933) [-2264.015] * (-2268.112) [-2264.404] (-2265.439) (-2266.011) -- 0:01:50
647000 -- [-2267.012] (-2265.768) (-2273.435) (-2266.999) * (-2256.496) (-2278.341) (-2271.965) [-2263.998] -- 0:01:50
647500 -- (-2269.446) [-2269.167] (-2263.513) (-2273.866) * [-2269.922] (-2270.065) (-2258.769) (-2265.004) -- 0:01:50
648000 -- (-2260.233) [-2257.007] (-2277.870) (-2261.622) * [-2262.097] (-2286.073) (-2264.602) (-2265.816) -- 0:01:50
648500 -- (-2265.501) [-2259.212] (-2272.826) (-2261.688) * (-2261.743) (-2273.653) [-2265.492] (-2268.174) -- 0:01:50
649000 -- (-2263.024) (-2262.282) [-2261.777] (-2267.000) * (-2277.604) [-2265.593] (-2267.488) (-2281.015) -- 0:01:50
649500 -- (-2260.300) (-2268.061) (-2275.079) [-2257.321] * (-2278.504) (-2264.410) (-2271.758) [-2260.131] -- 0:01:50
650000 -- (-2269.174) (-2261.565) (-2260.964) [-2262.222] * [-2258.331] (-2267.083) (-2265.673) (-2274.179) -- 0:01:49
Average standard deviation of split frequencies: 0.008549
650500 -- (-2260.271) (-2263.612) [-2262.322] (-2274.392) * [-2267.136] (-2267.274) (-2275.239) (-2268.269) -- 0:01:49
651000 -- (-2262.461) (-2265.802) (-2268.711) [-2255.809] * (-2267.829) (-2269.824) (-2261.035) [-2258.563] -- 0:01:49
651500 -- (-2267.794) (-2264.524) (-2263.915) [-2261.534] * (-2282.154) (-2269.530) (-2270.295) [-2271.980] -- 0:01:49
652000 -- (-2275.897) (-2268.859) [-2261.541] (-2268.212) * [-2262.645] (-2275.382) (-2274.457) (-2268.357) -- 0:01:49
652500 -- (-2272.090) (-2272.050) (-2267.795) [-2258.560] * [-2271.311] (-2271.676) (-2275.381) (-2274.318) -- 0:01:49
653000 -- (-2274.261) (-2270.287) [-2258.402] (-2269.631) * (-2263.144) (-2285.306) [-2264.607] (-2268.999) -- 0:01:48
653500 -- (-2268.605) (-2269.152) [-2269.853] (-2269.941) * (-2269.085) (-2282.870) [-2265.545] (-2259.337) -- 0:01:48
654000 -- (-2267.264) (-2282.229) (-2263.639) [-2260.058] * (-2274.861) (-2265.080) (-2275.621) [-2268.688] -- 0:01:48
654500 -- (-2259.062) (-2277.106) (-2266.069) [-2266.937] * (-2267.369) (-2279.945) [-2263.420] (-2264.027) -- 0:01:48
655000 -- [-2267.134] (-2269.406) (-2273.020) (-2266.682) * (-2263.057) (-2271.783) (-2266.342) [-2269.663] -- 0:01:48
Average standard deviation of split frequencies: 0.008815
655500 -- (-2274.859) [-2273.580] (-2258.016) (-2266.745) * (-2259.226) (-2273.281) (-2287.511) [-2262.761] -- 0:01:48
656000 -- (-2278.727) (-2262.380) [-2260.184] (-2264.899) * [-2259.095] (-2268.145) (-2275.678) (-2256.833) -- 0:01:48
656500 -- (-2265.938) [-2256.142] (-2276.326) (-2282.542) * (-2266.466) (-2266.182) [-2262.413] (-2265.474) -- 0:01:47
657000 -- (-2274.361) [-2255.936] (-2273.392) (-2283.539) * [-2261.669] (-2266.713) (-2279.847) (-2265.545) -- 0:01:47
657500 -- (-2267.669) (-2258.555) [-2266.259] (-2259.545) * (-2264.398) (-2266.409) (-2266.153) [-2269.669] -- 0:01:47
658000 -- (-2268.040) (-2271.203) (-2264.144) [-2268.002] * [-2267.252] (-2270.352) (-2274.736) (-2275.510) -- 0:01:47
658500 -- (-2268.816) (-2263.310) [-2264.541] (-2276.073) * (-2280.298) [-2271.506] (-2259.967) (-2265.543) -- 0:01:47
659000 -- (-2264.420) (-2264.285) [-2266.139] (-2280.203) * [-2264.081] (-2268.840) (-2262.391) (-2268.233) -- 0:01:47
659500 -- [-2260.319] (-2256.733) (-2269.438) (-2281.904) * [-2260.938] (-2270.135) (-2258.876) (-2271.462) -- 0:01:46
660000 -- (-2277.767) [-2260.146] (-2263.357) (-2262.950) * (-2267.071) [-2265.379] (-2261.415) (-2259.307) -- 0:01:46
Average standard deviation of split frequencies: 0.008657
660500 -- (-2268.582) (-2268.066) (-2259.717) [-2257.356] * (-2270.488) [-2259.227] (-2260.935) (-2268.505) -- 0:01:46
661000 -- (-2260.047) (-2284.667) [-2259.315] (-2263.668) * (-2265.513) [-2260.837] (-2260.904) (-2265.642) -- 0:01:46
661500 -- [-2265.078] (-2295.006) (-2272.486) (-2265.213) * [-2265.852] (-2263.980) (-2267.969) (-2263.817) -- 0:01:45
662000 -- (-2270.106) [-2263.325] (-2256.824) (-2279.790) * (-2273.549) (-2265.383) (-2267.946) [-2263.233] -- 0:01:46
662500 -- (-2261.599) (-2260.617) [-2257.493] (-2272.277) * (-2270.889) [-2264.973] (-2268.160) (-2272.925) -- 0:01:45
663000 -- (-2264.102) (-2262.250) [-2264.734] (-2272.737) * (-2270.476) (-2269.832) [-2260.564] (-2276.457) -- 0:01:45
663500 -- [-2264.540] (-2275.807) (-2266.021) (-2271.980) * (-2266.859) (-2265.433) (-2261.984) [-2281.090] -- 0:01:45
664000 -- (-2268.789) (-2272.449) [-2269.444] (-2269.796) * [-2262.925] (-2263.810) (-2263.576) (-2274.976) -- 0:01:45
664500 -- (-2259.278) [-2268.471] (-2272.089) (-2275.590) * (-2264.345) (-2266.918) [-2261.288] (-2265.194) -- 0:01:45
665000 -- (-2259.397) (-2269.716) (-2273.773) [-2267.852] * (-2264.349) (-2276.217) [-2268.371] (-2264.734) -- 0:01:45
Average standard deviation of split frequencies: 0.008399
665500 -- (-2265.078) (-2275.209) (-2278.646) [-2265.466] * (-2265.090) [-2260.436] (-2265.614) (-2269.590) -- 0:01:45
666000 -- [-2267.633] (-2275.484) (-2274.023) (-2270.480) * [-2256.146] (-2263.240) (-2272.612) (-2272.398) -- 0:01:44
666500 -- (-2271.908) (-2267.461) (-2274.340) [-2258.251] * (-2265.027) (-2270.214) [-2270.639] (-2265.089) -- 0:01:44
667000 -- [-2259.348] (-2277.736) (-2271.159) (-2257.768) * [-2272.633] (-2274.741) (-2263.645) (-2276.472) -- 0:01:44
667500 -- [-2272.055] (-2266.981) (-2265.257) (-2278.257) * (-2272.230) (-2270.831) [-2264.181] (-2260.378) -- 0:01:44
668000 -- [-2268.550] (-2270.720) (-2274.991) (-2270.342) * (-2265.404) (-2276.476) [-2267.279] (-2266.722) -- 0:01:44
668500 -- (-2280.115) [-2274.024] (-2267.304) (-2268.727) * [-2269.570] (-2271.643) (-2264.446) (-2268.780) -- 0:01:44
669000 -- (-2266.193) (-2271.849) [-2257.930] (-2258.825) * (-2268.920) [-2259.934] (-2265.965) (-2268.104) -- 0:01:43
669500 -- (-2275.191) (-2262.925) (-2263.196) [-2264.292] * (-2275.290) (-2273.537) (-2279.329) [-2258.096] -- 0:01:43
670000 -- (-2263.424) (-2265.247) [-2264.091] (-2272.160) * (-2271.145) (-2270.999) (-2265.994) [-2262.131] -- 0:01:43
Average standard deviation of split frequencies: 0.007826
670500 -- (-2276.025) (-2265.286) [-2266.793] (-2265.385) * (-2264.026) [-2262.099] (-2263.466) (-2272.843) -- 0:01:43
671000 -- (-2274.286) [-2264.946] (-2282.346) (-2268.856) * [-2258.455] (-2265.889) (-2273.326) (-2264.816) -- 0:01:43
671500 -- (-2274.957) [-2274.254] (-2283.270) (-2268.978) * (-2263.291) (-2266.889) [-2268.183] (-2265.268) -- 0:01:43
672000 -- [-2262.948] (-2269.162) (-2280.061) (-2274.230) * [-2261.645] (-2272.503) (-2271.226) (-2264.434) -- 0:01:42
672500 -- [-2270.072] (-2260.676) (-2269.345) (-2266.206) * (-2277.480) (-2266.402) (-2269.624) [-2280.425] -- 0:01:42
673000 -- (-2261.426) (-2259.619) (-2272.313) [-2263.656] * (-2272.467) (-2286.375) [-2257.857] (-2278.217) -- 0:01:42
673500 -- (-2278.790) (-2260.606) [-2266.287] (-2286.578) * [-2260.463] (-2264.944) (-2266.142) (-2269.789) -- 0:01:42
674000 -- (-2267.817) (-2264.722) (-2268.670) [-2268.501] * (-2264.459) (-2262.229) [-2257.715] (-2276.187) -- 0:01:42
674500 -- (-2266.966) (-2284.055) [-2263.483] (-2270.073) * (-2269.311) (-2261.194) [-2261.671] (-2270.080) -- 0:01:42
675000 -- (-2280.068) [-2255.328] (-2267.045) (-2261.581) * [-2255.023] (-2276.869) (-2274.243) (-2265.319) -- 0:01:42
Average standard deviation of split frequencies: 0.007950
675500 -- (-2271.929) [-2266.246] (-2267.989) (-2263.043) * (-2261.604) (-2273.670) (-2278.768) [-2261.890] -- 0:01:41
676000 -- [-2265.607] (-2274.640) (-2268.521) (-2257.807) * (-2276.556) (-2273.806) [-2263.328] (-2270.551) -- 0:01:41
676500 -- (-2261.276) (-2274.182) [-2268.438] (-2270.473) * (-2262.717) (-2263.981) [-2263.085] (-2262.506) -- 0:01:41
677000 -- [-2263.941] (-2257.560) (-2260.497) (-2261.545) * (-2269.602) (-2259.274) (-2277.493) [-2262.541] -- 0:01:41
677500 -- (-2274.179) (-2260.054) [-2260.231] (-2263.895) * (-2268.214) (-2266.972) (-2269.288) [-2265.367] -- 0:01:40
678000 -- (-2277.834) (-2270.953) (-2267.953) [-2264.713] * [-2262.469] (-2270.853) (-2268.825) (-2261.230) -- 0:01:41
678500 -- [-2272.290] (-2279.195) (-2264.090) (-2265.313) * (-2272.787) (-2267.970) [-2259.876] (-2265.592) -- 0:01:40
679000 -- (-2272.644) (-2260.302) [-2265.170] (-2266.136) * (-2270.889) (-2266.038) (-2267.420) [-2265.437] -- 0:01:40
679500 -- (-2270.265) [-2261.172] (-2268.000) (-2275.069) * (-2274.650) (-2264.655) (-2265.098) [-2267.142] -- 0:01:40
680000 -- (-2271.066) (-2271.428) [-2261.492] (-2273.740) * (-2275.914) (-2266.725) (-2277.162) [-2262.320] -- 0:01:40
Average standard deviation of split frequencies: 0.007849
680500 -- [-2264.200] (-2264.268) (-2262.813) (-2265.569) * [-2274.468] (-2264.694) (-2271.277) (-2266.528) -- 0:01:40
681000 -- [-2259.677] (-2268.786) (-2262.014) (-2269.201) * (-2278.453) (-2259.320) [-2263.558] (-2262.922) -- 0:01:39
681500 -- (-2257.631) [-2268.762] (-2267.946) (-2265.945) * (-2272.040) [-2258.749] (-2281.456) (-2266.143) -- 0:01:40
682000 -- [-2267.959] (-2270.902) (-2286.535) (-2271.737) * (-2257.895) [-2261.374] (-2276.140) (-2271.976) -- 0:01:39
682500 -- (-2264.868) (-2282.351) (-2281.282) [-2255.228] * [-2261.388] (-2265.010) (-2269.571) (-2262.399) -- 0:01:39
683000 -- (-2273.722) (-2260.263) (-2267.166) [-2261.073] * [-2260.763] (-2267.052) (-2267.129) (-2261.044) -- 0:01:39
683500 -- (-2267.367) [-2264.641] (-2264.348) (-2260.402) * (-2265.084) (-2266.657) [-2263.383] (-2271.437) -- 0:01:39
684000 -- (-2272.785) (-2272.597) (-2261.858) [-2263.812] * (-2275.767) (-2268.090) (-2269.011) [-2268.769] -- 0:01:38
684500 -- (-2274.604) (-2270.114) (-2266.367) [-2260.480] * (-2274.207) (-2258.679) [-2260.604] (-2281.036) -- 0:01:38
685000 -- (-2275.110) (-2260.777) (-2267.668) [-2259.450] * (-2275.258) (-2261.406) [-2259.668] (-2272.777) -- 0:01:38
Average standard deviation of split frequencies: 0.008017
685500 -- (-2261.153) [-2262.978] (-2262.172) (-2265.742) * (-2272.380) [-2258.691] (-2266.742) (-2273.275) -- 0:01:38
686000 -- (-2259.011) (-2264.831) (-2260.328) [-2256.418] * (-2271.403) (-2275.290) [-2262.699] (-2283.453) -- 0:01:38
686500 -- (-2259.689) [-2264.141] (-2275.391) (-2269.165) * [-2270.178] (-2277.982) (-2268.866) (-2271.641) -- 0:01:38
687000 -- [-2262.240] (-2269.879) (-2267.610) (-2267.186) * (-2268.767) (-2264.680) [-2265.453] (-2273.177) -- 0:01:37
687500 -- (-2270.934) (-2262.670) [-2259.616] (-2265.876) * (-2265.027) (-2261.130) [-2269.256] (-2270.509) -- 0:01:37
688000 -- (-2278.463) (-2271.009) [-2266.054] (-2269.166) * (-2263.516) (-2281.966) (-2264.915) [-2268.913] -- 0:01:37
688500 -- (-2275.148) [-2273.656] (-2273.762) (-2261.887) * (-2267.243) (-2269.904) [-2264.903] (-2260.811) -- 0:01:37
689000 -- (-2265.736) (-2267.653) (-2271.079) [-2262.119] * (-2266.062) (-2271.229) (-2270.304) [-2263.873] -- 0:01:37
689500 -- (-2275.940) (-2263.811) (-2260.836) [-2260.349] * (-2264.431) [-2262.044] (-2272.569) (-2262.993) -- 0:01:37
690000 -- (-2264.844) (-2271.331) (-2262.181) [-2267.544] * (-2270.591) (-2269.095) (-2271.943) [-2262.793] -- 0:01:37
Average standard deviation of split frequencies: 0.007553
690500 -- [-2261.645] (-2263.475) (-2262.225) (-2260.429) * (-2255.726) [-2268.288] (-2273.179) (-2258.579) -- 0:01:36
691000 -- [-2268.717] (-2279.514) (-2260.124) (-2267.853) * (-2273.646) [-2265.137] (-2266.995) (-2273.444) -- 0:01:36
691500 -- [-2262.521] (-2265.580) (-2259.806) (-2268.313) * (-2264.111) (-2263.477) [-2261.998] (-2266.937) -- 0:01:36
692000 -- (-2284.625) (-2278.229) (-2267.064) [-2260.790] * [-2265.616] (-2260.538) (-2274.340) (-2268.664) -- 0:01:36
692500 -- (-2260.287) (-2266.136) (-2270.213) [-2261.546] * (-2275.517) (-2260.923) [-2260.462] (-2266.358) -- 0:01:36
693000 -- [-2262.832] (-2263.591) (-2268.130) (-2258.785) * (-2273.730) (-2270.108) (-2271.787) [-2263.945] -- 0:01:36
693500 -- [-2269.669] (-2268.347) (-2261.459) (-2264.610) * (-2274.751) (-2268.787) [-2261.363] (-2274.175) -- 0:01:35
694000 -- (-2273.259) [-2261.800] (-2264.310) (-2270.450) * [-2267.848] (-2268.122) (-2274.047) (-2277.877) -- 0:01:35
694500 -- (-2272.732) (-2258.417) [-2264.533] (-2268.623) * (-2258.521) (-2262.018) [-2267.454] (-2284.477) -- 0:01:35
695000 -- (-2266.574) (-2263.537) (-2268.031) [-2263.382] * (-2269.885) (-2269.573) [-2265.987] (-2259.206) -- 0:01:35
Average standard deviation of split frequencies: 0.007812
695500 -- (-2260.586) (-2265.339) [-2268.733] (-2265.822) * (-2271.777) (-2263.907) (-2262.993) [-2256.614] -- 0:01:35
696000 -- (-2263.367) [-2259.532] (-2262.302) (-2283.062) * [-2272.076] (-2276.762) (-2273.952) (-2268.287) -- 0:01:35
696500 -- (-2268.254) (-2263.650) (-2274.686) [-2265.290] * [-2263.737] (-2271.765) (-2277.901) (-2265.303) -- 0:01:34
697000 -- (-2275.576) (-2262.213) (-2274.661) [-2258.285] * (-2261.927) (-2286.972) (-2263.208) [-2263.131] -- 0:01:34
697500 -- (-2265.763) (-2275.963) (-2276.729) [-2262.075] * [-2270.170] (-2274.597) (-2276.521) (-2277.441) -- 0:01:34
698000 -- [-2260.597] (-2260.905) (-2264.009) (-2266.252) * (-2262.255) [-2261.935] (-2264.508) (-2286.347) -- 0:01:34
698500 -- (-2262.259) (-2277.442) (-2269.874) [-2263.375] * (-2261.865) [-2264.854] (-2266.837) (-2273.254) -- 0:01:34
699000 -- (-2262.359) (-2264.823) [-2259.800] (-2273.480) * [-2270.819] (-2265.187) (-2275.256) (-2280.759) -- 0:01:34
699500 -- (-2257.497) (-2267.388) [-2260.807] (-2267.871) * [-2260.212] (-2260.604) (-2264.054) (-2287.515) -- 0:01:34
700000 -- (-2264.230) (-2271.666) [-2275.913] (-2264.589) * (-2263.831) (-2263.599) (-2268.248) [-2270.610] -- 0:01:33
Average standard deviation of split frequencies: 0.007849
700500 -- (-2274.981) (-2267.256) (-2263.373) [-2261.324] * (-2266.977) [-2268.850] (-2260.771) (-2277.346) -- 0:01:33
701000 -- (-2272.082) (-2262.780) (-2270.343) [-2266.488] * [-2256.824] (-2265.578) (-2273.741) (-2274.021) -- 0:01:33
701500 -- (-2271.069) [-2260.597] (-2285.062) (-2276.807) * [-2267.213] (-2265.693) (-2281.614) (-2269.172) -- 0:01:33
702000 -- (-2264.052) [-2259.000] (-2269.768) (-2263.924) * (-2270.857) [-2275.389] (-2269.791) (-2272.534) -- 0:01:33
702500 -- (-2266.172) [-2256.179] (-2268.045) (-2271.737) * (-2267.066) (-2258.150) [-2259.570] (-2263.966) -- 0:01:33
703000 -- (-2263.815) (-2275.643) (-2273.789) [-2267.920] * (-2272.560) (-2269.650) [-2256.860] (-2262.154) -- 0:01:32
703500 -- (-2265.931) (-2259.657) (-2289.956) [-2268.840] * (-2273.848) (-2265.605) [-2260.119] (-2271.736) -- 0:01:32
704000 -- (-2278.843) (-2264.853) (-2269.608) [-2264.483] * (-2276.827) [-2265.403] (-2258.614) (-2256.961) -- 0:01:32
704500 -- (-2261.456) [-2273.114] (-2275.868) (-2268.129) * [-2271.862] (-2263.094) (-2265.413) (-2264.471) -- 0:01:32
705000 -- (-2266.143) (-2267.278) (-2266.343) [-2263.446] * (-2272.170) (-2262.900) [-2256.258] (-2268.608) -- 0:01:32
Average standard deviation of split frequencies: 0.008280
705500 -- [-2259.484] (-2257.846) (-2281.520) (-2266.418) * (-2277.921) (-2269.574) [-2267.670] (-2267.828) -- 0:01:32
706000 -- (-2277.250) [-2259.786] (-2268.699) (-2266.465) * (-2278.371) [-2264.379] (-2264.818) (-2264.879) -- 0:01:32
706500 -- (-2270.758) (-2263.957) (-2277.635) [-2264.696] * (-2272.407) [-2272.233] (-2265.406) (-2275.280) -- 0:01:31
707000 -- (-2261.827) (-2261.368) (-2266.877) [-2265.601] * (-2264.273) (-2262.079) (-2279.565) [-2266.935] -- 0:01:31
707500 -- (-2268.328) [-2254.905] (-2272.086) (-2263.380) * (-2258.435) (-2266.159) [-2257.240] (-2267.363) -- 0:01:31
708000 -- (-2269.805) (-2263.151) (-2274.757) [-2261.518] * (-2264.111) (-2266.222) [-2267.612] (-2271.314) -- 0:01:31
708500 -- (-2268.344) [-2258.573] (-2265.649) (-2261.397) * [-2264.073] (-2274.306) (-2280.416) (-2264.553) -- 0:01:31
709000 -- (-2268.339) (-2270.163) [-2271.834] (-2269.217) * (-2265.896) [-2262.865] (-2280.134) (-2270.420) -- 0:01:31
709500 -- [-2257.166] (-2270.109) (-2273.527) (-2260.977) * [-2262.185] (-2267.833) (-2272.235) (-2274.555) -- 0:01:30
710000 -- [-2265.035] (-2268.209) (-2274.736) (-2265.824) * (-2266.474) (-2268.046) (-2261.253) [-2266.975] -- 0:01:30
Average standard deviation of split frequencies: 0.008623
710500 -- [-2265.923] (-2267.621) (-2270.312) (-2265.356) * (-2261.137) (-2267.424) (-2266.888) [-2265.232] -- 0:01:30
711000 -- [-2255.179] (-2267.497) (-2258.751) (-2269.085) * (-2266.022) [-2265.564] (-2266.639) (-2271.580) -- 0:01:30
711500 -- (-2266.584) [-2271.959] (-2269.651) (-2265.512) * (-2267.032) [-2260.059] (-2274.201) (-2277.590) -- 0:01:30
712000 -- (-2272.529) [-2269.648] (-2269.968) (-2263.482) * (-2272.982) (-2266.380) [-2263.167] (-2264.944) -- 0:01:30
712500 -- (-2285.505) [-2263.826] (-2264.234) (-2264.088) * (-2275.098) (-2264.867) (-2272.148) [-2255.534] -- 0:01:29
713000 -- (-2271.036) [-2260.043] (-2270.236) (-2271.750) * (-2262.596) [-2259.459] (-2268.115) (-2259.531) -- 0:01:29
713500 -- (-2266.000) [-2256.174] (-2259.127) (-2280.679) * [-2256.245] (-2269.096) (-2268.545) (-2267.036) -- 0:01:29
714000 -- (-2264.317) (-2266.876) [-2254.824] (-2264.473) * (-2262.444) (-2275.036) (-2273.316) [-2262.161] -- 0:01:29
714500 -- (-2269.800) (-2261.376) [-2256.648] (-2265.409) * (-2276.731) [-2264.895] (-2271.400) (-2284.860) -- 0:01:29
715000 -- (-2265.465) (-2269.601) [-2263.302] (-2273.199) * [-2269.890] (-2271.168) (-2274.287) (-2276.283) -- 0:01:29
Average standard deviation of split frequencies: 0.008164
715500 -- (-2274.903) [-2267.862] (-2283.642) (-2266.626) * (-2262.202) [-2265.105] (-2272.776) (-2277.175) -- 0:01:29
716000 -- (-2271.939) [-2276.141] (-2276.118) (-2263.115) * [-2267.641] (-2271.331) (-2275.970) (-2264.767) -- 0:01:28
716500 -- (-2275.907) (-2265.207) (-2273.143) [-2260.239] * [-2266.741] (-2265.656) (-2271.157) (-2260.140) -- 0:01:28
717000 -- (-2267.125) (-2260.802) [-2271.474] (-2270.451) * (-2261.129) (-2265.852) [-2267.296] (-2269.192) -- 0:01:28
717500 -- (-2283.084) (-2258.560) (-2262.171) [-2263.584] * (-2266.375) (-2266.139) (-2272.490) [-2262.681] -- 0:01:28
718000 -- (-2284.766) (-2263.888) [-2270.866] (-2267.208) * (-2272.809) (-2269.910) (-2269.708) [-2270.358] -- 0:01:27
718500 -- (-2274.378) (-2271.205) [-2256.029] (-2265.415) * (-2268.601) (-2281.994) (-2263.599) [-2261.588] -- 0:01:28
719000 -- (-2275.669) [-2264.325] (-2268.440) (-2260.340) * (-2275.089) [-2270.308] (-2262.551) (-2271.660) -- 0:01:27
719500 -- [-2268.739] (-2264.941) (-2271.878) (-2259.661) * (-2261.045) (-2259.870) [-2270.766] (-2271.767) -- 0:01:27
720000 -- (-2266.102) [-2260.615] (-2277.829) (-2258.795) * (-2266.494) (-2275.014) (-2265.444) [-2267.636] -- 0:01:27
Average standard deviation of split frequencies: 0.007544
720500 -- (-2267.321) (-2278.677) (-2273.288) [-2258.651] * [-2266.574] (-2272.696) (-2266.569) (-2284.632) -- 0:01:27
721000 -- [-2265.895] (-2289.762) (-2263.320) (-2263.846) * (-2262.951) (-2265.886) [-2261.334] (-2258.720) -- 0:01:27
721500 -- (-2283.677) (-2277.099) (-2267.310) [-2259.777] * [-2260.789] (-2264.480) (-2263.615) (-2265.033) -- 0:01:26
722000 -- (-2265.444) (-2280.749) [-2261.921] (-2261.832) * (-2262.633) [-2256.787] (-2259.002) (-2266.897) -- 0:01:27
722500 -- [-2267.777] (-2286.017) (-2254.773) (-2265.253) * [-2256.447] (-2263.386) (-2267.485) (-2265.585) -- 0:01:26
723000 -- [-2259.397] (-2280.478) (-2262.884) (-2269.673) * (-2254.643) (-2268.910) (-2263.398) [-2268.028] -- 0:01:26
723500 -- (-2259.877) (-2279.803) (-2273.604) [-2269.111] * (-2265.346) (-2262.967) (-2267.915) [-2261.199] -- 0:01:26
724000 -- (-2267.372) (-2274.015) (-2269.564) [-2265.906] * (-2270.338) [-2267.928] (-2262.301) (-2275.385) -- 0:01:26
724500 -- (-2269.612) (-2269.596) [-2260.839] (-2258.261) * (-2265.678) (-2272.277) [-2257.641] (-2266.885) -- 0:01:25
725000 -- [-2266.633] (-2267.512) (-2271.648) (-2265.075) * (-2271.814) (-2273.533) [-2262.397] (-2268.946) -- 0:01:25
Average standard deviation of split frequencies: 0.007575
725500 -- (-2261.815) [-2276.361] (-2269.047) (-2266.845) * (-2265.952) (-2267.663) (-2271.747) [-2254.596] -- 0:01:25
726000 -- (-2273.919) (-2264.227) (-2271.671) [-2269.517] * [-2277.322] (-2278.704) (-2267.535) (-2263.449) -- 0:01:25
726500 -- (-2261.903) [-2270.064] (-2258.529) (-2267.188) * (-2268.831) [-2266.177] (-2266.033) (-2271.719) -- 0:01:25
727000 -- (-2275.102) (-2268.911) (-2261.102) [-2269.433] * [-2261.466] (-2279.787) (-2264.311) (-2264.970) -- 0:01:25
727500 -- (-2275.909) (-2261.727) [-2259.317] (-2276.767) * (-2266.317) (-2263.816) (-2268.483) [-2263.718] -- 0:01:25
728000 -- (-2258.873) (-2269.930) (-2275.073) [-2263.327] * (-2266.796) (-2279.532) [-2266.208] (-2271.491) -- 0:01:24
728500 -- (-2257.182) (-2275.479) [-2259.813] (-2262.028) * (-2262.929) (-2265.786) (-2265.248) [-2259.039] -- 0:01:24
729000 -- (-2259.466) (-2275.594) (-2260.767) [-2259.957] * (-2270.548) (-2263.160) (-2262.641) [-2258.952] -- 0:01:24
729500 -- (-2266.746) (-2265.521) [-2259.439] (-2261.633) * [-2260.744] (-2270.470) (-2274.046) (-2265.476) -- 0:01:24
730000 -- (-2276.723) (-2263.772) [-2263.524] (-2265.742) * (-2268.624) [-2260.232] (-2259.889) (-2280.414) -- 0:01:24
Average standard deviation of split frequencies: 0.007914
730500 -- (-2277.895) (-2264.605) (-2267.568) [-2265.702] * (-2268.239) [-2260.310] (-2262.685) (-2261.442) -- 0:01:24
731000 -- [-2266.166] (-2265.535) (-2279.357) (-2266.462) * [-2268.977] (-2267.022) (-2267.969) (-2276.266) -- 0:01:23
731500 -- [-2267.731] (-2276.435) (-2259.775) (-2273.625) * [-2259.722] (-2270.550) (-2276.916) (-2269.353) -- 0:01:23
732000 -- (-2268.558) (-2264.026) [-2265.649] (-2270.145) * (-2269.034) (-2271.594) (-2277.211) [-2258.987] -- 0:01:23
732500 -- (-2272.311) [-2268.351] (-2270.065) (-2263.696) * (-2267.896) (-2268.431) [-2262.161] (-2280.533) -- 0:01:23
733000 -- (-2269.517) [-2254.748] (-2266.785) (-2269.970) * (-2274.629) (-2267.881) (-2267.406) [-2261.615] -- 0:01:23
733500 -- (-2267.260) [-2267.598] (-2280.877) (-2264.401) * (-2280.892) (-2262.600) (-2265.982) [-2266.973] -- 0:01:23
734000 -- (-2260.871) [-2257.756] (-2262.809) (-2268.635) * (-2274.532) [-2262.372] (-2276.293) (-2265.997) -- 0:01:22
734500 -- (-2270.706) (-2286.429) [-2257.630] (-2257.474) * (-2261.244) [-2256.538] (-2270.530) (-2276.029) -- 0:01:22
735000 -- (-2272.655) (-2270.569) (-2271.249) [-2266.554] * (-2268.004) [-2262.726] (-2271.904) (-2264.438) -- 0:01:22
Average standard deviation of split frequencies: 0.007985
735500 -- (-2273.474) (-2266.806) [-2262.450] (-2266.620) * (-2264.789) (-2269.213) (-2274.890) [-2260.506] -- 0:01:22
736000 -- (-2268.725) (-2267.095) [-2265.866] (-2271.265) * (-2267.107) [-2256.819] (-2268.540) (-2258.186) -- 0:01:22
736500 -- (-2269.854) (-2269.262) [-2266.505] (-2264.410) * (-2270.068) [-2268.595] (-2260.390) (-2263.161) -- 0:01:22
737000 -- (-2265.194) [-2257.616] (-2264.988) (-2266.819) * (-2265.890) [-2259.262] (-2273.723) (-2263.643) -- 0:01:22
737500 -- [-2263.805] (-2263.588) (-2264.779) (-2278.497) * (-2268.044) (-2273.286) (-2266.513) [-2261.761] -- 0:01:21
738000 -- (-2264.468) [-2259.768] (-2266.391) (-2273.199) * [-2265.481] (-2261.934) (-2267.949) (-2258.080) -- 0:01:21
738500 -- (-2263.437) (-2274.342) (-2266.466) [-2254.102] * (-2265.272) (-2251.260) (-2271.527) [-2256.881] -- 0:01:21
739000 -- (-2262.076) (-2285.359) [-2266.961] (-2261.067) * [-2260.766] (-2256.079) (-2272.910) (-2265.488) -- 0:01:21
739500 -- (-2274.508) (-2260.110) [-2265.963] (-2268.699) * [-2253.567] (-2258.469) (-2273.945) (-2265.163) -- 0:01:21
740000 -- [-2267.193] (-2267.930) (-2266.255) (-2262.996) * (-2254.612) (-2268.578) [-2270.762] (-2279.959) -- 0:01:21
Average standard deviation of split frequencies: 0.007977
740500 -- [-2273.405] (-2273.685) (-2262.257) (-2266.363) * (-2258.193) (-2268.052) [-2256.869] (-2270.433) -- 0:01:20
741000 -- (-2272.690) (-2278.811) [-2262.043] (-2264.999) * (-2263.448) (-2263.036) [-2256.756] (-2280.291) -- 0:01:20
741500 -- [-2267.243] (-2261.605) (-2269.081) (-2259.417) * [-2260.971] (-2265.495) (-2272.547) (-2270.362) -- 0:01:20
742000 -- (-2266.383) (-2274.736) (-2262.973) [-2264.752] * (-2260.327) (-2264.838) (-2276.281) [-2268.076] -- 0:01:20
742500 -- (-2268.008) [-2259.439] (-2263.756) (-2257.017) * (-2268.884) (-2273.389) (-2272.462) [-2257.285] -- 0:01:20
743000 -- (-2275.803) [-2255.948] (-2273.121) (-2259.398) * [-2265.616] (-2271.972) (-2271.246) (-2262.406) -- 0:01:19
743500 -- (-2270.335) (-2262.998) (-2279.318) [-2265.942] * (-2272.267) (-2257.903) [-2260.839] (-2260.373) -- 0:01:20
744000 -- (-2267.379) (-2273.323) (-2266.314) [-2270.020] * (-2276.009) (-2275.413) [-2261.210] (-2268.144) -- 0:01:19
744500 -- (-2272.472) [-2268.677] (-2261.150) (-2272.573) * (-2271.145) (-2267.324) [-2261.507] (-2274.711) -- 0:01:19
745000 -- (-2271.634) [-2260.601] (-2281.940) (-2264.815) * (-2269.863) (-2270.468) (-2268.361) [-2268.711] -- 0:01:19
Average standard deviation of split frequencies: 0.007751
745500 -- (-2278.909) (-2268.531) [-2259.205] (-2263.264) * (-2269.081) (-2274.993) [-2264.615] (-2266.292) -- 0:01:19
746000 -- [-2258.404] (-2258.174) (-2263.397) (-2278.371) * [-2263.996] (-2265.377) (-2269.328) (-2264.146) -- 0:01:19
746500 -- (-2274.339) (-2270.291) [-2256.385] (-2266.465) * (-2260.464) [-2268.026] (-2266.630) (-2273.244) -- 0:01:19
747000 -- (-2258.121) (-2267.350) [-2257.434] (-2263.142) * (-2263.276) (-2270.004) [-2256.808] (-2271.330) -- 0:01:18
747500 -- (-2271.894) (-2260.808) [-2257.592] (-2267.873) * (-2272.874) [-2270.585] (-2264.232) (-2262.686) -- 0:01:18
748000 -- (-2272.922) (-2269.867) (-2270.723) [-2257.889] * [-2263.252] (-2272.149) (-2269.477) (-2262.321) -- 0:01:18
748500 -- (-2268.245) (-2263.883) [-2265.760] (-2267.101) * (-2263.159) (-2273.412) [-2257.821] (-2262.153) -- 0:01:18
749000 -- (-2264.573) [-2263.806] (-2264.898) (-2264.795) * [-2262.846] (-2263.561) (-2273.835) (-2277.887) -- 0:01:18
749500 -- (-2265.393) (-2266.727) [-2267.344] (-2270.129) * (-2284.348) (-2270.569) (-2281.812) [-2271.260] -- 0:01:18
750000 -- (-2274.383) (-2263.236) [-2262.522] (-2266.289) * (-2280.900) (-2267.705) [-2261.205] (-2275.044) -- 0:01:18
Average standard deviation of split frequencies: 0.007745
750500 -- [-2258.833] (-2260.226) (-2266.530) (-2276.207) * (-2269.503) [-2262.542] (-2273.211) (-2266.697) -- 0:01:17
751000 -- [-2266.606] (-2270.212) (-2267.766) (-2260.258) * (-2262.165) [-2265.200] (-2266.564) (-2269.841) -- 0:01:17
751500 -- [-2262.591] (-2280.396) (-2269.707) (-2263.629) * (-2257.582) (-2268.331) [-2266.458] (-2263.332) -- 0:01:17
752000 -- (-2265.387) [-2288.624] (-2255.598) (-2265.733) * (-2254.923) (-2279.585) [-2259.072] (-2269.507) -- 0:01:17
752500 -- (-2266.536) (-2271.171) [-2261.678] (-2265.609) * [-2262.439] (-2269.714) (-2260.827) (-2269.054) -- 0:01:17
753000 -- [-2259.724] (-2271.050) (-2265.541) (-2262.263) * (-2262.975) (-2260.364) (-2257.015) [-2262.077] -- 0:01:17
753500 -- (-2267.487) [-2263.035] (-2290.427) (-2262.797) * (-2264.533) [-2264.004] (-2270.627) (-2268.215) -- 0:01:16
754000 -- (-2259.085) (-2266.868) (-2269.563) [-2262.102] * (-2271.314) (-2274.542) (-2267.895) [-2261.944] -- 0:01:16
754500 -- (-2272.628) [-2261.606] (-2276.523) (-2269.146) * [-2261.614] (-2271.478) (-2260.529) (-2269.320) -- 0:01:16
755000 -- (-2267.020) [-2272.851] (-2283.320) (-2269.914) * (-2272.191) (-2275.077) [-2275.672] (-2272.313) -- 0:01:16
Average standard deviation of split frequencies: 0.007607
755500 -- (-2281.870) (-2267.219) (-2275.998) [-2261.060] * [-2257.037] (-2273.792) (-2264.279) (-2272.802) -- 0:01:16
756000 -- (-2268.100) [-2263.553] (-2268.638) (-2271.742) * (-2275.197) [-2266.131] (-2274.012) (-2276.096) -- 0:01:16
756500 -- [-2257.061] (-2266.371) (-2266.836) (-2274.017) * [-2261.965] (-2272.313) (-2263.185) (-2270.822) -- 0:01:15
757000 -- (-2256.439) (-2271.454) (-2265.907) [-2265.123] * (-2283.494) (-2267.424) [-2263.688] (-2267.204) -- 0:01:15
757500 -- (-2271.664) [-2260.571] (-2268.732) (-2264.750) * (-2272.603) (-2264.905) (-2270.717) [-2260.644] -- 0:01:15
758000 -- (-2253.309) (-2264.214) (-2262.872) [-2263.254] * (-2272.165) (-2262.254) (-2264.094) [-2261.986] -- 0:01:15
758500 -- (-2271.754) (-2270.390) [-2257.971] (-2269.807) * (-2265.324) (-2272.534) (-2265.866) [-2269.677] -- 0:01:15
759000 -- [-2257.526] (-2269.463) (-2266.291) (-2270.084) * [-2260.841] (-2262.618) (-2271.576) (-2275.910) -- 0:01:14
759500 -- (-2259.486) (-2291.652) [-2265.544] (-2265.686) * (-2272.433) [-2267.641] (-2257.857) (-2270.174) -- 0:01:15
760000 -- [-2274.110] (-2280.772) (-2272.733) (-2271.476) * (-2264.329) (-2279.385) (-2253.615) [-2265.260] -- 0:01:14
Average standard deviation of split frequencies: 0.007809
760500 -- (-2275.901) (-2270.978) [-2267.844] (-2268.310) * [-2259.601] (-2262.908) (-2266.292) (-2269.816) -- 0:01:14
761000 -- (-2272.089) [-2267.523] (-2265.980) (-2270.450) * (-2265.001) (-2268.650) (-2261.254) [-2267.383] -- 0:01:14
761500 -- [-2261.304] (-2261.896) (-2266.330) (-2263.373) * (-2283.801) (-2261.260) (-2276.440) [-2265.740] -- 0:01:14
762000 -- (-2265.130) (-2270.415) (-2267.235) [-2260.580] * (-2271.847) (-2277.832) [-2272.501] (-2282.406) -- 0:01:14
762500 -- (-2270.034) (-2267.126) (-2268.365) [-2260.666] * (-2266.812) [-2267.314] (-2269.340) (-2276.579) -- 0:01:13
763000 -- (-2275.629) [-2261.271] (-2262.431) (-2271.855) * (-2267.274) (-2264.365) (-2257.092) [-2266.316] -- 0:01:13
763500 -- [-2268.222] (-2267.723) (-2276.931) (-2273.030) * [-2257.100] (-2286.535) (-2262.624) (-2261.974) -- 0:01:13
764000 -- (-2266.168) [-2266.056] (-2263.086) (-2269.731) * (-2264.977) [-2259.043] (-2269.261) (-2266.317) -- 0:01:13
764500 -- [-2259.931] (-2260.001) (-2263.694) (-2275.116) * (-2276.816) (-2259.813) (-2257.369) [-2269.751] -- 0:01:13
765000 -- (-2280.726) (-2260.102) [-2272.201] (-2271.091) * (-2268.386) [-2262.641] (-2263.099) (-2266.981) -- 0:01:13
Average standard deviation of split frequencies: 0.008616
765500 -- (-2281.071) (-2268.301) (-2267.849) [-2261.658] * (-2266.908) (-2267.369) [-2260.210] (-2266.652) -- 0:01:12
766000 -- (-2272.576) (-2257.267) (-2274.438) [-2256.418] * [-2263.869] (-2264.251) (-2256.361) (-2277.914) -- 0:01:12
766500 -- (-2267.898) [-2262.349] (-2271.512) (-2261.057) * (-2275.383) (-2263.523) (-2266.281) [-2270.924] -- 0:01:12
767000 -- (-2262.515) [-2270.245] (-2260.496) (-2260.573) * (-2266.681) (-2276.373) (-2265.103) [-2266.766] -- 0:01:12
767500 -- (-2270.010) (-2276.782) [-2258.128] (-2265.587) * (-2270.926) (-2273.726) (-2263.875) [-2262.875] -- 0:01:12
768000 -- [-2267.655] (-2267.125) (-2267.305) (-2261.807) * [-2272.456] (-2255.131) (-2268.940) (-2268.900) -- 0:01:12
768500 -- (-2270.377) (-2277.328) [-2266.304] (-2271.420) * (-2264.428) (-2258.790) [-2260.897] (-2261.259) -- 0:01:11
769000 -- (-2261.599) (-2285.761) (-2263.618) [-2267.866] * (-2264.729) (-2271.800) [-2272.054] (-2262.370) -- 0:01:11
769500 -- [-2270.737] (-2264.697) (-2264.114) (-2270.173) * (-2266.733) [-2264.951] (-2274.383) (-2261.742) -- 0:01:11
770000 -- (-2263.542) (-2275.977) (-2273.665) [-2267.377] * (-2260.919) [-2259.600] (-2266.450) (-2260.732) -- 0:01:11
Average standard deviation of split frequencies: 0.008197
770500 -- (-2270.494) (-2269.881) [-2264.486] (-2265.430) * [-2270.712] (-2273.729) (-2263.702) (-2276.343) -- 0:01:11
771000 -- (-2267.307) (-2271.747) (-2260.835) [-2257.721] * (-2273.016) (-2284.219) [-2262.593] (-2264.083) -- 0:01:11
771500 -- [-2270.378] (-2276.034) (-2268.996) (-2264.710) * [-2255.824] (-2264.918) (-2257.950) (-2268.028) -- 0:01:11
772000 -- (-2264.091) (-2263.760) [-2272.442] (-2269.742) * (-2263.529) [-2268.550] (-2270.669) (-2274.764) -- 0:01:10
772500 -- (-2265.176) (-2267.567) (-2270.998) [-2266.262] * (-2259.794) (-2278.110) (-2277.380) [-2268.956] -- 0:01:10
773000 -- (-2263.590) (-2266.602) (-2266.818) [-2266.692] * (-2262.794) (-2280.133) [-2260.225] (-2268.344) -- 0:01:10
773500 -- (-2264.066) [-2268.844] (-2276.240) (-2274.666) * (-2263.383) (-2273.339) [-2261.793] (-2263.060) -- 0:01:10
774000 -- (-2257.282) [-2257.388] (-2266.396) (-2274.353) * (-2269.460) [-2265.443] (-2261.596) (-2268.069) -- 0:01:10
774500 -- [-2265.218] (-2272.085) (-2271.468) (-2276.121) * (-2256.920) (-2277.950) [-2268.120] (-2264.638) -- 0:01:10
775000 -- (-2266.119) (-2257.137) [-2268.283] (-2276.306) * (-2272.688) (-2275.212) (-2267.468) [-2254.507] -- 0:01:09
Average standard deviation of split frequencies: 0.008181
775500 -- (-2263.816) [-2261.742] (-2267.013) (-2270.499) * (-2276.908) (-2265.874) (-2265.076) [-2263.920] -- 0:01:09
776000 -- (-2257.632) (-2270.545) (-2266.086) [-2266.495] * [-2269.467] (-2268.759) (-2262.292) (-2261.856) -- 0:01:09
776500 -- (-2263.472) [-2262.567] (-2270.508) (-2268.963) * (-2285.596) [-2258.529] (-2268.718) (-2268.110) -- 0:01:09
777000 -- (-2267.676) (-2278.784) [-2263.877] (-2254.913) * (-2264.800) [-2271.027] (-2258.690) (-2286.900) -- 0:01:09
777500 -- (-2262.174) (-2268.795) (-2260.638) [-2266.878] * (-2279.038) (-2271.658) [-2261.975] (-2267.789) -- 0:01:09
778000 -- (-2281.696) (-2264.846) (-2260.682) [-2266.678] * (-2268.719) (-2272.191) (-2268.568) [-2263.129] -- 0:01:09
778500 -- (-2260.255) (-2277.965) [-2262.135] (-2287.583) * [-2258.406] (-2273.976) (-2261.324) (-2261.328) -- 0:01:08
779000 -- (-2268.998) (-2273.327) [-2261.067] (-2277.207) * [-2267.174] (-2265.843) (-2263.207) (-2263.143) -- 0:01:08
779500 -- [-2270.386] (-2274.468) (-2269.453) (-2273.530) * (-2259.889) (-2275.581) [-2259.389] (-2272.564) -- 0:01:08
780000 -- (-2266.018) (-2274.265) (-2279.251) [-2262.721] * (-2266.601) [-2263.379] (-2266.550) (-2263.944) -- 0:01:08
Average standard deviation of split frequencies: 0.008575
780500 -- (-2286.383) (-2265.019) [-2266.066] (-2267.855) * (-2271.688) (-2269.133) (-2267.166) [-2264.432] -- 0:01:08
781000 -- (-2285.072) [-2266.609] (-2261.956) (-2273.622) * [-2263.857] (-2268.611) (-2261.295) (-2270.162) -- 0:01:08
781500 -- (-2270.131) [-2255.424] (-2267.477) (-2273.354) * (-2273.642) (-2264.122) [-2268.788] (-2266.644) -- 0:01:07
782000 -- (-2274.110) [-2263.669] (-2273.434) (-2270.667) * (-2265.643) [-2260.216] (-2288.227) (-2261.768) -- 0:01:07
782500 -- (-2256.416) (-2271.015) [-2260.597] (-2266.627) * (-2268.656) [-2264.801] (-2268.670) (-2265.403) -- 0:01:07
783000 -- [-2257.986] (-2264.665) (-2270.592) (-2265.057) * (-2264.712) (-2265.208) [-2267.141] (-2264.758) -- 0:01:07
783500 -- (-2265.973) (-2277.598) (-2274.203) [-2271.266] * (-2265.281) (-2268.155) [-2269.477] (-2265.953) -- 0:01:07
784000 -- (-2272.177) (-2272.632) [-2262.574] (-2278.362) * (-2264.580) (-2274.982) [-2252.603] (-2272.787) -- 0:01:07
784500 -- [-2271.701] (-2270.956) (-2276.145) (-2281.874) * (-2262.104) (-2265.447) [-2263.553] (-2273.525) -- 0:01:07
785000 -- (-2263.551) (-2270.216) (-2276.508) [-2267.936] * (-2267.960) [-2262.665] (-2265.170) (-2267.884) -- 0:01:06
Average standard deviation of split frequencies: 0.009116
785500 -- (-2259.453) (-2273.380) [-2269.899] (-2276.142) * (-2281.770) (-2268.442) [-2258.310] (-2265.326) -- 0:01:06
786000 -- (-2261.599) (-2271.789) [-2273.075] (-2271.260) * (-2273.005) (-2275.481) (-2268.285) [-2261.427] -- 0:01:06
786500 -- (-2266.892) (-2260.247) (-2266.221) [-2268.648] * (-2259.665) (-2271.121) (-2271.356) [-2265.536] -- 0:01:06
787000 -- (-2267.917) (-2271.605) [-2260.456] (-2271.884) * (-2260.905) (-2263.341) (-2266.543) [-2270.641] -- 0:01:06
787500 -- (-2265.965) (-2270.128) [-2264.271] (-2274.780) * (-2267.476) [-2271.580] (-2279.613) (-2268.862) -- 0:01:06
788000 -- [-2267.149] (-2271.998) (-2261.321) (-2268.305) * (-2279.016) (-2278.487) (-2256.057) [-2259.457] -- 0:01:05
788500 -- (-2270.167) [-2260.493] (-2261.493) (-2265.514) * [-2266.852] (-2272.137) (-2266.303) (-2268.438) -- 0:01:05
789000 -- (-2262.351) (-2262.850) [-2254.689] (-2262.117) * (-2264.149) [-2273.267] (-2284.465) (-2277.939) -- 0:01:05
789500 -- (-2263.012) (-2259.724) [-2254.805] (-2282.865) * (-2265.423) [-2262.204] (-2274.596) (-2265.857) -- 0:01:05
790000 -- [-2261.791] (-2265.176) (-2263.446) (-2265.550) * [-2258.159] (-2263.549) (-2282.986) (-2268.935) -- 0:01:05
Average standard deviation of split frequencies: 0.009102
790500 -- (-2258.480) (-2269.960) (-2276.774) [-2264.785] * [-2270.281] (-2267.789) (-2274.677) (-2270.482) -- 0:01:05
791000 -- (-2273.011) (-2269.343) [-2261.538] (-2275.386) * [-2263.812] (-2261.042) (-2271.185) (-2274.074) -- 0:01:04
791500 -- (-2267.002) (-2267.843) (-2272.043) [-2268.455] * (-2269.612) [-2259.193] (-2274.460) (-2266.203) -- 0:01:04
792000 -- [-2263.094] (-2265.900) (-2277.844) (-2259.772) * (-2278.264) (-2279.424) (-2271.059) [-2251.738] -- 0:01:04
792500 -- (-2263.366) (-2268.808) (-2271.239) [-2265.317] * (-2276.592) (-2264.186) (-2263.169) [-2269.038] -- 0:01:04
793000 -- (-2272.151) (-2270.297) [-2261.644] (-2268.096) * (-2271.236) (-2264.807) (-2263.177) [-2260.849] -- 0:01:04
793500 -- (-2280.496) [-2256.529] (-2256.662) (-2272.338) * (-2273.410) (-2273.713) [-2258.421] (-2263.890) -- 0:01:04
794000 -- (-2270.089) (-2268.891) (-2272.181) [-2262.249] * (-2267.988) [-2260.463] (-2266.090) (-2265.591) -- 0:01:03
794500 -- (-2269.540) (-2267.149) [-2264.370] (-2258.907) * (-2268.417) (-2274.005) [-2262.726] (-2269.203) -- 0:01:03
795000 -- (-2290.920) (-2259.008) (-2266.435) [-2264.793] * [-2268.643] (-2269.350) (-2261.178) (-2270.377) -- 0:01:03
Average standard deviation of split frequencies: 0.009041
795500 -- (-2270.029) [-2257.324] (-2263.571) (-2261.121) * (-2261.578) (-2272.564) (-2274.818) [-2265.022] -- 0:01:03
796000 -- (-2268.325) [-2265.102] (-2281.325) (-2274.473) * (-2267.880) (-2267.088) (-2259.999) [-2256.618] -- 0:01:03
796500 -- [-2267.485] (-2277.939) (-2274.559) (-2266.042) * (-2265.829) (-2260.846) [-2264.030] (-2263.042) -- 0:01:03
797000 -- (-2259.433) (-2272.828) [-2262.683] (-2264.855) * (-2263.793) (-2266.129) [-2267.992] (-2276.135) -- 0:01:02
797500 -- (-2261.156) (-2270.180) [-2260.350] (-2267.299) * (-2272.736) (-2265.104) [-2258.671] (-2276.123) -- 0:01:02
798000 -- (-2262.047) [-2257.546] (-2260.991) (-2264.263) * (-2276.207) (-2269.892) (-2270.715) [-2265.672] -- 0:01:02
798500 -- (-2262.654) [-2257.533] (-2282.649) (-2276.600) * (-2259.451) (-2269.563) [-2275.116] (-2270.527) -- 0:01:02
799000 -- (-2267.402) [-2264.904] (-2268.990) (-2269.497) * (-2270.833) [-2265.085] (-2269.975) (-2266.178) -- 0:01:02
799500 -- (-2272.719) (-2266.167) [-2259.942] (-2266.840) * (-2262.214) [-2263.524] (-2266.507) (-2284.592) -- 0:01:02
800000 -- (-2275.687) (-2270.286) [-2265.530] (-2270.495) * [-2265.805] (-2263.949) (-2269.240) (-2282.542) -- 0:01:02
Average standard deviation of split frequencies: 0.009538
800500 -- (-2271.108) (-2273.305) [-2256.602] (-2269.872) * [-2259.282] (-2265.551) (-2272.575) (-2283.698) -- 0:01:01
801000 -- [-2269.566] (-2265.160) (-2274.118) (-2265.867) * (-2268.978) [-2266.737] (-2276.641) (-2268.629) -- 0:01:01
801500 -- (-2275.155) (-2270.158) [-2268.517] (-2261.889) * (-2263.944) [-2264.529] (-2265.157) (-2266.490) -- 0:01:01
802000 -- (-2267.576) (-2256.397) (-2268.448) [-2264.243] * (-2259.029) (-2258.839) [-2266.246] (-2267.568) -- 0:01:01
802500 -- (-2276.410) (-2271.116) (-2263.916) [-2263.161] * [-2261.389] (-2268.091) (-2265.188) (-2261.795) -- 0:01:01
803000 -- [-2266.486] (-2263.989) (-2275.571) (-2270.360) * [-2268.235] (-2281.908) (-2262.759) (-2263.341) -- 0:01:01
803500 -- (-2259.331) [-2270.761] (-2274.684) (-2279.639) * (-2270.000) [-2261.510] (-2264.777) (-2277.649) -- 0:01:00
804000 -- [-2257.340] (-2267.700) (-2282.323) (-2260.637) * (-2273.479) [-2268.457] (-2268.552) (-2268.355) -- 0:01:00
804500 -- (-2273.788) [-2262.280] (-2279.136) (-2265.333) * (-2273.428) (-2273.787) (-2263.755) [-2259.641] -- 0:01:00
805000 -- (-2276.972) [-2260.456] (-2266.919) (-2274.547) * (-2270.785) (-2276.405) (-2274.005) [-2266.028] -- 0:01:00
Average standard deviation of split frequencies: 0.009202
805500 -- (-2259.480) (-2260.219) (-2270.498) [-2262.268] * (-2273.643) (-2272.234) [-2268.229] (-2258.729) -- 0:01:00
806000 -- (-2270.253) (-2274.227) (-2266.036) [-2258.665] * (-2266.160) (-2279.543) (-2266.219) [-2262.660] -- 0:01:00
806500 -- (-2268.070) [-2261.491] (-2273.861) (-2273.210) * (-2274.529) (-2267.114) (-2273.239) [-2261.437] -- 0:00:59
807000 -- (-2268.378) (-2262.916) (-2280.072) [-2264.628] * (-2266.591) (-2268.489) [-2275.346] (-2276.184) -- 0:00:59
807500 -- (-2267.606) [-2259.747] (-2267.680) (-2271.569) * (-2267.709) (-2264.795) [-2257.205] (-2266.221) -- 0:00:59
808000 -- (-2264.044) (-2265.219) [-2268.015] (-2270.981) * [-2264.189] (-2274.965) (-2266.969) (-2282.741) -- 0:00:59
808500 -- (-2270.284) [-2262.919] (-2270.173) (-2275.828) * (-2283.925) (-2264.109) [-2264.772] (-2283.625) -- 0:00:59
809000 -- [-2262.076] (-2259.612) (-2267.902) (-2277.930) * (-2271.694) [-2276.735] (-2265.593) (-2262.956) -- 0:00:59
809500 -- (-2261.908) (-2280.279) [-2261.275] (-2268.637) * (-2273.823) (-2259.990) (-2259.453) [-2267.771] -- 0:00:59
810000 -- (-2266.772) [-2264.046] (-2262.911) (-2261.862) * (-2267.962) (-2263.480) [-2268.912] (-2278.613) -- 0:00:58
Average standard deviation of split frequencies: 0.008645
810500 -- (-2262.653) (-2275.011) [-2264.657] (-2268.064) * [-2268.346] (-2267.301) (-2259.310) (-2272.202) -- 0:00:58
811000 -- [-2258.517] (-2267.238) (-2278.169) (-2277.160) * (-2263.780) (-2262.485) [-2269.313] (-2260.257) -- 0:00:58
811500 -- [-2262.765] (-2274.019) (-2265.235) (-2274.655) * (-2267.233) (-2274.218) [-2263.604] (-2267.758) -- 0:00:58
812000 -- [-2265.785] (-2279.167) (-2271.081) (-2265.234) * (-2264.250) [-2269.744] (-2261.023) (-2282.217) -- 0:00:58
812500 -- (-2258.800) (-2277.187) [-2265.459] (-2270.472) * (-2271.879) (-2273.009) [-2264.019] (-2269.359) -- 0:00:58
813000 -- [-2257.814] (-2272.146) (-2261.306) (-2259.284) * (-2266.360) [-2275.483] (-2262.532) (-2273.723) -- 0:00:57
813500 -- (-2264.219) (-2268.186) [-2263.735] (-2258.524) * [-2263.305] (-2267.137) (-2273.174) (-2267.332) -- 0:00:57
814000 -- [-2264.782] (-2285.818) (-2265.862) (-2262.800) * (-2263.940) [-2264.875] (-2261.042) (-2264.095) -- 0:00:57
814500 -- (-2264.494) (-2268.495) [-2263.314] (-2267.742) * (-2273.634) (-2269.808) [-2265.219] (-2270.920) -- 0:00:57
815000 -- (-2264.317) [-2264.930] (-2276.615) (-2270.196) * [-2264.096] (-2267.615) (-2270.888) (-2263.887) -- 0:00:57
Average standard deviation of split frequencies: 0.009051
815500 -- (-2271.434) [-2263.701] (-2268.402) (-2262.916) * (-2259.158) (-2270.110) [-2265.390] (-2256.674) -- 0:00:57
816000 -- (-2265.719) [-2266.459] (-2272.534) (-2268.250) * (-2269.007) (-2275.502) (-2263.830) [-2276.574] -- 0:00:56
816500 -- [-2258.735] (-2268.155) (-2263.073) (-2266.734) * (-2266.609) (-2273.121) (-2268.912) [-2260.108] -- 0:00:56
817000 -- (-2263.421) [-2259.711] (-2273.512) (-2257.936) * (-2270.709) [-2263.008] (-2274.206) (-2262.309) -- 0:00:56
817500 -- (-2260.969) (-2267.209) (-2267.371) [-2260.634] * [-2255.142] (-2281.233) (-2273.472) (-2260.272) -- 0:00:56
818000 -- (-2271.055) (-2262.708) (-2272.108) [-2265.010] * (-2269.542) (-2268.603) (-2273.334) [-2268.430] -- 0:00:56
818500 -- (-2264.742) (-2270.054) [-2254.110] (-2266.041) * (-2273.058) [-2260.026] (-2267.612) (-2272.120) -- 0:00:56
819000 -- (-2259.141) (-2273.665) [-2258.366] (-2279.099) * [-2266.980] (-2263.422) (-2268.931) (-2280.356) -- 0:00:55
819500 -- [-2263.464] (-2264.361) (-2264.551) (-2277.643) * [-2260.250] (-2269.896) (-2270.726) (-2263.134) -- 0:00:55
820000 -- [-2257.945] (-2267.461) (-2268.232) (-2271.764) * (-2282.440) (-2263.032) (-2270.967) [-2254.066] -- 0:00:55
Average standard deviation of split frequencies: 0.009459
820500 -- (-2255.429) (-2262.981) (-2269.033) [-2260.377] * (-2269.242) (-2261.824) (-2264.280) [-2262.412] -- 0:00:55
821000 -- (-2253.631) (-2276.374) [-2274.836] (-2268.875) * (-2281.172) (-2267.220) [-2262.291] (-2267.609) -- 0:00:55
821500 -- (-2262.044) [-2261.389] (-2265.019) (-2270.890) * (-2266.526) (-2263.902) [-2262.888] (-2263.453) -- 0:00:55
822000 -- (-2269.872) [-2267.196] (-2269.356) (-2268.711) * (-2268.550) (-2269.931) (-2262.105) [-2266.747] -- 0:00:55
822500 -- [-2265.279] (-2266.953) (-2274.033) (-2269.104) * (-2259.663) (-2282.837) [-2258.357] (-2266.232) -- 0:00:54
823000 -- (-2268.168) (-2281.985) [-2261.708] (-2264.568) * (-2262.041) [-2275.096] (-2269.179) (-2268.963) -- 0:00:54
823500 -- (-2267.190) [-2270.349] (-2280.112) (-2258.503) * (-2267.413) (-2273.859) [-2265.266] (-2265.444) -- 0:00:54
824000 -- (-2268.225) (-2263.874) (-2273.157) [-2269.887] * (-2261.793) (-2266.591) [-2270.413] (-2279.335) -- 0:00:54
824500 -- (-2265.115) (-2265.053) [-2260.304] (-2266.127) * (-2259.630) (-2290.115) [-2263.448] (-2264.021) -- 0:00:54
825000 -- (-2262.544) [-2270.426] (-2265.276) (-2271.062) * [-2257.827] (-2277.744) (-2271.367) (-2276.796) -- 0:00:54
Average standard deviation of split frequencies: 0.009740
825500 -- [-2258.826] (-2263.932) (-2264.503) (-2266.536) * (-2274.600) (-2283.002) (-2262.943) [-2263.184] -- 0:00:53
826000 -- (-2265.740) [-2262.119] (-2258.966) (-2288.369) * (-2262.244) (-2263.546) (-2259.439) [-2263.496] -- 0:00:53
826500 -- (-2263.571) (-2264.636) (-2273.028) [-2272.050] * [-2261.879] (-2262.566) (-2264.303) (-2268.981) -- 0:00:53
827000 -- (-2266.510) (-2272.657) [-2265.142] (-2276.919) * (-2270.865) [-2259.811] (-2263.351) (-2268.547) -- 0:00:53
827500 -- (-2269.359) [-2262.691] (-2269.855) (-2268.128) * [-2269.811] (-2265.396) (-2263.625) (-2266.411) -- 0:00:53
828000 -- (-2273.345) [-2264.479] (-2272.877) (-2265.054) * [-2263.610] (-2266.512) (-2272.353) (-2267.339) -- 0:00:53
828500 -- (-2264.696) (-2268.947) [-2268.643] (-2264.448) * (-2270.799) [-2266.274] (-2279.164) (-2267.238) -- 0:00:52
829000 -- (-2265.580) (-2280.861) (-2264.485) [-2256.236] * [-2264.256] (-2269.590) (-2276.185) (-2265.800) -- 0:00:52
829500 -- (-2269.442) (-2286.299) [-2268.818] (-2267.126) * (-2268.687) [-2260.591] (-2270.360) (-2266.702) -- 0:00:52
830000 -- [-2258.483] (-2264.193) (-2265.997) (-2265.284) * (-2273.576) (-2277.048) [-2264.940] (-2261.965) -- 0:00:52
Average standard deviation of split frequencies: 0.010139
830500 -- [-2262.845] (-2272.005) (-2259.903) (-2279.535) * (-2278.733) (-2270.330) (-2273.330) [-2261.858] -- 0:00:52
831000 -- (-2261.148) [-2264.843] (-2262.451) (-2260.027) * [-2260.482] (-2268.644) (-2269.860) (-2264.873) -- 0:00:52
831500 -- (-2259.415) [-2265.728] (-2269.256) (-2261.182) * (-2266.208) (-2259.894) [-2250.949] (-2263.206) -- 0:00:52
832000 -- (-2268.004) (-2274.837) [-2265.436] (-2264.098) * (-2268.686) (-2273.209) [-2261.393] (-2262.314) -- 0:00:51
832500 -- (-2274.914) (-2263.363) [-2268.100] (-2268.749) * [-2263.340] (-2270.420) (-2269.863) (-2267.323) -- 0:00:51
833000 -- (-2264.676) (-2261.930) (-2279.839) [-2261.879] * (-2260.113) [-2267.913] (-2260.205) (-2272.399) -- 0:00:51
833500 -- [-2269.436] (-2266.121) (-2270.882) (-2265.768) * [-2272.288] (-2260.319) (-2270.840) (-2278.697) -- 0:00:51
834000 -- (-2274.440) [-2261.141] (-2269.213) (-2273.594) * (-2265.806) (-2266.737) [-2264.496] (-2269.082) -- 0:00:51
834500 -- (-2261.747) [-2259.442] (-2271.145) (-2268.470) * [-2259.909] (-2267.540) (-2269.070) (-2268.738) -- 0:00:51
835000 -- [-2264.720] (-2267.089) (-2277.113) (-2257.964) * (-2270.805) (-2266.814) [-2273.456] (-2273.093) -- 0:00:50
Average standard deviation of split frequencies: 0.010563
835500 -- [-2263.129] (-2258.372) (-2262.151) (-2271.374) * [-2265.079] (-2267.161) (-2268.655) (-2269.474) -- 0:00:50
836000 -- (-2261.319) [-2266.885] (-2286.009) (-2262.157) * [-2264.407] (-2267.203) (-2269.183) (-2269.900) -- 0:00:50
836500 -- [-2265.210] (-2269.189) (-2270.569) (-2267.782) * (-2277.767) [-2267.704] (-2266.431) (-2267.066) -- 0:00:50
837000 -- (-2264.390) (-2266.661) [-2269.756] (-2278.911) * (-2276.273) [-2266.767] (-2266.312) (-2269.253) -- 0:00:50
837500 -- [-2258.399] (-2259.818) (-2260.913) (-2269.885) * (-2269.682) (-2269.925) (-2273.141) [-2263.342] -- 0:00:50
838000 -- [-2263.205] (-2275.597) (-2269.327) (-2268.998) * (-2267.191) [-2257.797] (-2264.640) (-2268.262) -- 0:00:50
838500 -- (-2269.514) (-2272.724) [-2259.261] (-2267.981) * [-2266.383] (-2279.347) (-2277.075) (-2263.847) -- 0:00:49
839000 -- (-2283.138) (-2267.004) [-2261.416] (-2265.279) * [-2263.074] (-2271.438) (-2257.065) (-2257.235) -- 0:00:49
839500 -- [-2263.965] (-2277.718) (-2269.353) (-2268.049) * [-2261.355] (-2268.584) (-2275.066) (-2263.125) -- 0:00:49
840000 -- (-2262.359) (-2274.786) (-2265.066) [-2265.713] * (-2276.137) (-2274.268) [-2257.402] (-2271.257) -- 0:00:49
Average standard deviation of split frequencies: 0.010056
840500 -- (-2267.464) (-2269.599) (-2262.936) [-2266.114] * (-2286.799) (-2268.928) [-2262.966] (-2265.154) -- 0:00:49
841000 -- [-2266.939] (-2267.386) (-2274.168) (-2264.090) * (-2268.709) (-2278.224) (-2267.667) [-2262.677] -- 0:00:49
841500 -- (-2266.859) (-2269.156) (-2277.926) [-2266.989] * (-2280.627) [-2275.950] (-2259.863) (-2266.996) -- 0:00:48
842000 -- (-2270.560) (-2265.881) [-2267.157] (-2278.226) * (-2260.723) [-2262.880] (-2265.833) (-2262.263) -- 0:00:48
842500 -- [-2264.570] (-2259.135) (-2275.223) (-2277.348) * (-2268.146) (-2280.152) [-2267.079] (-2283.398) -- 0:00:48
843000 -- (-2261.285) (-2263.603) [-2262.521] (-2279.048) * (-2269.262) (-2258.525) (-2273.516) [-2263.121] -- 0:00:48
843500 -- (-2274.758) [-2268.005] (-2265.616) (-2280.843) * (-2270.423) [-2267.677] (-2275.806) (-2275.053) -- 0:00:48
844000 -- (-2263.684) [-2264.147] (-2265.175) (-2278.521) * (-2275.172) (-2268.079) [-2263.462] (-2262.443) -- 0:00:48
844500 -- (-2270.571) [-2266.796] (-2257.233) (-2267.090) * (-2275.659) (-2263.471) [-2276.785] (-2276.418) -- 0:00:48
845000 -- (-2266.562) (-2263.201) (-2257.272) [-2261.817] * (-2263.505) (-2265.393) [-2264.712] (-2276.565) -- 0:00:47
Average standard deviation of split frequencies: 0.009398
845500 -- (-2270.988) (-2266.495) [-2256.388] (-2272.034) * (-2271.817) (-2264.517) [-2269.431] (-2278.191) -- 0:00:47
846000 -- (-2259.887) (-2285.776) [-2263.415] (-2265.744) * [-2264.720] (-2277.522) (-2272.830) (-2264.061) -- 0:00:47
846500 -- (-2262.181) (-2284.322) [-2274.323] (-2273.734) * (-2266.233) [-2263.501] (-2277.885) (-2269.892) -- 0:00:47
847000 -- (-2265.571) (-2275.636) (-2269.946) [-2260.524] * (-2277.510) (-2270.689) (-2272.310) [-2260.591] -- 0:00:47
847500 -- [-2268.522] (-2274.360) (-2260.489) (-2271.331) * [-2277.015] (-2258.715) (-2279.140) (-2263.043) -- 0:00:47
848000 -- [-2262.985] (-2261.121) (-2264.031) (-2262.444) * (-2266.825) [-2263.023] (-2269.699) (-2264.406) -- 0:00:46
848500 -- (-2263.004) [-2265.178] (-2266.777) (-2267.281) * (-2262.116) (-2266.126) [-2262.537] (-2287.640) -- 0:00:46
849000 -- (-2279.334) (-2262.483) (-2260.968) [-2262.519] * (-2258.709) (-2270.536) (-2269.129) [-2262.568] -- 0:00:46
849500 -- (-2274.492) (-2265.218) (-2264.944) [-2266.631] * (-2271.387) (-2280.052) [-2257.837] (-2269.025) -- 0:00:46
850000 -- (-2269.243) (-2272.030) [-2266.295] (-2261.776) * (-2264.141) (-2264.085) (-2269.298) [-2261.399] -- 0:00:46
Average standard deviation of split frequencies: 0.009014
850500 -- (-2272.785) (-2269.150) (-2258.903) [-2267.240] * (-2260.638) [-2255.934] (-2266.310) (-2270.295) -- 0:00:46
851000 -- (-2275.918) (-2268.904) [-2263.096] (-2266.716) * [-2262.606] (-2271.394) (-2274.043) (-2258.288) -- 0:00:46
851500 -- [-2264.552] (-2261.951) (-2261.030) (-2263.748) * [-2253.790] (-2261.731) (-2264.098) (-2264.870) -- 0:00:45
852000 -- (-2276.211) (-2268.579) (-2260.107) [-2262.867] * [-2264.816] (-2264.796) (-2266.152) (-2266.835) -- 0:00:45
852500 -- (-2274.190) (-2264.335) (-2262.277) [-2257.078] * (-2275.062) (-2261.763) (-2269.865) [-2265.665] -- 0:00:45
853000 -- (-2278.907) [-2268.621] (-2258.160) (-2267.194) * (-2260.815) [-2257.846] (-2266.151) (-2276.082) -- 0:00:45
853500 -- (-2270.759) (-2271.764) [-2258.397] (-2264.318) * (-2266.474) (-2258.011) [-2259.822] (-2274.114) -- 0:00:45
854000 -- (-2272.855) (-2276.396) [-2262.290] (-2265.171) * [-2257.288] (-2261.174) (-2275.280) (-2269.405) -- 0:00:45
854500 -- (-2259.442) (-2273.605) [-2265.480] (-2271.082) * (-2265.221) [-2258.653] (-2285.169) (-2266.445) -- 0:00:44
855000 -- [-2264.662] (-2275.794) (-2275.860) (-2262.080) * [-2260.709] (-2259.710) (-2267.978) (-2258.443) -- 0:00:44
Average standard deviation of split frequencies: 0.008481
855500 -- (-2266.541) (-2265.839) (-2275.932) [-2259.597] * (-2258.467) (-2270.070) [-2261.796] (-2260.822) -- 0:00:44
856000 -- (-2268.343) (-2281.776) (-2276.165) [-2264.253] * [-2259.574] (-2275.891) (-2266.643) (-2259.245) -- 0:00:44
856500 -- (-2267.008) (-2272.886) (-2270.343) [-2260.302] * [-2264.820] (-2266.061) (-2267.844) (-2266.216) -- 0:00:44
857000 -- [-2266.053] (-2261.685) (-2277.490) (-2261.143) * (-2256.001) (-2278.764) (-2264.806) [-2270.241] -- 0:00:44
857500 -- (-2271.176) (-2257.681) [-2259.794] (-2269.342) * (-2263.200) (-2273.782) (-2278.615) [-2282.035] -- 0:00:44
858000 -- (-2266.171) (-2270.909) [-2261.045] (-2261.732) * (-2254.957) (-2263.552) [-2258.991] (-2272.096) -- 0:00:43
858500 -- (-2275.825) (-2263.624) (-2279.575) [-2262.883] * (-2276.784) (-2260.497) (-2276.394) [-2259.300] -- 0:00:43
859000 -- (-2269.733) (-2266.517) (-2270.134) [-2262.017] * (-2283.032) [-2257.027] (-2257.658) (-2276.629) -- 0:00:43
859500 -- (-2275.510) [-2260.651] (-2271.180) (-2268.365) * (-2263.614) [-2270.191] (-2263.550) (-2269.674) -- 0:00:43
860000 -- (-2266.839) (-2269.621) [-2270.354] (-2274.719) * (-2262.146) (-2268.525) [-2264.867] (-2278.387) -- 0:00:43
Average standard deviation of split frequencies: 0.009165
860500 -- [-2263.867] (-2269.137) (-2266.142) (-2274.679) * (-2284.577) [-2262.359] (-2268.898) (-2267.223) -- 0:00:43
861000 -- (-2274.012) (-2272.288) [-2263.212] (-2279.642) * (-2260.685) (-2265.888) [-2268.942] (-2263.517) -- 0:00:42
861500 -- [-2267.993] (-2270.976) (-2261.015) (-2276.126) * (-2268.968) (-2261.566) [-2262.476] (-2273.043) -- 0:00:42
862000 -- (-2273.726) (-2285.415) (-2264.542) [-2260.344] * (-2259.451) (-2268.666) [-2261.829] (-2270.493) -- 0:00:42
862500 -- (-2265.362) (-2277.257) [-2265.373] (-2259.832) * (-2264.821) (-2261.504) [-2273.473] (-2259.777) -- 0:00:42
863000 -- (-2270.790) (-2265.774) [-2261.544] (-2266.940) * (-2261.896) (-2285.410) (-2275.950) [-2262.255] -- 0:00:42
863500 -- (-2266.155) (-2276.303) (-2272.977) [-2262.136] * (-2269.851) (-2267.759) [-2269.868] (-2267.885) -- 0:00:42
864000 -- (-2269.390) (-2255.942) [-2269.615] (-2262.055) * (-2272.007) (-2260.761) (-2281.179) [-2263.733] -- 0:00:42
864500 -- [-2288.705] (-2275.537) (-2268.296) (-2266.960) * (-2267.774) (-2263.701) (-2264.893) [-2257.838] -- 0:00:41
865000 -- (-2271.759) (-2277.236) [-2267.229] (-2262.318) * (-2270.140) (-2270.387) (-2269.121) [-2271.711] -- 0:00:41
Average standard deviation of split frequencies: 0.009254
865500 -- (-2259.629) (-2269.648) [-2264.684] (-2265.814) * [-2263.385] (-2271.407) (-2268.154) (-2279.769) -- 0:00:41
866000 -- (-2280.150) (-2265.365) (-2256.777) [-2257.847] * (-2269.762) [-2265.178] (-2280.650) (-2265.766) -- 0:00:41
866500 -- (-2265.193) (-2274.358) [-2259.978] (-2260.722) * (-2267.255) (-2271.223) (-2253.500) [-2261.626] -- 0:00:41
867000 -- (-2267.596) (-2267.946) (-2265.557) [-2267.291] * [-2266.383] (-2264.222) (-2264.401) (-2269.963) -- 0:00:41
867500 -- (-2269.863) [-2271.583] (-2272.361) (-2263.935) * (-2265.461) [-2256.062] (-2268.096) (-2273.706) -- 0:00:40
868000 -- (-2270.020) [-2273.458] (-2274.382) (-2270.543) * (-2271.629) (-2264.764) (-2263.700) [-2259.252] -- 0:00:40
868500 -- [-2259.611] (-2262.419) (-2287.739) (-2272.190) * (-2263.109) (-2264.359) [-2259.851] (-2261.111) -- 0:00:40
869000 -- (-2260.832) (-2270.165) (-2272.029) [-2268.044] * (-2270.687) (-2269.873) [-2264.851] (-2264.633) -- 0:00:40
869500 -- (-2265.778) [-2264.168] (-2274.651) (-2260.991) * [-2263.743] (-2266.603) (-2266.849) (-2264.430) -- 0:00:40
870000 -- (-2264.995) [-2259.531] (-2283.014) (-2274.235) * (-2278.271) [-2272.977] (-2260.386) (-2267.991) -- 0:00:40
Average standard deviation of split frequencies: 0.008988
870500 -- [-2263.661] (-2270.621) (-2271.075) (-2275.583) * (-2263.617) (-2266.521) [-2257.115] (-2282.848) -- 0:00:40
871000 -- [-2262.599] (-2279.963) (-2280.449) (-2264.047) * (-2275.392) (-2277.207) (-2265.204) [-2256.796] -- 0:00:39
871500 -- (-2269.975) [-2263.046] (-2265.607) (-2266.974) * (-2271.660) (-2264.572) (-2270.938) [-2264.161] -- 0:00:39
872000 -- [-2262.252] (-2266.703) (-2269.658) (-2269.652) * (-2274.102) (-2275.265) (-2259.595) [-2262.434] -- 0:00:39
872500 -- [-2269.683] (-2264.439) (-2269.254) (-2275.046) * (-2275.029) [-2264.752] (-2278.700) (-2271.149) -- 0:00:39
873000 -- (-2266.550) (-2258.063) (-2271.404) [-2263.611] * (-2264.005) [-2266.551] (-2273.744) (-2266.435) -- 0:00:39
873500 -- (-2265.581) (-2266.604) (-2265.999) [-2264.717] * (-2256.626) (-2262.319) [-2263.813] (-2267.365) -- 0:00:38
874000 -- [-2263.169] (-2257.545) (-2262.236) (-2295.983) * (-2272.951) (-2282.368) [-2259.231] (-2261.816) -- 0:00:38
874500 -- (-2267.329) (-2274.346) (-2261.191) [-2264.623] * (-2274.588) [-2265.407] (-2272.935) (-2268.434) -- 0:00:38
875000 -- [-2268.349] (-2268.342) (-2267.025) (-2264.443) * (-2276.548) (-2277.775) [-2274.802] (-2274.456) -- 0:00:38
Average standard deviation of split frequencies: 0.008467
875500 -- [-2258.146] (-2261.401) (-2261.479) (-2275.932) * [-2261.910] (-2260.940) (-2264.665) (-2264.720) -- 0:00:38
876000 -- (-2271.412) (-2272.483) [-2263.579] (-2259.479) * (-2259.948) (-2275.897) (-2261.652) [-2261.057] -- 0:00:38
876500 -- [-2263.658] (-2262.205) (-2274.508) (-2269.458) * (-2266.110) (-2265.369) [-2257.975] (-2270.841) -- 0:00:38
877000 -- [-2269.001] (-2265.366) (-2274.426) (-2269.269) * (-2272.035) [-2263.280] (-2262.970) (-2266.710) -- 0:00:37
877500 -- [-2269.179] (-2277.435) (-2274.881) (-2259.444) * (-2267.465) (-2257.184) [-2266.750] (-2271.699) -- 0:00:37
878000 -- (-2267.810) [-2255.861] (-2264.082) (-2265.573) * (-2267.238) [-2276.654] (-2264.447) (-2260.344) -- 0:00:37
878500 -- (-2271.120) (-2275.399) [-2261.215] (-2260.501) * (-2270.036) (-2269.277) (-2271.421) [-2257.647] -- 0:00:37
879000 -- (-2277.966) [-2270.391] (-2260.969) (-2268.926) * (-2276.121) [-2273.675] (-2268.632) (-2263.841) -- 0:00:37
879500 -- (-2263.848) (-2260.523) [-2260.255] (-2272.674) * (-2268.571) (-2264.941) [-2258.107] (-2271.902) -- 0:00:37
880000 -- (-2258.878) (-2270.334) (-2265.761) [-2258.905] * [-2259.491] (-2274.638) (-2260.718) (-2275.289) -- 0:00:36
Average standard deviation of split frequencies: 0.008386
880500 -- (-2281.844) [-2260.214] (-2270.592) (-2261.738) * [-2262.557] (-2265.941) (-2269.542) (-2268.662) -- 0:00:36
881000 -- (-2268.573) [-2265.799] (-2270.040) (-2259.981) * [-2260.120] (-2264.221) (-2277.995) (-2270.036) -- 0:00:36
881500 -- (-2265.717) (-2256.719) (-2262.039) [-2257.599] * (-2271.011) [-2263.644] (-2268.779) (-2261.237) -- 0:00:36
882000 -- [-2261.054] (-2268.387) (-2275.113) (-2258.100) * (-2261.174) (-2269.060) (-2272.808) [-2261.855] -- 0:00:36
882500 -- (-2264.664) (-2264.030) (-2267.944) [-2260.058] * (-2269.740) (-2259.657) [-2262.505] (-2273.313) -- 0:00:36
883000 -- (-2272.216) (-2264.083) (-2265.250) [-2262.335] * (-2269.359) (-2268.149) [-2272.910] (-2279.630) -- 0:00:36
883500 -- (-2272.261) (-2269.290) [-2259.520] (-2261.641) * [-2271.961] (-2269.026) (-2264.695) (-2267.017) -- 0:00:35
884000 -- (-2269.577) (-2280.468) (-2271.247) [-2262.254] * (-2268.503) (-2272.211) (-2266.875) [-2263.627] -- 0:00:35
884500 -- (-2281.566) (-2261.176) [-2267.971] (-2271.666) * [-2261.479] (-2282.615) (-2265.347) (-2274.072) -- 0:00:35
885000 -- (-2271.659) (-2263.312) (-2266.556) [-2266.608] * (-2262.368) (-2283.956) [-2262.097] (-2269.906) -- 0:00:35
Average standard deviation of split frequencies: 0.008194
885500 -- (-2271.800) (-2277.810) [-2261.833] (-2260.335) * (-2266.513) [-2265.957] (-2258.436) (-2271.815) -- 0:00:35
886000 -- (-2277.789) (-2283.844) (-2263.477) [-2259.378] * (-2265.215) (-2259.875) (-2261.254) [-2273.596] -- 0:00:35
886500 -- (-2266.127) [-2265.708] (-2262.976) (-2280.300) * (-2262.144) [-2260.394] (-2260.391) (-2280.091) -- 0:00:34
887000 -- [-2261.408] (-2267.562) (-2269.241) (-2265.625) * (-2261.049) (-2275.524) [-2261.552] (-2272.666) -- 0:00:34
887500 -- (-2271.285) (-2273.744) (-2270.341) [-2256.182] * (-2265.080) (-2265.229) (-2269.050) [-2254.536] -- 0:00:34
888000 -- (-2280.622) [-2259.954] (-2269.267) (-2270.385) * (-2263.658) (-2265.035) [-2265.363] (-2273.149) -- 0:00:34
888500 -- [-2267.277] (-2266.148) (-2281.548) (-2260.319) * (-2263.331) (-2272.898) [-2265.973] (-2260.735) -- 0:00:34
889000 -- [-2268.012] (-2275.823) (-2276.200) (-2268.903) * (-2261.343) (-2273.531) [-2259.399] (-2260.447) -- 0:00:34
889500 -- (-2284.595) (-2270.195) (-2269.199) [-2269.573] * (-2259.918) (-2280.783) [-2259.739] (-2274.331) -- 0:00:34
890000 -- (-2265.949) [-2261.241] (-2264.427) (-2272.600) * (-2269.659) (-2265.945) (-2267.521) [-2260.293] -- 0:00:33
Average standard deviation of split frequencies: 0.008045
890500 -- (-2293.492) (-2266.943) [-2262.752] (-2273.121) * (-2270.585) [-2259.249] (-2260.479) (-2268.633) -- 0:00:33
891000 -- (-2266.324) (-2263.336) (-2276.521) [-2257.437] * (-2261.476) (-2266.031) [-2262.143] (-2279.285) -- 0:00:33
891500 -- (-2271.976) (-2268.641) [-2269.068] (-2268.327) * (-2269.176) [-2261.171] (-2261.864) (-2270.215) -- 0:00:33
892000 -- (-2267.221) (-2273.927) (-2256.478) [-2253.967] * (-2284.318) (-2265.249) [-2263.579] (-2269.517) -- 0:00:33
892500 -- (-2268.243) (-2264.189) [-2263.015] (-2265.717) * (-2283.150) (-2267.041) [-2258.197] (-2281.385) -- 0:00:33
893000 -- (-2262.756) [-2263.818] (-2262.857) (-2264.336) * (-2269.201) (-2277.819) (-2262.360) [-2257.895] -- 0:00:32
893500 -- [-2257.907] (-2268.629) (-2263.402) (-2270.616) * (-2275.186) (-2272.764) [-2258.569] (-2257.701) -- 0:00:32
894000 -- (-2264.878) (-2265.535) (-2261.663) [-2266.339] * (-2268.562) (-2265.548) [-2265.119] (-2273.662) -- 0:00:32
894500 -- [-2265.980] (-2262.693) (-2267.584) (-2278.435) * (-2277.233) (-2266.753) (-2280.198) [-2264.416] -- 0:00:32
895000 -- [-2258.701] (-2259.526) (-2272.732) (-2272.515) * (-2268.173) [-2267.209] (-2278.898) (-2264.828) -- 0:00:32
Average standard deviation of split frequencies: 0.007366
895500 -- (-2261.121) [-2265.014] (-2262.694) (-2268.347) * (-2269.402) (-2273.508) (-2263.410) [-2263.532] -- 0:00:32
896000 -- [-2264.780] (-2269.000) (-2268.277) (-2267.099) * (-2274.949) (-2271.078) (-2261.847) [-2259.737] -- 0:00:32
896500 -- [-2265.828] (-2266.646) (-2292.109) (-2270.767) * [-2267.288] (-2266.794) (-2266.307) (-2266.352) -- 0:00:31
897000 -- (-2261.486) (-2265.893) [-2264.285] (-2277.989) * [-2261.753] (-2264.009) (-2254.399) (-2277.192) -- 0:00:31
897500 -- (-2259.155) [-2266.127] (-2280.207) (-2279.046) * (-2260.365) (-2281.010) (-2265.021) [-2265.131] -- 0:00:31
898000 -- (-2263.786) (-2262.858) [-2274.230] (-2262.135) * [-2269.020] (-2264.536) (-2269.013) (-2283.338) -- 0:00:31
898500 -- (-2260.383) (-2273.089) (-2267.908) [-2266.223] * (-2286.291) (-2267.608) [-2273.436] (-2274.626) -- 0:00:31
899000 -- (-2260.382) (-2263.289) [-2275.305] (-2259.049) * (-2273.761) (-2265.760) [-2262.923] (-2278.412) -- 0:00:31
899500 -- (-2274.433) [-2258.998] (-2273.645) (-2266.636) * (-2271.769) (-2267.029) [-2260.003] (-2284.771) -- 0:00:30
900000 -- [-2260.057] (-2268.083) (-2274.899) (-2259.146) * (-2266.780) (-2271.158) (-2268.566) [-2263.497] -- 0:00:30
Average standard deviation of split frequencies: 0.007990
900500 -- (-2262.428) (-2263.272) [-2258.355] (-2269.429) * [-2259.656] (-2273.156) (-2257.751) (-2266.654) -- 0:00:30
901000 -- (-2266.876) (-2268.169) (-2272.343) [-2266.063] * (-2268.810) (-2281.720) [-2254.108] (-2268.197) -- 0:00:30
901500 -- (-2266.582) (-2258.202) [-2265.189] (-2263.909) * (-2276.271) (-2259.855) (-2283.273) [-2259.711] -- 0:00:30
902000 -- (-2275.761) (-2266.647) (-2258.383) [-2257.458] * [-2259.531] (-2269.906) (-2255.430) (-2274.180) -- 0:00:30
902500 -- (-2264.566) [-2265.054] (-2269.183) (-2264.091) * (-2283.624) (-2268.697) (-2283.746) [-2262.776] -- 0:00:30
903000 -- [-2267.281] (-2258.568) (-2266.892) (-2275.862) * (-2264.817) [-2266.937] (-2258.530) (-2267.645) -- 0:00:29
903500 -- (-2261.313) [-2264.965] (-2273.605) (-2275.488) * (-2275.024) [-2261.327] (-2278.104) (-2266.279) -- 0:00:29
904000 -- (-2274.296) (-2261.750) [-2262.748] (-2277.634) * (-2271.060) (-2275.416) (-2265.337) [-2255.550] -- 0:00:29
904500 -- (-2258.653) [-2259.877] (-2280.248) (-2265.400) * [-2264.282] (-2266.016) (-2263.077) (-2263.695) -- 0:00:29
905000 -- [-2258.119] (-2270.521) (-2281.962) (-2273.994) * [-2261.149] (-2262.258) (-2261.991) (-2263.169) -- 0:00:29
Average standard deviation of split frequencies: 0.008186
905500 -- (-2270.391) [-2263.085] (-2277.865) (-2270.992) * (-2269.893) (-2256.427) (-2267.304) [-2267.788] -- 0:00:29
906000 -- (-2265.899) [-2257.563] (-2256.657) (-2266.633) * [-2262.264] (-2265.141) (-2271.147) (-2261.996) -- 0:00:28
906500 -- (-2271.958) (-2273.461) [-2262.803] (-2259.406) * (-2263.841) (-2274.336) [-2262.947] (-2265.915) -- 0:00:28
907000 -- (-2270.836) [-2266.765] (-2278.346) (-2268.371) * (-2259.024) [-2272.070] (-2269.054) (-2272.044) -- 0:00:28
907500 -- (-2262.337) (-2270.680) (-2266.252) [-2264.143] * (-2265.215) (-2266.112) [-2258.139] (-2267.079) -- 0:00:28
908000 -- (-2273.086) (-2266.110) [-2277.083] (-2266.081) * (-2265.642) (-2280.601) [-2254.342] (-2259.766) -- 0:00:28
908500 -- (-2284.600) (-2268.791) [-2265.500] (-2266.885) * (-2271.266) (-2263.421) [-2261.016] (-2266.706) -- 0:00:28
909000 -- (-2272.338) (-2255.783) [-2275.413] (-2271.296) * (-2266.343) [-2263.728] (-2265.854) (-2271.195) -- 0:00:27
909500 -- [-2275.001] (-2266.415) (-2267.074) (-2269.432) * (-2265.674) (-2265.552) (-2272.412) [-2266.015] -- 0:00:27
910000 -- (-2274.878) (-2269.570) [-2270.074] (-2277.017) * (-2277.790) (-2265.297) [-2263.263] (-2278.101) -- 0:00:27
Average standard deviation of split frequencies: 0.007868
910500 -- (-2266.057) (-2267.526) [-2277.205] (-2270.814) * [-2258.214] (-2262.845) (-2266.107) (-2269.828) -- 0:00:27
911000 -- (-2265.975) (-2278.263) (-2274.759) [-2260.523] * [-2260.228] (-2272.916) (-2273.644) (-2266.386) -- 0:00:27
911500 -- (-2269.411) (-2271.070) (-2271.287) [-2262.922] * (-2263.708) (-2276.051) [-2270.759] (-2269.350) -- 0:00:27
912000 -- (-2274.526) (-2266.461) (-2265.972) [-2261.097] * (-2259.126) [-2265.812] (-2272.863) (-2265.711) -- 0:00:27
912500 -- [-2269.039] (-2264.810) (-2265.706) (-2265.248) * [-2259.959] (-2269.956) (-2263.039) (-2266.929) -- 0:00:26
913000 -- [-2269.470] (-2268.918) (-2279.023) (-2281.482) * (-2262.028) (-2266.471) (-2273.810) [-2267.017] -- 0:00:26
913500 -- (-2271.725) (-2263.437) [-2268.437] (-2274.741) * [-2259.598] (-2270.838) (-2266.130) (-2269.628) -- 0:00:26
914000 -- (-2266.396) [-2265.177] (-2259.546) (-2290.565) * (-2272.848) (-2271.358) [-2261.463] (-2261.897) -- 0:00:26
914500 -- (-2267.809) (-2280.079) (-2271.604) [-2263.254] * (-2284.921) (-2262.936) (-2271.241) [-2264.822] -- 0:00:26
915000 -- [-2254.993] (-2267.708) (-2272.648) (-2267.243) * (-2283.496) (-2267.187) (-2267.408) [-2267.821] -- 0:00:26
Average standard deviation of split frequencies: 0.007754
915500 -- [-2265.867] (-2261.094) (-2261.870) (-2277.530) * (-2275.742) (-2266.898) [-2259.324] (-2263.347) -- 0:00:25
916000 -- (-2265.338) [-2265.449] (-2268.924) (-2268.898) * (-2270.888) (-2266.423) [-2265.849] (-2266.120) -- 0:00:25
916500 -- (-2275.622) (-2267.193) [-2264.022] (-2262.537) * (-2276.779) [-2258.304] (-2266.136) (-2266.804) -- 0:00:25
917000 -- (-2267.040) (-2260.960) (-2267.240) [-2261.713] * [-2268.726] (-2261.049) (-2275.395) (-2267.731) -- 0:00:25
917500 -- (-2268.346) [-2259.754] (-2263.526) (-2288.320) * [-2270.767] (-2263.243) (-2268.638) (-2262.610) -- 0:00:25
918000 -- (-2275.818) [-2262.935] (-2254.682) (-2271.117) * (-2274.249) [-2264.506] (-2266.910) (-2271.729) -- 0:00:25
918500 -- (-2261.221) (-2276.148) (-2262.447) [-2260.611] * (-2268.934) (-2272.430) (-2281.916) [-2265.616] -- 0:00:25
919000 -- (-2272.677) (-2278.394) (-2256.377) [-2261.762] * [-2271.727] (-2261.916) (-2263.749) (-2271.524) -- 0:00:24
919500 -- (-2264.878) [-2275.212] (-2272.563) (-2273.609) * (-2260.322) (-2257.286) (-2265.177) [-2269.322] -- 0:00:24
920000 -- (-2265.613) [-2269.207] (-2271.788) (-2278.453) * [-2262.244] (-2270.418) (-2272.463) (-2274.127) -- 0:00:24
Average standard deviation of split frequencies: 0.007851
920500 -- (-2282.935) (-2259.056) (-2278.449) [-2260.218] * [-2273.690] (-2264.041) (-2272.095) (-2277.488) -- 0:00:24
921000 -- (-2268.302) [-2267.126] (-2272.863) (-2276.656) * (-2273.617) (-2270.208) (-2273.741) [-2280.371] -- 0:00:24
921500 -- (-2275.463) [-2264.549] (-2270.953) (-2280.087) * [-2268.278] (-2276.115) (-2271.287) (-2256.614) -- 0:00:24
922000 -- [-2266.429] (-2265.255) (-2271.744) (-2277.775) * (-2278.106) (-2285.416) (-2269.025) [-2258.439] -- 0:00:23
922500 -- (-2271.476) [-2273.496] (-2281.819) (-2263.764) * [-2265.958] (-2280.178) (-2275.280) (-2266.822) -- 0:00:23
923000 -- (-2276.432) [-2267.018] (-2265.049) (-2265.590) * (-2265.941) (-2267.096) (-2265.060) [-2269.088] -- 0:00:23
923500 -- (-2270.602) [-2275.296] (-2266.891) (-2270.523) * (-2260.653) (-2265.923) (-2258.152) [-2264.165] -- 0:00:23
924000 -- [-2271.586] (-2271.561) (-2269.300) (-2273.525) * (-2258.081) (-2273.038) [-2272.519] (-2259.008) -- 0:00:23
924500 -- [-2258.799] (-2273.660) (-2256.731) (-2260.005) * [-2254.407] (-2276.173) (-2276.273) (-2266.207) -- 0:00:23
925000 -- (-2270.430) [-2267.122] (-2259.977) (-2272.056) * (-2276.473) [-2262.411] (-2279.953) (-2256.670) -- 0:00:23
Average standard deviation of split frequencies: 0.008043
925500 -- (-2268.321) (-2275.500) [-2271.496] (-2269.428) * (-2270.718) (-2261.738) (-2268.095) [-2254.720] -- 0:00:22
926000 -- [-2265.718] (-2263.947) (-2266.787) (-2263.704) * (-2268.457) [-2272.197] (-2264.955) (-2264.487) -- 0:00:22
926500 -- (-2262.378) (-2267.670) [-2263.517] (-2270.081) * [-2267.861] (-2259.336) (-2259.361) (-2257.003) -- 0:00:22
927000 -- [-2264.839] (-2262.744) (-2272.273) (-2268.071) * (-2274.772) [-2270.833] (-2259.564) (-2267.738) -- 0:00:22
927500 -- [-2257.352] (-2281.997) (-2278.720) (-2270.261) * (-2272.865) (-2270.397) [-2261.954] (-2275.687) -- 0:00:22
928000 -- (-2273.281) (-2263.198) [-2261.139] (-2270.732) * [-2262.888] (-2283.455) (-2277.332) (-2261.509) -- 0:00:22
928500 -- [-2274.010] (-2263.707) (-2266.613) (-2278.332) * [-2260.560] (-2277.503) (-2275.388) (-2268.522) -- 0:00:21
929000 -- (-2264.484) (-2271.553) (-2269.454) [-2261.022] * (-2270.170) (-2269.530) (-2268.372) [-2256.761] -- 0:00:21
929500 -- (-2266.274) (-2258.885) [-2258.110] (-2262.010) * (-2272.482) (-2264.650) (-2266.912) [-2265.458] -- 0:00:21
930000 -- (-2267.556) (-2277.699) [-2257.598] (-2264.150) * (-2280.245) [-2266.880] (-2270.833) (-2269.053) -- 0:00:21
Average standard deviation of split frequencies: 0.008003
930500 -- (-2274.539) [-2259.371] (-2270.670) (-2274.106) * [-2263.465] (-2274.475) (-2265.002) (-2267.203) -- 0:00:21
931000 -- (-2275.971) (-2264.773) (-2264.150) [-2265.598] * [-2267.137] (-2266.710) (-2256.207) (-2270.796) -- 0:00:21
931500 -- (-2266.217) (-2263.294) [-2265.222] (-2262.617) * [-2260.697] (-2273.651) (-2272.529) (-2266.231) -- 0:00:20
932000 -- (-2270.396) [-2263.523] (-2261.128) (-2260.288) * (-2262.896) [-2262.059] (-2255.724) (-2263.570) -- 0:00:20
932500 -- (-2267.626) (-2266.583) (-2276.975) [-2270.296] * (-2276.265) [-2263.606] (-2271.521) (-2288.079) -- 0:00:20
933000 -- (-2279.004) [-2266.481] (-2267.607) (-2274.411) * (-2279.407) (-2262.955) [-2267.264] (-2270.490) -- 0:00:20
933500 -- (-2260.699) (-2261.475) (-2266.560) [-2260.729] * (-2264.008) (-2278.742) (-2274.469) [-2263.899] -- 0:00:20
934000 -- (-2270.177) (-2265.362) [-2255.885] (-2266.722) * (-2263.529) (-2267.262) [-2277.977] (-2281.588) -- 0:00:20
934500 -- [-2275.637] (-2269.071) (-2266.733) (-2264.161) * (-2266.970) (-2276.004) [-2259.857] (-2273.323) -- 0:00:20
935000 -- (-2268.640) (-2279.632) (-2263.152) [-2265.440] * (-2266.510) (-2265.631) (-2266.555) [-2260.103] -- 0:00:19
Average standard deviation of split frequencies: 0.008226
935500 -- (-2269.332) (-2269.436) (-2258.360) [-2269.773] * [-2264.442] (-2277.101) (-2266.470) (-2263.169) -- 0:00:19
936000 -- (-2264.614) (-2273.614) [-2262.656] (-2262.514) * [-2273.482] (-2269.962) (-2268.309) (-2261.663) -- 0:00:19
936500 -- (-2258.899) (-2270.130) [-2254.345] (-2279.910) * (-2260.219) (-2269.305) [-2263.462] (-2264.320) -- 0:00:19
937000 -- (-2267.310) [-2267.326] (-2267.873) (-2259.343) * [-2266.522] (-2269.642) (-2269.563) (-2270.311) -- 0:00:19
937500 -- [-2266.791] (-2277.986) (-2268.680) (-2269.665) * [-2264.071] (-2262.095) (-2266.133) (-2260.819) -- 0:00:19
938000 -- (-2277.416) [-2261.756] (-2268.821) (-2265.263) * (-2270.633) (-2280.827) [-2256.012] (-2258.827) -- 0:00:18
938500 -- (-2277.918) [-2255.238] (-2274.894) (-2279.523) * (-2271.929) [-2264.566] (-2268.419) (-2265.275) -- 0:00:18
939000 -- [-2265.370] (-2265.597) (-2278.163) (-2264.060) * (-2267.880) (-2262.049) (-2263.098) [-2267.068] -- 0:00:18
939500 -- (-2264.539) [-2261.973] (-2276.726) (-2268.246) * (-2269.655) [-2258.907] (-2274.909) (-2262.367) -- 0:00:18
940000 -- [-2262.741] (-2278.089) (-2267.879) (-2254.643) * (-2265.888) (-2262.710) [-2260.648] (-2264.806) -- 0:00:18
Average standard deviation of split frequencies: 0.008453
940500 -- (-2265.360) (-2265.608) (-2263.055) [-2259.713] * (-2267.989) (-2270.392) [-2258.148] (-2266.183) -- 0:00:18
941000 -- (-2274.171) (-2258.541) [-2256.599] (-2272.139) * (-2271.875) [-2264.763] (-2262.303) (-2267.811) -- 0:00:18
941500 -- (-2269.638) [-2260.777] (-2263.299) (-2265.869) * (-2265.240) (-2272.018) (-2276.242) [-2262.728] -- 0:00:17
942000 -- (-2267.369) [-2267.512] (-2268.382) (-2267.028) * (-2270.798) [-2260.911] (-2265.308) (-2281.693) -- 0:00:17
942500 -- (-2272.743) [-2268.222] (-2273.127) (-2284.142) * (-2251.489) [-2260.875] (-2283.020) (-2263.324) -- 0:00:17
943000 -- [-2269.178] (-2257.980) (-2272.075) (-2266.674) * (-2267.277) (-2269.797) (-2265.568) [-2264.572] -- 0:00:17
943500 -- (-2269.556) (-2278.311) [-2260.709] (-2269.380) * (-2259.892) (-2260.774) [-2257.304] (-2270.295) -- 0:00:17
944000 -- (-2275.028) (-2261.917) [-2270.073] (-2272.619) * (-2267.102) (-2265.212) [-2260.570] (-2270.335) -- 0:00:17
944500 -- (-2264.046) (-2255.486) [-2263.110] (-2265.097) * (-2274.788) [-2258.589] (-2268.722) (-2274.169) -- 0:00:16
945000 -- (-2267.050) (-2257.209) (-2264.426) [-2262.471] * [-2260.943] (-2276.830) (-2262.853) (-2272.777) -- 0:00:16
Average standard deviation of split frequencies: 0.008671
945500 -- (-2263.347) [-2254.813] (-2265.933) (-2284.280) * (-2280.469) (-2269.272) [-2260.631] (-2273.730) -- 0:00:16
946000 -- (-2274.525) [-2255.188] (-2271.173) (-2269.607) * (-2262.800) (-2272.176) [-2260.805] (-2265.672) -- 0:00:16
946500 -- (-2268.918) [-2265.425] (-2268.853) (-2270.509) * (-2267.286) (-2265.271) [-2265.407] (-2274.984) -- 0:00:16
947000 -- [-2275.262] (-2265.567) (-2261.036) (-2271.588) * (-2264.511) [-2265.024] (-2268.421) (-2271.448) -- 0:00:16
947500 -- (-2280.536) (-2267.052) (-2267.504) [-2262.945] * [-2263.716] (-2258.326) (-2260.351) (-2280.594) -- 0:00:16
948000 -- (-2275.569) [-2264.939] (-2269.307) (-2272.024) * [-2266.244] (-2264.545) (-2256.047) (-2272.581) -- 0:00:15
948500 -- (-2261.799) [-2265.010] (-2274.490) (-2287.025) * (-2264.394) (-2267.949) (-2266.164) [-2265.729] -- 0:00:15
949000 -- [-2267.268] (-2278.272) (-2268.423) (-2264.794) * (-2275.559) [-2253.647] (-2268.377) (-2272.694) -- 0:00:15
949500 -- (-2266.051) [-2266.021] (-2268.977) (-2265.129) * (-2267.105) [-2263.186] (-2266.667) (-2267.308) -- 0:00:15
950000 -- (-2279.772) (-2255.094) (-2271.145) [-2261.961] * (-2264.804) [-2261.786] (-2272.134) (-2264.976) -- 0:00:15
Average standard deviation of split frequencies: 0.008959
950500 -- (-2275.727) [-2267.362] (-2265.700) (-2265.845) * (-2262.723) (-2268.836) [-2256.511] (-2265.705) -- 0:00:15
951000 -- (-2273.745) (-2275.131) (-2271.864) [-2261.739] * [-2276.247] (-2292.873) (-2264.446) (-2261.567) -- 0:00:14
951500 -- (-2270.989) (-2276.401) (-2274.745) [-2258.708] * [-2258.501] (-2270.659) (-2272.382) (-2263.682) -- 0:00:14
952000 -- [-2262.177] (-2272.590) (-2270.567) (-2263.129) * (-2260.711) (-2261.478) (-2269.074) [-2269.377] -- 0:00:14
952500 -- (-2261.480) [-2256.948] (-2263.728) (-2268.469) * (-2265.297) (-2263.468) [-2256.942] (-2272.110) -- 0:00:14
953000 -- (-2268.304) (-2268.462) [-2260.278] (-2260.468) * [-2261.094] (-2279.434) (-2270.763) (-2269.917) -- 0:00:14
953500 -- [-2259.776] (-2263.293) (-2262.733) (-2269.085) * (-2262.630) (-2274.376) [-2273.567] (-2264.605) -- 0:00:14
954000 -- [-2271.263] (-2263.923) (-2270.213) (-2272.740) * (-2259.578) (-2264.177) (-2263.375) [-2266.237] -- 0:00:14
954500 -- (-2267.062) [-2257.201] (-2279.194) (-2259.655) * (-2259.315) [-2270.897] (-2280.167) (-2265.382) -- 0:00:13
955000 -- (-2265.916) (-2258.741) (-2273.242) [-2269.867] * [-2261.639] (-2264.203) (-2305.002) (-2272.271) -- 0:00:13
Average standard deviation of split frequencies: 0.008679
955500 -- (-2265.013) (-2262.733) [-2262.309] (-2266.973) * [-2264.452] (-2270.798) (-2272.514) (-2264.497) -- 0:00:13
956000 -- (-2274.928) (-2271.199) (-2265.456) [-2259.582] * (-2269.078) (-2265.907) (-2260.763) [-2264.294] -- 0:00:13
956500 -- (-2264.337) (-2262.904) (-2265.343) [-2260.540] * [-2260.911] (-2269.621) (-2257.897) (-2262.245) -- 0:00:13
957000 -- (-2260.050) [-2260.015] (-2268.604) (-2266.056) * (-2275.150) (-2269.894) [-2263.450] (-2274.146) -- 0:00:13
957500 -- (-2272.127) [-2268.854] (-2270.154) (-2259.664) * (-2275.353) (-2276.621) (-2265.431) [-2257.818] -- 0:00:13
958000 -- (-2271.151) [-2275.199] (-2269.745) (-2271.791) * (-2271.550) (-2265.353) (-2257.680) [-2270.750] -- 0:00:12
958500 -- (-2261.474) [-2265.898] (-2284.883) (-2280.137) * (-2265.742) (-2259.008) [-2260.292] (-2285.046) -- 0:00:12
959000 -- (-2268.216) (-2262.137) [-2261.420] (-2279.283) * (-2263.351) (-2260.031) [-2255.896] (-2268.334) -- 0:00:12
959500 -- (-2263.876) [-2261.614] (-2265.799) (-2268.231) * (-2267.159) (-2278.189) (-2266.346) [-2255.689] -- 0:00:12
960000 -- (-2270.440) [-2264.888] (-2260.848) (-2266.440) * (-2270.389) (-2262.004) [-2265.056] (-2276.540) -- 0:00:12
Average standard deviation of split frequencies: 0.008440
960500 -- (-2267.365) (-2260.569) [-2266.293] (-2277.034) * [-2265.800] (-2262.826) (-2268.144) (-2272.877) -- 0:00:12
961000 -- (-2265.051) (-2277.080) [-2263.969] (-2285.666) * [-2264.082] (-2265.132) (-2270.132) (-2266.506) -- 0:00:11
961500 -- [-2262.207] (-2272.626) (-2263.286) (-2274.168) * [-2260.647] (-2297.353) (-2268.885) (-2277.679) -- 0:00:11
962000 -- (-2264.702) (-2278.070) (-2260.910) [-2259.761] * (-2269.921) (-2277.866) (-2267.174) [-2257.817] -- 0:00:11
962500 -- [-2263.815] (-2275.977) (-2273.813) (-2265.092) * (-2265.927) (-2267.399) (-2270.733) [-2254.017] -- 0:00:11
963000 -- (-2261.055) (-2269.118) (-2269.305) [-2264.325] * (-2285.993) [-2256.591] (-2273.753) (-2257.738) -- 0:00:11
963500 -- [-2258.071] (-2268.205) (-2273.156) (-2264.645) * (-2266.821) (-2265.097) [-2267.940] (-2262.176) -- 0:00:11
964000 -- (-2263.840) (-2261.902) [-2260.065] (-2279.230) * (-2275.815) [-2263.735] (-2265.533) (-2266.137) -- 0:00:11
964500 -- (-2267.750) (-2266.914) [-2265.170] (-2269.160) * (-2273.834) [-2259.619] (-2271.569) (-2271.924) -- 0:00:10
965000 -- [-2262.256] (-2262.513) (-2264.239) (-2261.189) * (-2267.946) (-2263.983) [-2263.376] (-2272.548) -- 0:00:10
Average standard deviation of split frequencies: 0.007710
965500 -- (-2269.737) [-2262.941] (-2269.066) (-2262.597) * [-2267.394] (-2270.526) (-2267.870) (-2275.733) -- 0:00:10
966000 -- [-2258.519] (-2258.124) (-2264.463) (-2271.463) * (-2273.690) [-2257.556] (-2283.032) (-2269.258) -- 0:00:10
966500 -- (-2274.361) [-2257.136] (-2263.874) (-2260.490) * (-2266.324) (-2265.694) (-2270.479) [-2261.805] -- 0:00:10
967000 -- (-2271.537) (-2263.198) (-2270.432) [-2270.155] * [-2263.892] (-2277.156) (-2273.368) (-2269.455) -- 0:00:10
967500 -- (-2274.141) (-2275.556) (-2268.011) [-2259.292] * (-2267.572) (-2274.680) [-2266.674] (-2264.293) -- 0:00:09
968000 -- [-2265.371] (-2270.663) (-2268.390) (-2260.101) * (-2275.311) (-2263.373) [-2263.080] (-2268.386) -- 0:00:09
968500 -- [-2268.526] (-2274.912) (-2271.854) (-2262.850) * (-2264.102) (-2265.811) (-2274.565) [-2268.331] -- 0:00:09
969000 -- [-2267.421] (-2272.805) (-2271.590) (-2265.676) * (-2254.832) [-2265.603] (-2265.368) (-2268.839) -- 0:00:09
969500 -- (-2268.870) [-2261.111] (-2281.650) (-2269.509) * [-2261.500] (-2275.449) (-2269.938) (-2280.581) -- 0:00:09
970000 -- (-2275.651) [-2260.769] (-2272.755) (-2265.474) * (-2263.408) (-2266.334) (-2258.893) [-2263.333] -- 0:00:09
Average standard deviation of split frequencies: 0.007706
970500 -- (-2277.656) [-2267.104] (-2267.946) (-2267.643) * (-2257.890) (-2273.375) [-2259.062] (-2274.839) -- 0:00:09
971000 -- (-2269.165) (-2265.172) (-2271.082) [-2264.593] * (-2262.263) [-2260.424] (-2263.088) (-2270.465) -- 0:00:08
971500 -- (-2264.635) [-2259.553] (-2271.485) (-2267.841) * (-2266.969) (-2262.564) [-2263.369] (-2268.406) -- 0:00:08
972000 -- (-2274.696) [-2268.586] (-2265.482) (-2268.262) * (-2270.883) (-2267.970) [-2259.129] (-2268.611) -- 0:00:08
972500 -- [-2259.637] (-2264.028) (-2262.051) (-2279.081) * (-2269.751) (-2260.951) [-2260.341] (-2267.196) -- 0:00:08
973000 -- [-2255.747] (-2264.512) (-2284.745) (-2277.879) * (-2279.229) (-2261.448) (-2267.503) [-2261.439] -- 0:00:08
973500 -- (-2287.046) [-2265.392] (-2267.366) (-2267.757) * (-2276.823) (-2267.090) (-2269.621) [-2260.772] -- 0:00:08
974000 -- (-2263.021) (-2266.207) [-2262.120] (-2270.414) * (-2263.390) (-2269.955) [-2258.629] (-2275.334) -- 0:00:07
974500 -- [-2258.128] (-2277.467) (-2260.663) (-2261.288) * (-2262.815) [-2268.780] (-2275.330) (-2271.382) -- 0:00:07
975000 -- (-2275.791) [-2261.098] (-2269.000) (-2270.337) * [-2271.371] (-2286.608) (-2269.655) (-2261.282) -- 0:00:07
Average standard deviation of split frequencies: 0.007535
975500 -- (-2272.431) [-2265.761] (-2264.889) (-2275.337) * [-2266.073] (-2269.752) (-2271.452) (-2265.382) -- 0:00:07
976000 -- (-2265.315) (-2271.186) [-2266.271] (-2271.175) * [-2259.540] (-2274.087) (-2271.804) (-2280.447) -- 0:00:07
976500 -- (-2271.957) [-2268.284] (-2276.991) (-2277.372) * [-2263.717] (-2271.958) (-2263.973) (-2279.864) -- 0:00:07
977000 -- [-2265.330] (-2267.797) (-2273.402) (-2279.092) * (-2274.899) [-2267.744] (-2259.900) (-2261.155) -- 0:00:07
977500 -- (-2272.882) [-2266.499] (-2259.292) (-2272.884) * (-2263.824) (-2271.348) [-2263.094] (-2264.768) -- 0:00:06
978000 -- (-2260.576) (-2269.104) (-2264.987) [-2259.641] * (-2267.356) [-2266.373] (-2267.011) (-2263.123) -- 0:00:06
978500 -- (-2263.049) (-2270.419) (-2272.771) [-2270.826] * (-2278.471) (-2269.505) [-2261.337] (-2276.893) -- 0:00:06
979000 -- (-2258.294) (-2267.174) (-2261.754) [-2263.164] * (-2259.660) (-2271.175) [-2265.698] (-2266.940) -- 0:00:06
979500 -- [-2262.867] (-2265.912) (-2270.346) (-2269.015) * (-2266.185) (-2283.394) [-2263.331] (-2269.524) -- 0:00:06
980000 -- (-2273.968) (-2263.233) [-2272.513] (-2267.238) * (-2272.075) [-2263.470] (-2270.751) (-2271.506) -- 0:00:06
Average standard deviation of split frequencies: 0.007435
980500 -- (-2257.604) (-2264.711) [-2259.192] (-2272.525) * [-2268.070] (-2265.581) (-2280.972) (-2268.787) -- 0:00:05
981000 -- (-2267.420) (-2273.918) (-2269.285) [-2261.777] * (-2282.777) (-2259.987) (-2265.922) [-2264.226] -- 0:00:05
981500 -- (-2276.461) [-2265.367] (-2273.946) (-2261.623) * (-2274.677) (-2264.298) (-2272.047) [-2257.558] -- 0:00:05
982000 -- (-2264.683) [-2255.738] (-2271.598) (-2273.560) * (-2267.974) [-2275.068] (-2274.727) (-2260.561) -- 0:00:05
982500 -- (-2269.925) [-2264.367] (-2265.999) (-2265.234) * (-2272.060) (-2268.864) [-2264.489] (-2259.055) -- 0:00:05
983000 -- (-2264.565) (-2257.503) [-2264.619] (-2263.692) * (-2266.834) (-2261.036) (-2276.626) [-2268.354] -- 0:00:05
983500 -- (-2274.581) (-2263.953) [-2260.894] (-2270.528) * [-2263.086] (-2259.618) (-2268.493) (-2272.389) -- 0:00:05
984000 -- (-2275.193) (-2266.389) [-2266.311] (-2266.715) * (-2276.785) [-2258.490] (-2264.453) (-2284.648) -- 0:00:04
984500 -- (-2275.441) (-2272.691) (-2260.645) [-2269.600] * (-2286.481) (-2260.353) [-2261.009] (-2283.709) -- 0:00:04
985000 -- [-2270.690] (-2265.851) (-2270.969) (-2266.407) * (-2268.427) (-2271.497) [-2256.798] (-2271.448) -- 0:00:04
Average standard deviation of split frequencies: 0.007458
985500 -- [-2267.609] (-2270.713) (-2262.829) (-2262.263) * (-2272.099) [-2267.825] (-2286.739) (-2279.078) -- 0:00:04
986000 -- (-2267.757) (-2269.035) (-2266.888) [-2257.495] * (-2263.081) [-2262.370] (-2273.491) (-2277.735) -- 0:00:04
986500 -- (-2274.495) (-2273.990) (-2271.151) [-2260.355] * (-2264.852) (-2267.506) [-2262.736] (-2271.869) -- 0:00:04
987000 -- (-2280.211) (-2266.513) (-2264.125) [-2254.181] * (-2269.085) (-2268.809) [-2262.057] (-2265.528) -- 0:00:03
987500 -- (-2268.107) [-2263.964] (-2263.530) (-2277.272) * (-2272.220) (-2270.368) [-2257.616] (-2269.805) -- 0:00:03
988000 -- (-2266.433) [-2268.883] (-2278.262) (-2265.529) * (-2274.296) [-2267.149] (-2260.219) (-2262.605) -- 0:00:03
988500 -- (-2268.321) (-2268.327) (-2270.685) [-2269.908] * (-2265.336) (-2261.878) (-2263.374) [-2264.386] -- 0:00:03
989000 -- [-2272.895] (-2275.018) (-2263.509) (-2264.849) * (-2267.731) [-2259.675] (-2270.004) (-2267.867) -- 0:00:03
989500 -- (-2264.508) (-2282.828) [-2266.966] (-2264.421) * [-2260.963] (-2272.896) (-2280.795) (-2264.151) -- 0:00:03
990000 -- [-2264.779] (-2271.878) (-2263.835) (-2263.849) * (-2272.250) [-2270.102] (-2269.350) (-2265.951) -- 0:00:03
Average standard deviation of split frequencies: 0.007233
990500 -- [-2262.720] (-2262.840) (-2270.272) (-2269.793) * (-2263.711) (-2265.332) [-2265.686] (-2262.836) -- 0:00:02
991000 -- (-2270.187) (-2257.326) [-2269.726] (-2259.608) * (-2275.072) (-2267.229) (-2279.025) [-2268.029] -- 0:00:02
991500 -- (-2273.982) (-2271.603) [-2258.976] (-2265.812) * (-2272.737) [-2267.661] (-2269.431) (-2263.828) -- 0:00:02
992000 -- (-2261.088) (-2262.444) [-2266.295] (-2274.127) * (-2268.708) (-2264.831) [-2261.607] (-2269.203) -- 0:00:02
992500 -- (-2260.496) [-2257.582] (-2286.269) (-2268.073) * (-2269.457) [-2264.646] (-2261.594) (-2266.020) -- 0:00:02
993000 -- (-2260.175) [-2266.573] (-2267.362) (-2267.569) * [-2268.286] (-2269.781) (-2262.855) (-2271.796) -- 0:00:02
993500 -- (-2263.629) (-2269.275) (-2274.237) [-2255.941] * [-2271.234] (-2261.990) (-2263.498) (-2261.255) -- 0:00:01
994000 -- (-2268.191) (-2265.894) (-2277.391) [-2274.975] * (-2266.632) [-2262.763] (-2270.813) (-2262.835) -- 0:00:01
994500 -- (-2260.435) (-2279.599) [-2261.682] (-2269.509) * [-2269.377] (-2268.206) (-2267.390) (-2267.190) -- 0:00:01
995000 -- [-2264.280] (-2279.167) (-2261.770) (-2273.006) * (-2269.335) [-2266.347] (-2263.939) (-2274.028) -- 0:00:01
Average standard deviation of split frequencies: 0.006658
995500 -- (-2270.141) (-2267.640) (-2290.790) [-2272.001] * [-2264.516] (-2270.284) (-2268.543) (-2272.788) -- 0:00:01
996000 -- (-2268.336) (-2270.377) (-2269.925) [-2259.872] * (-2267.947) [-2263.756] (-2265.580) (-2282.377) -- 0:00:01
996500 -- (-2274.510) [-2263.049] (-2265.270) (-2270.726) * (-2268.729) (-2273.809) (-2266.603) [-2260.593] -- 0:00:01
997000 -- (-2268.019) (-2257.637) [-2262.658] (-2261.960) * (-2263.411) (-2272.203) (-2275.185) [-2261.165] -- 0:00:00
997500 -- (-2265.859) (-2266.731) [-2271.011] (-2262.110) * [-2268.143] (-2273.815) (-2259.457) (-2267.765) -- 0:00:00
998000 -- [-2271.684] (-2255.852) (-2268.976) (-2262.237) * [-2261.512] (-2259.387) (-2267.936) (-2267.305) -- 0:00:00
998500 -- (-2266.115) (-2268.482) [-2259.466] (-2272.292) * [-2255.782] (-2268.886) (-2267.497) (-2264.825) -- 0:00:00
999000 -- [-2259.296] (-2267.492) (-2282.528) (-2261.780) * (-2265.162) [-2259.497] (-2266.360) (-2271.622) -- 0:00:00
999500 -- (-2272.985) (-2268.166) [-2264.166] (-2275.287) * (-2267.520) (-2269.686) (-2266.829) [-2263.788] -- 0:00:00
1000000 -- (-2259.551) (-2268.230) (-2280.603) [-2258.107] * (-2274.937) (-2264.432) (-2263.568) [-2262.227] -- 0:00:00
Average standard deviation of split frequencies: 0.006375
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2259.551094 -- 24.756568
Chain 1 -- -2259.551104 -- 24.756568
Chain 2 -- -2268.229704 -- 20.825052
Chain 2 -- -2268.229708 -- 20.825052
Chain 3 -- -2280.603345 -- 26.192893
Chain 3 -- -2280.603343 -- 26.192893
Chain 4 -- -2258.106649 -- 25.580104
Chain 4 -- -2258.106649 -- 25.580104
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2274.937046 -- 26.480692
Chain 1 -- -2274.937065 -- 26.480692
Chain 2 -- -2264.432216 -- 25.611939
Chain 2 -- -2264.432214 -- 25.611939
Chain 3 -- -2263.568334 -- 26.334736
Chain 3 -- -2263.568336 -- 26.334736
Chain 4 -- -2262.226853 -- 22.709695
Chain 4 -- -2262.226863 -- 22.709695
Analysis completed in 5 mins 6 seconds
Analysis used 305.38 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2249.39
Likelihood of best state for "cold" chain of run 2 was -2249.24
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
49.0 % ( 36 %) Dirichlet(Revmat{all})
65.5 % ( 47 %) Slider(Revmat{all})
25.2 % ( 30 %) Dirichlet(Pi{all})
26.6 % ( 25 %) Slider(Pi{all})
56.7 % ( 29 %) Multiplier(Alpha{1,2})
44.8 % ( 30 %) Multiplier(Alpha{3})
34.4 % ( 34 %) Slider(Pinvar{all})
13.5 % ( 10 %) ExtSPR(Tau{all},V{all})
4.0 % ( 8 %) ExtTBR(Tau{all},V{all})
19.2 % ( 13 %) NNI(Tau{all},V{all})
17.2 % ( 17 %) ParsSPR(Tau{all},V{all})
26.8 % ( 24 %) Multiplier(V{all})
44.4 % ( 45 %) Nodeslider(V{all})
25.7 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
48.7 % ( 35 %) Dirichlet(Revmat{all})
64.8 % ( 47 %) Slider(Revmat{all})
24.6 % ( 34 %) Dirichlet(Pi{all})
26.4 % ( 25 %) Slider(Pi{all})
56.8 % ( 26 %) Multiplier(Alpha{1,2})
44.5 % ( 23 %) Multiplier(Alpha{3})
34.6 % ( 27 %) Slider(Pinvar{all})
13.6 % ( 9 %) ExtSPR(Tau{all},V{all})
4.1 % ( 6 %) ExtTBR(Tau{all},V{all})
19.3 % ( 17 %) NNI(Tau{all},V{all})
17.2 % ( 16 %) ParsSPR(Tau{all},V{all})
26.8 % ( 18 %) Multiplier(V{all})
44.1 % ( 45 %) Nodeslider(V{all})
25.6 % ( 18 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166777 0.75 0.54
3 | 166166 167095 0.77
4 | 166399 167162 166401
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166512 0.76 0.55
3 | 166197 166122 0.77
4 | 167423 166890 166856
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2261.23
| 2 1 |
| 1 2 |
| 2 1 2 2 |
| 2 11 2 2 1 |
| 22 * 1 |
| 22 2 * 1 2 * 11 1 * |
| 122 22 1 1 1 2 2 1 |
| 2 21 2 2 1 2 12 2 2 1 |
| 2 1 1 112 1 1 2 1 * 1 1 1 22|
|2 1 2 1 2 2 1 1 2 2 212 2 2 |
|1 1 1 12 * 2 2 * 1 1|
| 1 21 1 2 1 |
| 1 1 12 1 1 * |
| 1 1 2 2 |
| 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2266.52
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2257.37 -2282.05
2 -2256.73 -2276.21
--------------------------------------
TOTAL -2257.00 -2281.36
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.389200 0.003138 0.287301 0.504191 0.384507 1405.33 1436.15 1.000
r(A<->C){all} 0.119417 0.001146 0.058768 0.190841 0.116106 795.84 908.99 1.000
r(A<->G){all} 0.251567 0.002956 0.147983 0.358029 0.247817 589.66 640.17 1.000
r(A<->T){all} 0.110706 0.001484 0.041559 0.187782 0.107179 757.43 817.06 1.000
r(C<->G){all} 0.065725 0.000407 0.030332 0.107925 0.063458 960.11 1006.60 1.000
r(C<->T){all} 0.441390 0.003780 0.323123 0.560051 0.441287 591.01 664.37 1.000
r(G<->T){all} 0.011194 0.000107 0.000002 0.031442 0.008227 921.04 1021.98 1.000
pi(A){all} 0.238453 0.000149 0.215876 0.262784 0.238250 986.36 1149.22 1.000
pi(C){all} 0.308173 0.000175 0.283215 0.334078 0.307752 1207.76 1210.44 1.000
pi(G){all} 0.270920 0.000168 0.245455 0.296428 0.271094 1117.11 1203.63 1.000
pi(T){all} 0.182454 0.000122 0.162519 0.205410 0.182323 1156.83 1195.96 1.000
alpha{1,2} 0.046441 0.000670 0.000113 0.086602 0.048221 1266.70 1325.95 1.000
alpha{3} 2.457735 0.659965 1.069537 4.040857 2.338692 1396.56 1448.78 1.000
pinvar{all} 0.746451 0.000694 0.695172 0.797072 0.747761 1101.42 1284.18 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- ....*******
13 -- .........**
14 -- ...********
15 -- .....**....
16 -- ..*********
17 -- .....**.***
18 -- ........***
19 -- ....*..*...
20 -- .....**..**
21 -- .....******
22 -- ....****.**
23 -- ....***.***
24 -- .**........
25 -- .....***.**
26 -- .*.********
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 3001 0.999667 0.000471 0.999334 1.000000 2
13 2985 0.994337 0.001413 0.993338 0.995336 2
14 2984 0.994004 0.001884 0.992672 0.995336 2
15 2607 0.868421 0.014604 0.858095 0.878748 2
16 2328 0.775483 0.000942 0.774817 0.776149 2
17 2258 0.752165 0.007537 0.746835 0.757495 2
18 1824 0.607595 0.004711 0.604264 0.610926 2
19 1045 0.348101 0.022141 0.332445 0.363757 2
20 936 0.311792 0.001884 0.310460 0.313125 2
21 896 0.298468 0.011306 0.290473 0.306462 2
22 649 0.216189 0.004240 0.213191 0.219187 2
23 593 0.197535 0.000471 0.197202 0.197868 2
24 353 0.117588 0.008951 0.111259 0.123917 2
25 349 0.116256 0.007066 0.111259 0.121252 2
26 317 0.105596 0.008009 0.099933 0.111259 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.017794 0.000043 0.006419 0.030212 0.016862 1.000 2
length{all}[2] 0.003851 0.000009 0.000001 0.009541 0.003143 1.000 2
length{all}[3] 0.002030 0.000004 0.000000 0.006056 0.001389 1.000 2
length{all}[4] 0.005252 0.000014 0.000002 0.012300 0.004488 1.001 2
length{all}[5] 0.034398 0.000124 0.014813 0.055669 0.033023 1.000 2
length{all}[6] 0.020024 0.000055 0.006680 0.034307 0.019121 1.000 2
length{all}[7] 0.006684 0.000018 0.000642 0.015171 0.005906 1.000 2
length{all}[8] 0.074806 0.000397 0.038597 0.112677 0.072129 1.000 2
length{all}[9] 0.099814 0.000651 0.052474 0.146801 0.096995 1.000 2
length{all}[10] 0.012086 0.000037 0.001582 0.023764 0.011063 1.000 2
length{all}[11] 0.016760 0.000050 0.005175 0.031298 0.015770 1.000 2
length{all}[12] 0.031237 0.000151 0.008090 0.056134 0.030316 1.000 2
length{all}[13] 0.018432 0.000082 0.003670 0.037249 0.017044 1.000 2
length{all}[14] 0.008353 0.000021 0.001201 0.017484 0.007514 1.000 2
length{all}[15] 0.006759 0.000022 0.000007 0.015908 0.005763 1.001 2
length{all}[16] 0.003493 0.000007 0.000001 0.008318 0.002877 1.001 2
length{all}[17] 0.012011 0.000042 0.001438 0.024568 0.010921 1.000 2
length{all}[18] 0.010456 0.000046 0.000009 0.022850 0.009220 1.000 2
length{all}[19] 0.005381 0.000023 0.000005 0.014826 0.004126 0.999 2
length{all}[20] 0.010063 0.000039 0.000253 0.021944 0.009317 0.999 2
length{all}[21] 0.005731 0.000024 0.000009 0.015525 0.004462 1.002 2
length{all}[22] 0.016654 0.000090 0.001074 0.034524 0.014793 0.999 2
length{all}[23] 0.004965 0.000025 0.000001 0.014809 0.003476 0.999 2
length{all}[24] 0.001948 0.000005 0.000005 0.005345 0.001311 0.999 2
length{all}[25] 0.007268 0.000041 0.000034 0.018273 0.005398 0.997 2
length{all}[26] 0.001767 0.000003 0.000005 0.005023 0.001208 0.999 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.006375
Maximum standard deviation of split frequencies = 0.022141
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.002
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
+ /------------------------------------------------------------ C3 (3)
| |
| | /-------------------------------------------------- C4 (4)
\----78---+ |
| | /---------------------------------------- C5 (5)
| | |
\----99---+ | /---------- C6 (6)
| | /---------87--------+
| | | \---------- C7 (7)
| | |
\---100---+----75---+ /-------------------- C9 (9)
| | |
| \----61---+ /---------- C10 (10)
| \----99---+
| \---------- C11 (11)
|
\---------------------------------------- C8 (8)
Phylogram (based on average branch lengths):
/-------- C1 (1)
|
|- C2 (2)
|
+/- C3 (3)
||
|| /-- C4 (4)
\+ |
| | /--------------- C5 (5)
| | |
\---+ | /--------- C6 (6)
| | /-+
| | | \--- C7 (7)
| | |
\-------------+----+ /-------------------------------------------- C9 (9)
| | |
| \---+ /----- C10 (10)
| \-------+
| \------- C11 (11)
|
\-------------------------------- C8 (8)
|--------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (203 trees sampled):
50 % credible set contains 5 trees
90 % credible set contains 48 trees
95 % credible set contains 85 trees
99 % credible set contains 173 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 1092
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sequences read..
Counting site patterns.. 0:00
139 patterns at 364 / 364 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
135664 bytes for conP
18904 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
542656 bytes for conP, adjusted
0.020678 0.004641 0.001794 0.000967 0.007419 0.006114 0.036193 0.042762 0.007098 0.006288 0.020917 0.010193 0.003005 0.080255 0.022420 0.015703 0.018332 0.076131 0.300000 1.300000
ntime & nrate & np: 18 2 20
Bounds (np=20):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 20
lnL0 = -2504.240891
Iterating by ming2
Initial: fx= 2504.240891
x= 0.02068 0.00464 0.00179 0.00097 0.00742 0.00611 0.03619 0.04276 0.00710 0.00629 0.02092 0.01019 0.00300 0.08026 0.02242 0.01570 0.01833 0.07613 0.30000 1.30000
1 h-m-p 0.0000 0.0000 858.9175 ++ 2502.624905 m 0.0000 25 | 1/20
2 h-m-p 0.0000 0.0000 510.2313 +YYCCC 2500.213715 4 0.0000 55 | 1/20
3 h-m-p 0.0000 0.0000 1543.4548 YCCCC 2498.879698 4 0.0000 85 | 1/20
4 h-m-p 0.0000 0.0000 1101.5833 +YYYCCC 2495.605224 5 0.0000 116 | 1/20
5 h-m-p 0.0000 0.0000 2110.3468 +YCYCCC 2492.161225 5 0.0000 148 | 1/20
6 h-m-p 0.0000 0.0001 1981.2517 ++ 2467.271068 m 0.0001 171 | 1/20
7 h-m-p 0.0000 0.0000 94867.5661 ++ 2462.956807 m 0.0000 194 | 1/20
8 h-m-p 0.0000 0.0001 3915.9667 +YYYCYCYC 2438.382836 7 0.0000 228 | 1/20
9 h-m-p 0.0000 0.0001 1363.2329 +CYYYCCCC 2422.731749 7 0.0001 263 | 1/20
10 h-m-p 0.0000 0.0000 16776.9072 +YYCCCC 2410.690726 5 0.0000 295 | 1/20
11 h-m-p 0.0000 0.0000 2966.1150 YCYCCC 2406.040619 5 0.0000 326 | 1/20
12 h-m-p 0.0000 0.0001 1121.7176 CCCC 2403.548700 3 0.0000 355 | 1/20
13 h-m-p 0.0000 0.0001 1072.1170 YCCCCC 2398.267418 5 0.0001 387 | 1/20
14 h-m-p 0.0000 0.0002 879.1071 YCYCCC 2390.449609 5 0.0001 418 | 1/20
15 h-m-p 0.0001 0.0004 390.2379 CCCC 2387.486019 3 0.0001 447 | 1/20
16 h-m-p 0.0001 0.0013 663.5872 +++ 2204.620568 m 0.0013 471 | 2/20
17 h-m-p 0.0004 0.0019 84.8408 CCCC 2204.330666 3 0.0001 500 | 2/20
18 h-m-p 0.0009 0.0106 12.6833 CCC 2204.292193 2 0.0003 527 | 2/20
19 h-m-p 0.0065 0.1561 0.6194 ++YYYYC 2196.668837 4 0.1025 556 | 2/20
20 h-m-p 0.0001 0.0007 92.3737 CCCCC 2195.507605 4 0.0002 605 | 2/20
21 h-m-p 0.0315 0.3955 0.6672 +CYCCC 2181.975879 4 0.2278 636 | 2/20
22 h-m-p 0.0884 0.4422 0.2799 +YYCCC 2174.376221 4 0.2891 684 | 2/20
23 h-m-p 0.2775 1.3876 0.1983 CCCC 2169.490499 3 0.2681 731 | 2/20
24 h-m-p 0.3674 1.8368 0.0264 +YYCCC 2165.330126 4 1.2784 779 | 2/20
25 h-m-p 0.3595 7.8477 0.0938 +YCCC 2161.552197 3 2.3536 826 | 2/20
26 h-m-p 0.8163 4.0814 0.0365 CYC 2160.898447 2 0.8236 870 | 2/20
27 h-m-p 0.9795 6.0732 0.0307 CCCC 2160.472202 3 1.7178 917 | 2/20
28 h-m-p 1.2672 8.0000 0.0416 YCCC 2160.162940 3 2.1161 963 | 2/20
29 h-m-p 1.6000 8.0000 0.0414 YC 2159.864926 1 2.9423 1005 | 2/20
30 h-m-p 1.6000 8.0000 0.0187 YCCC 2159.646862 3 3.1136 1051 | 2/20
31 h-m-p 1.6000 8.0000 0.0017 YCC 2159.549216 2 2.5637 1095 | 2/20
32 h-m-p 0.2850 8.0000 0.0149 ++CC 2159.359719 1 4.8936 1140 | 2/20
33 h-m-p 1.6000 8.0000 0.0250 CC 2159.290521 1 2.4060 1183 | 2/20
34 h-m-p 1.6000 8.0000 0.0014 YC 2159.234083 1 3.0725 1225 | 2/20
35 h-m-p 1.3887 8.0000 0.0031 +CC 2159.124054 1 5.6423 1269 | 2/20
36 h-m-p 1.6000 8.0000 0.0057 +YCC 2158.851491 2 4.3425 1314 | 2/20
37 h-m-p 1.6000 8.0000 0.0103 YC 2158.643454 1 3.1152 1356 | 2/20
38 h-m-p 1.1786 8.0000 0.0273 YC 2158.518045 1 2.6239 1398 | 2/20
39 h-m-p 1.6000 8.0000 0.0199 CC 2158.452586 1 2.5077 1441 | 2/20
40 h-m-p 1.6000 8.0000 0.0021 C 2158.441426 0 1.5454 1482 | 2/20
41 h-m-p 1.6000 8.0000 0.0004 CC 2158.439218 1 2.1416 1525 | 2/20
42 h-m-p 0.2564 8.0000 0.0029 ++CC 2158.437936 1 3.5183 1570 | 2/20
43 h-m-p 1.6000 8.0000 0.0016 YC 2158.436334 1 3.2921 1612 | 2/20
44 h-m-p 1.6000 8.0000 0.0007 +YC 2158.435168 1 4.7216 1655 | 2/20
45 h-m-p 1.6000 8.0000 0.0004 C 2158.434860 0 1.6526 1696 | 2/20
46 h-m-p 0.8166 8.0000 0.0009 +C 2158.434681 0 3.6607 1738 | 2/20
47 h-m-p 1.6000 8.0000 0.0005 C 2158.434661 0 1.7808 1779 | 2/20
48 h-m-p 1.6000 8.0000 0.0000 C 2158.434656 0 1.5518 1820 | 2/20
49 h-m-p 1.6000 8.0000 0.0000 Y 2158.434656 0 3.0963 1861 | 2/20
50 h-m-p 1.1587 8.0000 0.0000 C 2158.434656 0 1.7376 1902 | 2/20
51 h-m-p 1.6000 8.0000 0.0000 Y 2158.434656 0 2.7402 1943 | 2/20
52 h-m-p 0.7232 8.0000 0.0000 C 2158.434656 0 0.6242 1984 | 2/20
53 h-m-p 1.2889 8.0000 0.0000 Y 2158.434656 0 0.7193 2025 | 2/20
54 h-m-p 1.6000 8.0000 0.0000 +C 2158.434656 0 5.5810 2067 | 2/20
55 h-m-p 1.3008 8.0000 0.0000 C 2158.434656 0 0.3252 2108 | 2/20
56 h-m-p 0.4724 8.0000 0.0000 C 2158.434656 0 0.4724 2149 | 2/20
57 h-m-p 0.8788 8.0000 0.0000 C 2158.434656 0 0.8788 2190 | 2/20
58 h-m-p 1.6000 8.0000 0.0000 ++ 2158.434656 m 8.0000 2231 | 2/20
59 h-m-p 1.1723 8.0000 0.0000 ---Y 2158.434656 0 0.0046 2275
Out..
lnL = -2158.434656
2276 lfun, 2276 eigenQcodon, 40968 P(t)
Time used: 0:12
Model 1: NearlyNeutral
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
0.020678 0.004641 0.001794 0.000967 0.007419 0.006114 0.036193 0.042762 0.007098 0.006288 0.020917 0.010193 0.003005 0.080255 0.022420 0.015703 0.018332 0.076131 2.166246 0.652999 0.498354
ntime & nrate & np: 18 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 5.951908
np = 21
lnL0 = -2329.647024
Iterating by ming2
Initial: fx= 2329.647024
x= 0.02068 0.00464 0.00179 0.00097 0.00742 0.00611 0.03619 0.04276 0.00710 0.00629 0.02092 0.01019 0.00300 0.08026 0.02242 0.01570 0.01833 0.07613 2.16625 0.65300 0.49835
1 h-m-p 0.0000 0.0000 803.4446 ++ 2328.188214 m 0.0000 26 | 1/21
2 h-m-p 0.0000 0.0000 382.8396 +YCYCCC 2327.091859 5 0.0000 59 | 1/21
3 h-m-p 0.0000 0.0000 841.8408 CCC 2326.627148 2 0.0000 87 | 1/21
4 h-m-p 0.0000 0.0000 450.6370 CCC 2326.063870 2 0.0000 115 | 1/21
5 h-m-p 0.0000 0.0001 459.2369 +YCYCC 2324.393737 4 0.0000 146 | 1/21
6 h-m-p 0.0000 0.0002 595.3561 +YYCYCCC 2317.064423 6 0.0001 180 | 1/21
7 h-m-p 0.0000 0.0000 6557.7201 +YYCYCYC 2304.393931 6 0.0000 214 | 1/21
8 h-m-p 0.0000 0.0000 46656.0829 ++ 2253.468599 m 0.0000 238 | 1/21
9 h-m-p -0.0000 -0.0000 4094847.1419
h-m-p: -1.36520787e-24 -6.82603933e-24 4.09484714e+06 2253.468599
.. | 1/21
10 h-m-p 0.0000 0.0001 23323.8739 CYCYYCCC 2234.163077 7 0.0000 295 | 1/21
11 h-m-p 0.0000 0.0001 648.3556 ++ 2210.670346 m 0.0001 319 | 1/21
12 h-m-p 0.0000 0.0000 18556.6655 ++ 2191.507975 m 0.0000 343 | 2/21
13 h-m-p 0.0000 0.0001 958.0452 CCCC 2190.165737 3 0.0000 373 | 2/21
14 h-m-p 0.0000 0.0000 812.1084 +CYCCC 2184.940483 4 0.0000 405 | 2/21
15 h-m-p 0.0000 0.0000 1338.1615 +YCCC 2182.900996 3 0.0000 435 | 2/21
16 h-m-p 0.0000 0.0000 751.2559 ++ 2181.219838 m 0.0000 459 | 3/21
17 h-m-p 0.0000 0.0001 310.1227 +YC 2180.287556 1 0.0000 485 | 3/21
18 h-m-p 0.0001 0.0005 218.1677 +YCCC 2177.658186 3 0.0002 515 | 3/21
19 h-m-p 0.0000 0.0001 429.4021 YCCCC 2176.323322 4 0.0000 546 | 3/21
20 h-m-p 0.0001 0.0003 128.0141 YCCCC 2174.718258 4 0.0001 577 | 3/21
21 h-m-p 0.0001 0.0007 97.6458 YCCCC 2170.149062 4 0.0003 608 | 3/21
22 h-m-p 0.0000 0.0001 253.4761 +YYYCCCCC 2166.719364 7 0.0001 644 | 3/21
23 h-m-p 0.0000 0.0000 1570.2437 +YYCCCC 2163.849754 5 0.0000 677 | 3/21
24 h-m-p 0.0000 0.0000 1280.8321 YCYCCC 2162.708676 5 0.0000 709 | 3/21
25 h-m-p 0.0001 0.0003 49.9681 YYC 2162.632872 2 0.0001 735 | 3/21
26 h-m-p 0.0001 0.0017 31.1946 CC 2162.588201 1 0.0001 761 | 3/21
27 h-m-p 0.0002 0.0028 21.9757 YC 2162.567252 1 0.0001 786 | 3/21
28 h-m-p 0.0107 1.5591 0.2570 +++YCCC 2160.071049 3 0.5853 818 | 3/21
29 h-m-p 0.1513 0.7565 0.4332 CCCC 2159.113830 3 0.1888 866 | 3/21
30 h-m-p 0.3125 1.7957 0.2617 YCCC 2158.755375 3 0.7442 913 | 3/21
31 h-m-p 0.1661 0.8307 0.6575 CCCC 2158.604171 3 0.2302 961 | 3/21
32 h-m-p 1.6000 8.0000 0.0588 YCCC 2158.522432 3 0.9070 1008 | 3/21
33 h-m-p 1.2686 8.0000 0.0421 CC 2158.482856 1 1.1542 1052 | 3/21
34 h-m-p 1.6000 8.0000 0.0054 CC 2158.449863 1 1.3780 1096 | 3/21
35 h-m-p 0.4372 8.0000 0.0170 +C 2158.432457 0 1.7489 1139 | 3/21
36 h-m-p 1.6000 8.0000 0.0089 YC 2158.423614 1 2.5635 1182 | 3/21
37 h-m-p 1.6000 8.0000 0.0061 CC 2158.418878 1 2.2006 1226 | 3/21
38 h-m-p 1.6000 8.0000 0.0012 YC 2158.414262 1 3.0168 1269 | 3/21
39 h-m-p 1.6000 8.0000 0.0015 YC 2158.405694 1 3.6259 1312 | 3/21
40 h-m-p 1.6000 8.0000 0.0023 YC 2158.395665 1 3.2387 1355 | 3/21
41 h-m-p 1.6000 8.0000 0.0007 CC 2158.389803 1 1.7304 1399 | 3/21
42 h-m-p 0.5173 8.0000 0.0024 +YC 2158.388589 1 1.6665 1443 | 3/21
43 h-m-p 1.6000 8.0000 0.0013 C 2158.388468 0 1.3994 1485 | 3/21
44 h-m-p 1.6000 8.0000 0.0000 C 2158.388458 0 1.8931 1527 | 3/21
45 h-m-p 0.8400 8.0000 0.0001 C 2158.388457 0 1.2378 1569 | 3/21
46 h-m-p 1.6000 8.0000 0.0000 C 2158.388457 0 1.6150 1611 | 3/21
47 h-m-p 1.6000 8.0000 0.0000 C 2158.388457 0 0.5929 1653 | 3/21
48 h-m-p 0.8720 8.0000 0.0000 C 2158.388457 0 0.2549 1695 | 3/21
49 h-m-p 0.3443 8.0000 0.0000 Y 2158.388457 0 0.1440 1737 | 3/21
50 h-m-p 0.1867 8.0000 0.0000 Y 2158.388457 0 0.1867 1779 | 3/21
51 h-m-p 0.2572 8.0000 0.0000 ---Y 2158.388457 0 0.0010 1824
Out..
lnL = -2158.388457
1825 lfun, 5475 eigenQcodon, 65700 P(t)
Time used: 0:32
Model 2: PositiveSelection
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
initial w for M2:NSpselection reset.
0.020678 0.004641 0.001794 0.000967 0.007419 0.006114 0.036193 0.042762 0.007098 0.006288 0.020917 0.010193 0.003005 0.080255 0.022420 0.015703 0.018332 0.076131 2.165595 1.001601 0.301958 0.109127 2.014820
ntime & nrate & np: 18 3 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.671306
np = 23
lnL0 = -2324.733909
Iterating by ming2
Initial: fx= 2324.733909
x= 0.02068 0.00464 0.00179 0.00097 0.00742 0.00611 0.03619 0.04276 0.00710 0.00629 0.02092 0.01019 0.00300 0.08026 0.02242 0.01570 0.01833 0.07613 2.16559 1.00160 0.30196 0.10913 2.01482
1 h-m-p 0.0000 0.0000 890.4880 ++ 2322.681006 m 0.0000 28 | 1/23
2 h-m-p 0.0000 0.0000 470.8684 +YYCYC 2320.701685 4 0.0000 60 | 1/23
3 h-m-p 0.0000 0.0000 1645.3699 YCCC 2319.614243 3 0.0000 91 | 1/23
4 h-m-p 0.0000 0.0003 427.3637 +CYCCC 2316.210079 4 0.0001 125 | 1/23
5 h-m-p 0.0000 0.0002 514.2295 +YYCYCC 2309.671335 5 0.0001 159 | 1/23
6 h-m-p 0.0000 0.0000 1212.9408 ++ 2303.059043 m 0.0000 185 | 2/23
7 h-m-p 0.0001 0.0003 589.9143 CYCC 2302.036006 3 0.0001 216 | 2/23
8 h-m-p 0.0001 0.0008 297.8877 YCCC 2299.747619 3 0.0003 247 | 2/23
9 h-m-p 0.0000 0.0001 589.7204 YCCCC 2298.954840 4 0.0000 280 | 2/23
10 h-m-p 0.0000 0.0001 675.7280 +YYCCC 2296.948881 4 0.0001 313 | 2/23
11 h-m-p 0.0001 0.0012 807.8239 ++YCYCCC 2277.619320 5 0.0007 349 | 2/23
12 h-m-p 0.0001 0.0007 847.6890 +YCC 2266.015121 2 0.0005 379 | 2/23
13 h-m-p 0.0002 0.0008 261.3747 +YYCCC 2259.436423 4 0.0006 412 | 2/23
14 h-m-p 0.0002 0.0010 615.1858 YCCC 2249.851198 3 0.0004 443 | 2/23
15 h-m-p 0.0002 0.0008 211.7178 +YYCYCC 2241.682064 5 0.0005 477 | 2/23
16 h-m-p 0.0001 0.0004 373.3716 +YCYCCC 2235.405919 5 0.0002 512 | 2/23
17 h-m-p 0.0000 0.0001 361.9207 CYCCC 2234.467273 4 0.0000 545 | 2/23
18 h-m-p 0.0004 0.0027 41.7819 CCC 2234.091454 2 0.0004 575 | 2/23
19 h-m-p 0.0001 0.0005 317.7119 YCCC 2233.277506 3 0.0001 606 | 2/23
20 h-m-p 0.0072 0.1205 5.7752 ++YYYCYCC 2221.672202 6 0.1091 642 | 2/23
21 h-m-p 0.0106 0.0531 14.4565 +YCYCCC 2216.037496 5 0.0308 677 | 2/23
22 h-m-p 0.0432 0.2158 9.9059 +YCYCCC 2199.255676 5 0.1222 712 | 2/23
23 h-m-p 0.0709 0.3544 2.2974 +YCYCCC 2191.951409 5 0.2052 747 | 2/23
24 h-m-p 0.0835 0.4176 1.1611 +YYYCCC 2183.399829 5 0.3186 781 | 2/23
25 h-m-p 0.0231 0.1154 4.5428 CCCCC 2180.460406 4 0.0338 815 | 2/23
26 h-m-p 0.0721 1.5335 2.1286 +YCCCC 2172.318357 4 0.6586 849 | 2/23
27 h-m-p 0.1795 0.8975 1.9215 YCCCC 2169.337296 4 0.4047 882 | 2/23
28 h-m-p 0.1963 0.9817 2.0810 YCCC 2168.052490 3 0.3487 913 | 2/23
29 h-m-p 0.2695 1.3477 1.3504 YCCC 2166.521887 3 0.5591 944 | 2/23
30 h-m-p 0.3707 1.8535 0.7053 CCCCC 2165.318466 4 0.5953 978 | 2/23
31 h-m-p 0.8017 5.4284 0.5237 CCCCC 2163.569432 4 1.3197 1033 | 2/23
32 h-m-p 0.6517 3.2584 0.6344 CCCCC 2162.182793 4 0.7554 1088 | 2/23
33 h-m-p 0.5335 2.6674 0.8618 CCCCC 2160.117513 4 0.9428 1143 | 2/23
34 h-m-p 1.2718 6.3589 0.3912 YYC 2159.360135 2 1.0766 1192 | 2/23
35 h-m-p 1.2805 6.6813 0.3289 CCC 2159.020816 2 1.2165 1243 | 2/23
36 h-m-p 1.6000 8.0000 0.2344 CC 2158.857144 1 1.4968 1292 | 2/23
37 h-m-p 1.6000 8.0000 0.2151 CC 2158.752986 1 1.5342 1341 | 2/23
38 h-m-p 1.3997 8.0000 0.2357 CCC 2158.659323 2 1.9258 1392 | 2/23
39 h-m-p 1.6000 8.0000 0.2645 CC 2158.602976 1 1.7032 1441 | 2/23
40 h-m-p 1.1542 8.0000 0.3903 YCC 2158.523228 2 2.2128 1491 | 2/23
41 h-m-p 1.6000 8.0000 0.4801 CC 2158.476313 1 1.4738 1540 | 2/23
42 h-m-p 1.6000 8.0000 0.2764 CYC 2158.462554 2 1.8145 1590 | 2/23
43 h-m-p 1.6000 8.0000 0.3079 CC 2158.450739 1 2.3275 1639 | 2/23
44 h-m-p 1.6000 8.0000 0.3618 CYC 2158.439388 2 1.8614 1689 | 2/23
45 h-m-p 1.6000 8.0000 0.3122 YC 2158.427251 1 2.8602 1737 | 2/23
46 h-m-p 1.6000 8.0000 0.1592 CC 2158.419274 1 2.3928 1786 | 2/23
47 h-m-p 1.6000 8.0000 0.0083 +YC 2158.400262 1 5.0164 1835 | 2/23
48 h-m-p 0.2519 8.0000 0.1656 +YC 2158.393083 1 1.6262 1884 | 2/23
49 h-m-p 1.6000 8.0000 0.1683 YC 2158.390284 1 3.5825 1932 | 2/23
50 h-m-p 1.4771 8.0000 0.4082 CC 2158.388534 1 2.0054 1981 | 2/23
51 h-m-p 1.6000 8.0000 0.3142 YC 2158.387312 1 3.1360 2029 | 2/23
52 h-m-p 1.6000 8.0000 0.3246 CC 2158.386684 1 2.4367 2078 | 2/23
53 h-m-p 1.6000 8.0000 0.3017 YC 2158.386230 1 3.5416 2126 | 2/23
54 h-m-p 1.6000 8.0000 0.2883 YC 2158.386049 1 2.6697 2174 | 2/23
55 h-m-p 1.6000 8.0000 0.3276 Y 2158.385955 0 2.7095 2221 | 2/23
56 h-m-p 1.6000 8.0000 0.3221 Y 2158.385903 0 3.6421 2268 | 2/23
57 h-m-p 1.6000 8.0000 0.4367 C 2158.385882 0 2.2523 2315 | 2/23
58 h-m-p 1.6000 8.0000 0.3921 Y 2158.385872 0 3.2990 2362 | 2/23
59 h-m-p 1.6000 8.0000 0.4248 Y 2158.385866 0 2.6980 2409 | 2/23
60 h-m-p 1.6000 8.0000 0.5048 Y 2158.385863 0 2.6572 2456 | 2/23
61 h-m-p 1.6000 8.0000 0.3027 C 2158.385863 0 1.7501 2503 | 2/23
62 h-m-p 1.5972 8.0000 0.3316 ++ 2158.385862 m 8.0000 2550 | 2/23
63 h-m-p 1.6000 8.0000 0.4161 C 2158.385862 0 1.3301 2597 | 2/23
64 h-m-p 1.1591 8.0000 0.4775 C 2158.385862 0 1.8523 2644 | 2/23
65 h-m-p 1.6000 8.0000 0.4545 Y 2158.385862 0 3.8340 2691 | 2/23
66 h-m-p 1.6000 8.0000 0.1483 C 2158.385862 0 1.6911 2738 | 2/23
67 h-m-p 0.6281 8.0000 0.3994 +Y 2158.385862 0 4.6337 2786 | 2/23
68 h-m-p 1.6000 8.0000 0.0554 Y 2158.385862 0 0.7435 2833 | 2/23
69 h-m-p 0.0519 8.0000 0.7939 +Y 2158.385862 0 0.4111 2881 | 2/23
70 h-m-p 1.6000 8.0000 0.1119 ----Y 2158.385862 0 0.0011 2932 | 2/23
71 h-m-p 0.0435 8.0000 0.0028 -------------N 2158.385862 0 0.0000 2992 | 2/23
72 h-m-p 0.0160 8.0000 0.0307 ------------Y 2158.385862 0 0.0000 3051 | 2/23
73 h-m-p 0.0160 8.0000 0.0003 -------------.. | 2/23
74 h-m-p 0.0077 3.8738 0.0047 ------------- | 2/23
75 h-m-p 0.0077 3.8738 0.0047 -------------
Out..
lnL = -2158.385862
3226 lfun, 12904 eigenQcodon, 174204 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2210.376790 S = -2183.010579 -18.939766
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 139 patterns 1:26
did 20 / 139 patterns 1:26
did 30 / 139 patterns 1:26
did 40 / 139 patterns 1:26
did 50 / 139 patterns 1:26
did 60 / 139 patterns 1:26
did 70 / 139 patterns 1:26
did 80 / 139 patterns 1:26
did 90 / 139 patterns 1:26
did 100 / 139 patterns 1:26
did 110 / 139 patterns 1:26
did 120 / 139 patterns 1:26
did 130 / 139 patterns 1:26
did 139 / 139 patterns 1:26
Time used: 1:26
Model 3: discrete
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
0.020678 0.004641 0.001794 0.000967 0.007419 0.006114 0.036193 0.042762 0.007098 0.006288 0.020917 0.010193 0.003005 0.080255 0.022420 0.015703 0.018332 0.076131 2.165580 0.898262 0.025525 0.000050 0.000113 0.000175
ntime & nrate & np: 18 4 24
Bounds (np=24):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.189482
np = 24
lnL0 = -2162.986328
Iterating by ming2
Initial: fx= 2162.986328
x= 0.02068 0.00464 0.00179 0.00097 0.00742 0.00611 0.03619 0.04276 0.00710 0.00629 0.02092 0.01019 0.00300 0.08026 0.02242 0.01570 0.01833 0.07613 2.16558 0.89826 0.02553 0.00005 0.00011 0.00017
1 h-m-p 0.0000 0.0000 778.2909 ++ 2162.875327 m 0.0000 53 | 1/24
2 h-m-p 0.0000 0.0000 885.7169 ++ 2162.679342 m 0.0000 104 | 2/24
3 h-m-p 0.0000 0.0000 2199.3034 ++ 2162.571504 m 0.0000 154 | 3/24
4 h-m-p 0.0000 0.0000 2144.2435 ++ 2162.402595 m 0.0000 203 | 4/24
5 h-m-p 0.0000 0.0003 128.2104 +CC 2162.142403 1 0.0000 254 | 4/24
6 h-m-p 0.0001 0.0007 108.7294 CCC 2162.010542 2 0.0000 305 | 4/24
7 h-m-p 0.0000 0.0002 81.0989 CCY 2161.929773 2 0.0000 356 | 4/24
8 h-m-p 0.0001 0.0024 36.3306 YCC 2161.899012 2 0.0001 406 | 4/24
9 h-m-p 0.0001 0.0006 36.6427 YC 2161.879898 1 0.0000 454 | 4/24
10 h-m-p 0.0002 0.0038 7.7594 CC 2161.864847 1 0.0002 503 | 4/24
11 h-m-p 0.0001 0.0015 11.2078 CCC 2161.834981 2 0.0002 554 | 4/24
12 h-m-p 0.0000 0.0015 36.4960 CC 2161.772056 1 0.0001 603 | 4/24
13 h-m-p 0.0002 0.0024 11.4623 +CCCC 2160.871542 3 0.0010 657 | 4/24
14 h-m-p 0.0001 0.0004 63.5851 CCCC 2160.576243 3 0.0001 710 | 4/24
15 h-m-p 0.0002 0.0013 35.8075 CCC 2160.483108 2 0.0001 761 | 4/24
16 h-m-p 0.0003 0.0060 17.0989 CC 2160.468838 1 0.0001 810 | 4/24
17 h-m-p 0.0002 0.0036 11.6963 YC 2160.464381 1 0.0001 858 | 4/24
18 h-m-p 0.0006 0.0305 1.7053 C 2160.463939 0 0.0001 905 | 4/24
19 h-m-p 0.0013 0.6730 0.1746 ++++YYYCC 2159.014969 4 0.3307 961 | 4/24
20 h-m-p 0.2799 1.4198 0.2063 CCC 2158.545609 2 0.4259 1012 | 4/24
21 h-m-p 0.2565 5.3749 0.3425 CYC 2158.503664 2 0.3131 1062 | 4/24
22 h-m-p 0.8402 4.2011 0.0622 CCC 2158.408978 2 0.8630 1113 | 4/24
23 h-m-p 1.6000 8.0000 0.0096 YCC 2158.393787 2 0.9331 1163 | 4/24
24 h-m-p 0.4922 8.0000 0.0182 CC 2158.389498 1 0.6586 1212 | 4/24
25 h-m-p 1.0709 8.0000 0.0112 CC 2158.386609 1 1.4908 1261 | 4/24
26 h-m-p 1.6000 8.0000 0.0035 C 2158.385997 0 1.4423 1308 | 4/24
27 h-m-p 1.6000 8.0000 0.0019 C 2158.385880 0 1.7586 1355 | 4/24
28 h-m-p 1.6000 8.0000 0.0007 Y 2158.385863 0 1.2315 1402 | 4/24
29 h-m-p 1.6000 8.0000 0.0001 Y 2158.385862 0 1.0172 1449 | 4/24
30 h-m-p 1.6000 8.0000 0.0000 Y 2158.385862 0 1.0093 1496 | 4/24
31 h-m-p 1.6000 8.0000 0.0000 Y 2158.385862 0 0.6991 1543 | 4/24
32 h-m-p 1.6000 8.0000 0.0000 C 2158.385862 0 0.4290 1590 | 4/24
33 h-m-p 0.9460 8.0000 0.0000 C 2158.385862 0 0.2365 1637 | 4/24
34 h-m-p 0.3285 8.0000 0.0000 Y 2158.385862 0 0.1800 1684 | 4/24
35 h-m-p 0.2309 8.0000 0.0000 C 2158.385862 0 0.0577 1731
Out..
lnL = -2158.385862
1732 lfun, 6928 eigenQcodon, 93528 P(t)
Time used: 1:54
Model 7: beta
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
0.020678 0.004641 0.001794 0.000967 0.007419 0.006114 0.036193 0.042762 0.007098 0.006288 0.020917 0.010193 0.003005 0.080255 0.022420 0.015703 0.018332 0.076131 2.165580 0.649633 1.679063
ntime & nrate & np: 18 1 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 9.851450
np = 21
lnL0 = -2252.428472
Iterating by ming2
Initial: fx= 2252.428472
x= 0.02068 0.00464 0.00179 0.00097 0.00742 0.00611 0.03619 0.04276 0.00710 0.00629 0.02092 0.01019 0.00300 0.08026 0.02242 0.01570 0.01833 0.07613 2.16558 0.64963 1.67906
1 h-m-p 0.0000 0.0000 784.8707 ++ 2250.945882 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 380.4314 +YCYCCC 2250.039138 5 0.0000 101 | 1/21
3 h-m-p 0.0000 0.0000 819.8957 CCCC 2249.485175 3 0.0000 151 | 1/21
4 h-m-p 0.0000 0.0001 312.1424 YCC 2248.934657 2 0.0000 198 | 1/21
5 h-m-p 0.0000 0.0002 343.6563 YCCC 2247.741261 3 0.0001 247 | 1/21
6 h-m-p 0.0000 0.0002 265.2693 YCCCC 2246.097608 4 0.0001 298 | 1/21
7 h-m-p 0.0000 0.0002 866.0343 +YCCCC 2242.644900 4 0.0001 350 | 1/21
8 h-m-p 0.0000 0.0001 832.2449 +YYYCCC 2238.854700 5 0.0001 402 | 1/21
9 h-m-p 0.0000 0.0001 3089.6575 +YYYYCCC 2224.434772 6 0.0001 455 | 1/21
10 h-m-p 0.0000 0.0000 12249.2586 ++ 2195.900187 m 0.0000 499 | 2/21
11 h-m-p 0.0000 0.0001 923.1141 CCCCC 2195.196689 4 0.0000 551 | 2/21
12 h-m-p 0.0000 0.0001 653.8399 CCC 2194.584144 2 0.0000 598 | 2/21
13 h-m-p 0.0001 0.0003 115.2198 YYC 2194.225440 2 0.0000 643 | 2/21
14 h-m-p 0.0001 0.0003 102.3876 YCC 2194.069490 2 0.0000 689 | 2/21
15 h-m-p 0.0001 0.0015 53.5617 +CCCC 2193.610157 3 0.0004 739 | 2/21
16 h-m-p 0.0000 0.0007 483.4990 +
QuantileBeta(0.15, 0.00500, 2.21329) = 1.185101e-160 2000 rounds
YYCCCCC 2191.457087 6 0.0002 793 | 2/21
17 h-m-p 0.0002 0.0016 507.1848
QuantileBeta(0.15, 0.00500, 2.43166) = 1.054200e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.79251) = 8.911173e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.55917) = 9.902192e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.58250) = 9.793400e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.68750) = 9.331638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.74001) = 9.116595e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.64293) = 9.522248e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.64709) = 9.504125e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.66730) = 9.417098e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65047) = 9.489474e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.65888) = 9.453149e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
C 2177.682121 5 0.0013 846
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.488546e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65068) = 9.819788e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65082) = 9.487969e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.65055) = 9.489124e-161 2000 rounds
| 2/21
18 h-m-p 0.0000 0.0002 12347.8868
QuantileBeta(0.15, 0.00500, 3.09881) = 7.874966e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.44319) = 5.209286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21176) = 7.550875e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.87475) = 8.607270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15247) = 7.717632e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
C 2170.783202 2 0.0000 892
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.718783e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15207) = 7.988243e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15221) = 7.718365e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15192) = 7.719200e-161 2000 rounds
| 2/21
19 h-m-p 0.0013 0.0063 20.9856
QuantileBeta(0.15, 0.00500, 3.16526) = 7.681029e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15536) = 7.709310e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15671) = 7.705458e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.16098) = 7.693224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15691) = 7.704888e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.15895) = 7.699051e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
C 2170.701582 2 0.0005 939
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.704795e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15694) = 7.973767e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15708) = 7.704379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.15679) = 7.705212e-161 2000 rounds
| 2/21
20 h-m-p 0.0070 1.7539 1.3880
QuantileBeta(0.15, 0.00500, 3.15989) = 7.696348e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.16875) = 7.671115e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.20417) = 7.571810e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.34588) = 7.198920e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.89749) = 6.039914e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28611) = 7.351653e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.32219) = 7.258704e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.33811) = 7.218415e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.34515) = 7.200750e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.62168) = 6.568885e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36120) = 7.160784e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.49144) = 6.852130e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36720) = 7.145961e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.42932) = 6.995976e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36951) = 7.140283e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.39941) = 7.067396e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36992) = 7.139262e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.38467) = 7.103148e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
C 2166.159820 8 0.5046 998
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.139107e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36998) = 7.388331e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.37013) = 7.138737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.36983) = 7.139477e-161 2000 rounds
| 2/21
21 h-m-p 0.2372 1.1859 2.1848
QuantileBeta(0.15, 0.00500, 3.30620) = 7.299606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.11485) = 7.827277e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31786) = 7.269727e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.21052) = 7.554285e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31070) = 7.288052e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
C 2164.277936 2 0.2209 1044
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.288376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31057) = 7.542811e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31072) = 7.287994e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.31042) = 7.288758e-161 2000 rounds
| 2/21
22 h-m-p 0.4449 2.2247 0.1493
QuantileBeta(0.15, 0.00500, 3.25658) = 7.429522e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.09460) = 7.887590e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.23342) = 7.491743e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.16401) = 7.684599e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21676) = 7.537149e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.21525) = 7.541291e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.18963) = 7.612274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21400) = 7.544710e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.20182) = 7.578342e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
C 2161.331573 4 0.7966 1094
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.544988e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21390) = 7.808381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21405) = 7.544585e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21376) = 7.545391e-161 2000 rounds
| 2/21
23 h-m-p 0.7155 8.0000 0.1662
QuantileBeta(0.15, 0.00500, 3.30923) = 7.291806e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.59523) = 6.624515e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40801) = 7.046721e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.40437) = 7.055451e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.35680) = 7.171690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40146) = 7.062452e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.37913) = 7.116654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
C 2160.510934 3 1.4073 1142
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.062606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40140) = 7.309159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40155) = 7.062243e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.40125) = 7.062970e-161 2000 rounds
| 2/21
24 h-m-p 0.5069 2.5344 0.3023
QuantileBeta(0.15, 0.00500, 3.54539) = 6.731914e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97735) = 5.902240e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67223) = 6.465139e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.68399) = 6.441470e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.83067) = 6.160118e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70052) = 6.408487e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.76560) = 6.281858e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70209) = 6.405367e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.73384) = 6.343014e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
C 2159.677083 4 1.0599 1192
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.404607e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70248) = 6.628189e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70264) = 6.404294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70232) = 6.404920e-161 2000 rounds
| 2/21
25 h-m-p 1.5697 7.8484 0.2014
QuantileBeta(0.15, 0.00500, 4.01134) = 5.845524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.93791) = 4.631458e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92410) = 5.993332e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.92904) = 5.984761e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.97019) = 5.914326e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92695) = 5.988389e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
C 2159.166618 3 1.1408 1239
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 5.988393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92694) = 6.197446e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92711) = 5.988111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.92678) = 5.988675e-161 2000 rounds
| 2/21
26 h-m-p 0.8457 4.2285 0.1661
QuantileBeta(0.15, 0.00500, 4.05391) = 5.775993e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.43482) = 5.220294e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05938) = 5.767189e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.24710) = 5.480169e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07526) = 5.741746e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.16118) = 5.607918e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
C 2158.948076 2 0.9952 1286
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.740002e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07636) = 5.940384e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07652) = 5.739738e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.07619) = 5.740267e-161 2000 rounds
| 2/21
27 h-m-p 1.6000 8.0000 0.0956
QuantileBeta(0.15, 0.00500, 4.22301) = 5.515391e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.66299) = 4.935733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21496) = 5.527274e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.14566) = 5.631636e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523570e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
C 2158.789934 2 1.5395 1332
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.523568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21747) = 5.716394e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21764) = 5.523318e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.21730) = 5.523818e-161 2000 rounds
| 2/21
28 h-m-p 1.6000 8.0000 0.0746
QuantileBeta(0.15, 0.00500, 4.33422) = 5.356428e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.68448) = 4.910520e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.33924) = 5.349462e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.51186) = 5.120625e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34223) = 5.345329e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.42705) = 5.230571e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
C 2158.681210 2 1.7112 1379
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.345187e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34233) = 5.531786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34251) = 5.344950e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.34216) = 5.345425e-161 2000 rounds
| 2/21
29 h-m-p 1.6000 8.0000 0.0309
QuantileBeta(0.15, 0.00500, 4.35755) = 5.324227e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40321) = 5.262317e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35790) = 5.323753e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.38056) = 5.292857e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35862) = 5.322761e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.36959) = 5.307767e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
C 2158.622045 2 1.7156 1426
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.322718e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35865) = 5.508532e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35883) = 5.322482e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35848) = 5.322954e-161 2000 rounds
| 2/21
30 h-m-p 1.6000 8.0000 0.0164
QuantileBeta(0.15, 0.00500, 4.33635) = 5.353473e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.26944) = 5.447901e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30765) = 5.393566e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
C 2158.523866 1 3.6682 1470
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.393756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30752) = 5.582051e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30769) = 5.393515e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.30735) = 5.393997e-161 2000 rounds
| 2/21
31 h-m-p 1.5653 8.0000 0.0385
QuantileBeta(0.15, 0.00500, 4.36744) = 5.310693e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.54722) = 5.076139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39567) = 5.272443e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.47145) = 5.172434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
C 2158.461439 1 2.2671 1515
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.274274e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39431) = 5.458397e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39449) = 5.274041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.39414) = 5.274507e-161 2000 rounds
| 2/21
32 h-m-p 1.6000 8.0000 0.0460
QuantileBeta(0.15, 0.00500, 4.46748) = 5.177578e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.68698) = 4.907608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48891) = 5.149925e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.58794) = 5.025854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
C 2158.418849 1 2.0374 1560
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.151756e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48748) = 5.331602e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48765) = 5.151531e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48730) = 5.151981e-161 2000 rounds
| 2/21
33 h-m-p 1.6000 8.0000 0.0070
QuantileBeta(0.15, 0.00500, 4.49836) = 5.137816e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.53100) = 5.096446e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50052) = 5.135063e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.51576) = 5.115682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
C 2158.395230 1 1.9196 1605
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.135041e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50053) = 5.314304e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50071) = 5.134817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.50036) = 5.135265e-161 2000 rounds
| 2/21
34 h-m-p 0.9667 8.0000 0.0138
QuantileBeta(0.15, 0.00500, 4.48739) = 5.151866e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.44797) = 5.203006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47802) = 5.163942e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
C 2158.387974 1 1.6679 1649
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.164139e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47786) = 5.344418e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47804) = 5.163914e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47769) = 5.164365e-161 2000 rounds
| 2/21
35 h-m-p 1.6000 8.0000 0.0077
QuantileBeta(0.15, 0.00500, 4.46588) = 5.179654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.42993) = 5.226762e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
C 2158.386041 0 1.4629 1692
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.178322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46690) = 5.359095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46708) = 5.178095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.46673) = 5.178548e-161 2000 rounds
| 2/21
36 h-m-p 1.6000 8.0000 0.0031
QuantileBeta(0.15, 0.00500, 4.47173) = 5.172066e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48621) = 5.153388e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
Y 2158.385703 0 1.2781 1735
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.173323e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47076) = 5.353922e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47093) = 5.173097e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47059) = 5.173549e-161 2000 rounds
| 2/21
37 h-m-p 1.3668 8.0000 0.0029
QuantileBeta(0.15, 0.00500, 4.47474) = 5.168171e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48669) = 5.152777e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
C 2158.385629 0 1.7602 1778
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.166690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47589) = 5.347058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47606) = 5.166465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47571) = 5.166916e-161 2000 rounds
| 2/21
38 h-m-p 1.6000 8.0000 0.0004
QuantileBeta(0.15, 0.00500, 4.47524) = 5.167529e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47329) = 5.170046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
C 2158.385615 0 1.7886 1821
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.167628e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47516) = 5.348028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47534) = 5.167402e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47499) = 5.167854e-161 2000 rounds
| 2/21
39 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168046e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47387) = 5.169300e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
C 2158.385614 0 1.5879 1864
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168042e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.348457e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47467) = 5.168268e-161 2000 rounds
| 2/21
40 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47489) = 5.167985e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
C 2158.385614 0 2.2422 1907
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.348374e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47508) = 5.167736e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47473) = 5.168188e-161 2000 rounds
| 2/21
41 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47480) = 5.168099e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
Y 2158.385614 0 1.1144 1950
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.167986e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47488) = 5.348399e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47506) = 5.167760e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47471) = 5.168212e-161 2000 rounds
| 2/21
42 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47489) = 5.167978e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
Y 2158.385614 0 3.0571 1993
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.348383e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47507) = 5.167745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47472) = 5.168196e-161 2000 rounds
| 2/21
43 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167971e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167971e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
Y 2158.385614 0 0.0618 2037
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.348383e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47507) = 5.167745e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47472) = 5.168196e-161 2000 rounds
| 2/21
44 h-m-p 0.0400 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
C 2158.385614 0 0.1602 2081
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167970e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.348382e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47507) = 5.167744e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47472) = 5.168195e-161 2000 rounds
| 2/21
45 h-m-p 0.1188 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167968e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167963e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
C 2158.385614 0 0.1901 2124
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167967e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.348379e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47507) = 5.167741e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47472) = 5.168193e-161 2000 rounds
| 2/21
46 h-m-p 0.1374 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167964e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167955e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
Y 2158.385614 0 0.2530 2167
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.167962e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47490) = 5.348374e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47508) = 5.167736e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47473) = 5.168188e-161 2000 rounds
| 2/21
47 h-m-p 0.1871 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167956e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167939e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
Y 2158.385614 0 0.3117 2210
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.167952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47491) = 5.348364e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47509) = 5.167726e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47474) = 5.168178e-161 2000 rounds
| 2/21
48 h-m-p 0.2290 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167942e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47494) = 5.167912e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
Y 2158.385614 0 0.4055 2253
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.167934e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47492) = 5.348345e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47510) = 5.167709e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47475) = 5.168160e-161 2000 rounds
| 2/21
49 h-m-p 0.2924 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.47494) = 5.167916e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47498) = 5.167862e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
Y 2158.385614 0 0.5762 2296
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.167899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47495) = 5.348309e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47513) = 5.167673e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47478) = 5.168125e-161 2000 rounds
| 2/21
50 h-m-p 0.4010 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 4.47498) = 5.167863e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47506) = 5.167755e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
Y 2158.385614 0 0.9080 2339
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.167817e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47502) = 5.348224e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47519) = 5.167592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47484) = 5.168043e-161 2000 rounds
| 2/21
51 h-m-p 0.5705 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 4.47508) = 5.167736e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47527) = 5.167490e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.47590) = 5.166670e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
Y 2158.385614 0 1.7287 2383
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.167569e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47521) = 5.347968e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47538) = 5.167344e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47503) = 5.167795e-161 2000 rounds
| 2/21
52 h-m-p 0.8577 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 4.47540) = 5.167321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47598) = 5.166575e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.47700) = 5.165251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
Y 2158.385614 0 4.7128 2427
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.166203e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47626) = 5.346554e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47644) = 5.165977e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.47609) = 5.166429e-161 2000 rounds
| 2/21
53 h-m-p 1.2175 8.0000 0.0009
QuantileBeta(0.15, 0.00500, 4.47732) = 5.164836e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48050) = 5.160741e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
+ 2158.385613 m 8.0000 2470
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.157236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48322) = 5.337273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48339) = 5.157011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.48304) = 5.157461e-161 2000 rounds
| 2/21
54 h-m-p 0.1996 8.0000 0.0348
QuantileBeta(0.15, 0.00500, 4.49017) = 5.148299e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.51104) = 5.121673e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.59449) = 5.017862e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.76197) = 4.821692e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
C 2158.385611 0 2.7666 2515
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.036049e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57962) = 5.211856e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57980) = 5.035831e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.57944) = 5.036266e-161 2000 rounds
| 2/21
55 h-m-p 1.6000 8.0000 0.0487
QuantileBeta(0.15, 0.00500, 4.65756) = 4.942143e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.89139) = 4.680283e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
+ 2158.385590 m 8.0000 2558
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.599044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96934) = 4.759595e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96952) = 4.598854e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.96915) = 4.599233e-161 2000 rounds
| 2/21
56 h-m-p 0.2284 8.0000 1.7063
QuantileBeta(0.15, 0.00500, 5.35905) = 4.231707e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 6.52820) = 3.413404e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 11.20479) = 1.924038e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 18.62012) = 1.137037e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
Y 2158.385505 0 2.8179 2603
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.219665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77761) = 2.297153e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77789) = 2.219599e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 9.77734) = 2.219731e-161 2000 rounds
| 2/21
57 h-m-p 1.6000 8.0000 0.5189
QuantileBeta(0.15, 0.00500, 10.60782) = 2.037553e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.09844) = 1.635061e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
C 2158.385473 0 2.1463 2646
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 1.982031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89126) = 2.051223e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89156) = 1.981975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.89097) = 1.982087e-161 2000 rounds
| 2/21
58 h-m-p 1.0734 8.0000 1.0375
QuantileBeta(0.15, 0.00500, 12.00491) = 1.790344e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.34586) = 1.387682e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 19.19129) = 1.102304e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
C 2158.385440 0 3.9773 2690
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.419032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01770) = 1.468570e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01806) = 1.418997e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 15.01734) = 1.419067e-161 2000 rounds
| 2/21
59 h-m-p 1.6000 8.0000 1.2444
QuantileBeta(0.15, 0.00500, 17.00869) = 1.247975e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 22.98166) = 9.165119e-162 2000 rounds
+
QuantileBeta(0.15, 0.00500, 24.97265) = 8.419668e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
C 2158.385418 0 6.0524 2734
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.344857e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54913) = 9.671083e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54959) = 9.344660e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.54866) = 9.345054e-162 2000 rounds
| 2/21
60 h-m-p 1.6000 8.0000 3.3425
QuantileBeta(0.15, 0.00500, 27.89719) = 7.521090e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 43.94137) = 3.821709e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
Y 2158.385402 0 2.8191 2777
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 5.274912e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97224) = 6.775987e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97282) = 5.274815e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 31.97166) = 5.275010e-162 2000 rounds
| 2/21
61 h-m-p 1.6000 8.0000 4.3534
QuantileBeta(0.15, 0.00500, 38.93767) = 4.319148e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 59.83395) = 2.597828e-163 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
Y 2158.385392 0 3.3329 2820
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.610591e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48172) = 3.734060e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48246) = 3.610533e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 46.48098) = 3.610649e-162 2000 rounds
| 2/21
62 h-m-p 1.5397 7.6986 6.8218
QuantileBeta(0.15, 0.00500, 56.98538) = 7.435624e-163 2000 rounds
Y 2158.385385 0 3.2750 2863 | 2/21
63 h-m-p 0.6307 3.1533 9.5699 ++ 2158.385380 m 3.1533 2906 | 3/21
64 h-m-p 1.6000 8.0000 0.0003 Y 2158.385379 0 1.0299 2949 | 3/21
65 h-m-p 1.6000 8.0000 0.0000 --C 2158.385379 0 0.0250 2993
Out..
lnL = -2158.385379
2994 lfun, 32934 eigenQcodon, 538920 P(t)
Time used: 5:30
Model 8: beta&w>1
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
initial w for M8:NSbetaw>1 reset.
0.020678 0.004641 0.001794 0.000967 0.007419 0.006114 0.036193 0.042762 0.007098 0.006288 0.020917 0.010193 0.003005 0.080255 0.022420 0.015703 0.018332 0.076131 2.165564 0.900000 0.578325 1.546757 2.928793
ntime & nrate & np: 18 2 23
Bounds (np=23):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 6.893803
np = 23
lnL0 = -2289.707617
Iterating by ming2
Initial: fx= 2289.707617
x= 0.02068 0.00464 0.00179 0.00097 0.00742 0.00611 0.03619 0.04276 0.00710 0.00629 0.02092 0.01019 0.00300 0.08026 0.02242 0.01570 0.01833 0.07613 2.16556 0.90000 0.57833 1.54676 2.92879
1 h-m-p 0.0000 0.0000 1004.8299 ++ 2286.764557 m 0.0000 51 | 1/23
2 h-m-p 0.0000 0.0000 851.1522 +YCYYCCC 2280.764291 6 0.0000 110 | 1/23
3 h-m-p 0.0000 0.0000 8012.6845 +CCCY 2274.500683 3 0.0000 165 | 1/23
4 h-m-p 0.0000 0.0001 1306.7674 ++ 2252.400691 m 0.0001 213 | 2/23
5 h-m-p 0.0000 0.0002 228.9118 +YCYCC 2250.632006 4 0.0001 268 | 2/23
6 h-m-p 0.0000 0.0001 331.5233 YCCCC 2249.348454 4 0.0001 322 | 2/23
7 h-m-p 0.0000 0.0001 1028.9145 +YCCC 2246.292150 3 0.0001 375 | 2/23
8 h-m-p 0.0000 0.0002 852.7168 YCCC 2243.439641 3 0.0001 427 | 2/23
9 h-m-p 0.0000 0.0002 1120.9395 +YYCCCC 2234.983244 5 0.0001 483 | 2/23
10 h-m-p 0.0000 0.0001 3598.3794 ++ 2203.929301 m 0.0001 530 | 3/23
11 h-m-p 0.0000 0.0001 946.8411 CCCC 2202.264956 3 0.0000 583 | 3/23
12 h-m-p 0.0000 0.0000 1938.2292 YCCCC 2200.076430 4 0.0000 636 | 3/23
13 h-m-p 0.0000 0.0001 2216.0182 +YCCCC 2195.569237 4 0.0000 690 | 3/23
14 h-m-p 0.0001 0.0003 820.9789 CCC 2192.107967 2 0.0001 740 | 3/23
15 h-m-p 0.0003 0.0015 89.7975 CYCCC 2189.026144 4 0.0005 793 | 2/23
16 h-m-p 0.0001 0.0006 191.0393 YCCC 2187.849561 3 0.0001 844 | 2/23
17 h-m-p 0.0001 0.0007 63.3063 CCC 2187.553852 2 0.0002 895 | 2/23
18 h-m-p 0.0002 0.0025 39.0437 +YCCC 2187.009134 3 0.0007 948 | 2/23
19 h-m-p 0.0002 0.0019 116.7268 CCCC 2186.406827 3 0.0003 1001 | 2/23
20 h-m-p 0.0005 0.0028 65.9854 ++ 2182.238620 m 0.0028 1048 | 3/23
21 h-m-p 0.0045 0.0350 41.2124
QuantileBeta(0.15, 0.00500, 2.47331) = 1.032418e-160 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.14739) = 7.732249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.56022) = 9.897272e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.85380) = 8.682700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.00060) = 8.180122e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.72035) = 9.195961e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.72599) = 9.173040e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.78990) = 8.921184e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73438) = 9.139162e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.76214) = 9.028867e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
C 2173.244984 4 0.0247 1104
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.456453e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73494) = 9.136923e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73467) = 9.138011e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73480) = 9.137467e-161 2000 rounds
| 3/23
22 h-m-p 0.1615 0.8074 1.8016
QuantileBeta(0.15, 0.00500, 2.78498) = 8.940070e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93551) = 8.395642e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83351) = 8.757050e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.83918) = 8.736151e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.88734) = 8.562534e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84766) = 8.705061e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.86750) = 8.633213e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84865) = 8.701470e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.85807) = 8.667208e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84892) = 8.700486e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.85350) = 8.683815e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
C 2167.103115 5 0.3673 1159
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 9.004145e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84907) = 8.699914e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84880) = 8.700920e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.84894) = 8.700417e-161 2000 rounds
| 3/23
23 h-m-p 0.0770 0.3848 1.5945
QuantileBeta(0.15, 0.00500, 2.93268) = 8.405270e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.18390) = 7.628314e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04666) = 8.034110e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.04783) = 8.030498e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.11586) = 7.824269e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05621) = 8.004508e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.08604) = 7.913368e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05666) = 8.003102e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.07135) = 7.957984e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
C 2164.070477 4 0.1910 1212
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.282031e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05695) = 8.002219e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05666) = 8.003102e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05681) = 8.002661e-161 2000 rounds
| 3/23
24 h-m-p 0.0864 0.4318 1.6186
QuantileBeta(0.15, 0.00500, 3.02296) = 8.108587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92142) = 8.443777e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.88758) = 8.561711e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96579) = 8.293983e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.95252) = 8.338231e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.95041) = 8.345291e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.93592) = 8.394247e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94899) = 8.350074e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.94245) = 8.372103e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
C 2161.947713 4 0.2755 1265
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.642118e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94897) = 8.350129e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94869) = 8.351073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94883) = 8.350601e-161 2000 rounds
| 3/23
25 h-m-p 0.1010 0.5049 0.6407
QuantileBeta(0.15, 0.00500, 2.88932) = 8.555567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71076) = 9.235145e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83481) = 8.752250e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.83635) = 8.746570e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.77279) = 8.987261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
C 2161.208430 2 0.1940 1314
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 9.059073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83461) = 8.752984e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83433) = 8.754000e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.83447) = 8.753492e-161 2000 rounds
| 3/23
26 h-m-p 0.1732 1.6830 0.7176
QuantileBeta(0.15, 0.00500, 2.78787) = 8.928966e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.64806) = 9.499948e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77553) = 8.976602e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.71179) = 9.230918e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77809) = 8.966682e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
C 2160.612572 2 0.2092 1363
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 9.279296e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77833) = 8.965758e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77805) = 8.966814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.77819) = 8.966286e-161 2000 rounds
| 3/23
27 h-m-p 0.3410 1.7051 0.2464
QuantileBeta(0.15, 0.00500, 2.78290) = 8.948093e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.79702) = 8.893953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78504) = 8.939832e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.79103) = 8.916834e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78593) = 8.936404e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.78848) = 8.926608e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78606) = 8.935895e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.78727) = 8.931249e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
C 2159.914203 3 0.5720 1415
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 9.247760e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78622) = 8.935289e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78595) = 8.936339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78609) = 8.935814e-161 2000 rounds
| 3/23
28 h-m-p 0.2854 4.9030 0.4939
QuantileBeta(0.15, 0.00500, 2.74773) = 9.085800e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.63265) = 9.567318e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71517) = 9.217094e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.71623) = 9.212768e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.73198) = 9.148847e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71683) = 9.210299e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.72440) = 9.179471e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
C 2159.494333 3 0.5152 1466
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.531793e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71697) = 9.209715e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71670) = 9.210816e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.71684) = 9.210266e-161 2000 rounds
| 3/23
29 h-m-p 0.7227 3.6137 0.2957
QuantileBeta(0.15, 0.00500, 2.73433) = 9.139367e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.78681) = 8.933028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.72987) = 9.157354e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.73072) = 9.153921e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.73252) = 9.146638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
C 2159.067852 2 0.5741 1515
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.473419e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73087) = 9.153316e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73060) = 9.154407e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.73073) = 9.153861e-161 2000 rounds
| 3/23
30 h-m-p 1.1508 8.0000 0.1475
QuantileBeta(0.15, 0.00500, 2.87227) = 8.616131e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29687) = 7.323672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.94360) = 8.368234e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.12024) = 7.811376e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.93018) = 8.413784e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.90122) = 8.513763e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92862) = 8.419116e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.91492) = 8.466176e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
C 2158.663942 3 1.6084 1567
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.713303e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92868) = 8.418907e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92840) = 8.419863e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.92854) = 8.419385e-161 2000 rounds
| 3/23
31 h-m-p 1.4470 7.2349 0.0369
QuantileBeta(0.15, 0.00500, 2.96712) = 8.289591e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.08284) = 7.923032e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96007) = 8.312994e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.02498) = 8.102192e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96563) = 8.294507e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
Y 2158.498085 2 1.4027 1616
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.583030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96607) = 8.293040e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96579) = 8.293974e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.96593) = 8.293507e-161 2000 rounds
| 3/23
32 h-m-p 0.7143 8.0000 0.0724
QuantileBeta(0.15, 0.00500, 2.98716) = 8.223710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05083) = 8.021154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98552) = 8.229058e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.97573) = 8.261158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
C 2158.466110 1 0.6437 1664
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.517881e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98520) = 8.230094e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98492) = 8.231016e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.98506) = 8.230555e-161 2000 rounds
| 3/23
33 h-m-p 1.6000 8.0000 0.0194
QuantileBeta(0.15, 0.00500, 3.01556) = 8.132106e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.10707) = 7.850327e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02338) = 8.107248e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.06523) = 7.976731e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
C 2158.434437 1 2.0394 1712
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.388437e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02408) = 8.105027e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02380) = 8.105928e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02394) = 8.105477e-161 2000 rounds
| 3/23
34 h-m-p 1.6000 8.0000 0.0033
QuantileBeta(0.15, 0.00500, 3.02710) = 8.095485e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03657) = 8.065654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02854) = 8.090943e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.03255) = 8.078279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
C 2158.417143 1 2.3675 1760
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.373144e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02876) = 8.090251e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02847) = 8.091150e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02861) = 8.090700e-161 2000 rounds
| 3/23
35 h-m-p 0.6682 8.0000 0.0116
QuantileBeta(0.15, 0.00500, 3.02709) = 8.095521e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02251) = 8.110018e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.01034) = 8.148796e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02312) = 8.108073e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.02510) = 8.101792e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
C 2158.404181 1 2.4338 1809
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.391345e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02320) = 8.107837e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02291) = 8.108738e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02305) = 8.108288e-161 2000 rounds
| 3/23
36 h-m-p 1.6000 8.0000 0.0135
QuantileBeta(0.15, 0.00500, 3.02455) = 8.103552e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02903) = 8.089378e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02404) = 8.105163e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
C 2158.396158 1 1.0424 1856
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.388151e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02417) = 8.104751e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02389) = 8.105652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02403) = 8.105202e-161 2000 rounds
| 3/23
37 h-m-p 1.1327 8.0000 0.0124
QuantileBeta(0.15, 0.00500, 3.03464) = 8.071712e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06648) = 7.972873e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03584) = 8.067963e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.05116) = 8.020138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
C 2158.392163 1 1.2578 1904
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.349680e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03596) = 8.067581e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03567) = 8.068476e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03581) = 8.068028e-161 2000 rounds
| 3/23
38 h-m-p 1.6000 8.0000 0.0052
QuantileBeta(0.15, 0.00500, 3.04211) = 8.048308e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.06100) = 7.989717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053437e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
C 2158.391387 1 1.1841 1951
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.334568e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04062) = 8.052979e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04033) = 8.053871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04047) = 8.053425e-161 2000 rounds
| 3/23
39 h-m-p 1.6000 8.0000 0.0038
QuantileBeta(0.15, 0.00500, 3.03991) = 8.055190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03822) = 8.060489e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057028e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
C 2158.389798 1 3.2679 1998
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.338298e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03947) = 8.056584e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03918) = 8.057477e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03932) = 8.057030e-161 2000 rounds
| 3/23
40 h-m-p 1.6000 8.0000 0.0022
QuantileBeta(0.15, 0.00500, 3.03656) = 8.065675e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02829) = 8.091721e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
C 2158.389183 0 1.4995 2044
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.346682e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03688) = 8.064685e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03660) = 8.065579e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03674) = 8.065132e-161 2000 rounds
| 3/23
41 h-m-p 1.6000 8.0000 0.0009
QuantileBeta(0.15, 0.00500, 3.03698) = 8.064363e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03772) = 8.062058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
Y 2158.389137 0 1.2783 2090
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.346047e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03708) = 8.064071e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03679) = 8.064964e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03693) = 8.064517e-161 2000 rounds
| 3/23
42 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 3.03705) = 8.064164e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03739) = 8.063102e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
Y 2158.389134 0 1.2675 2136
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.345757e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03717) = 8.063790e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03688) = 8.064684e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03702) = 8.064237e-161 2000 rounds
| 3/23
43 h-m-p 1.0031 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 3.03707) = 8.064081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063612e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.03742) = 8.062992e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
C 2158.389132 0 4.3691 2183
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.345053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03738) = 8.063110e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03710) = 8.064004e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03724) = 8.063557e-161 2000 rounds
| 3/23
44 h-m-p 1.6000 8.0000 0.0006
QuantileBeta(0.15, 0.00500, 3.03723) = 8.063601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03718) = 8.063733e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
Y 2158.389130 0 2.7180 2229
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.345130e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03736) = 8.063185e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03707) = 8.064078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03722) = 8.063631e-161 2000 rounds
| 3/23
45 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063227e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03773) = 8.062015e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
C 2158.389130 0 1.6637 2275
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.344695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03749) = 8.062764e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03721) = 8.063658e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03735) = 8.063211e-161 2000 rounds
| 3/23
46 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 3.03741) = 8.063021e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03759) = 8.062452e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
Y 2158.389130 0 2.6569 2321
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.344369e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03759) = 8.062449e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03731) = 8.063343e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03745) = 8.062896e-161 2000 rounds
| 3/23
47 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 3.03748) = 8.062813e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03756) = 8.062563e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
+ 2158.389129 m 8.0000 2367
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.343938e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03773) = 8.062033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03744) = 8.062927e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03758) = 8.062480e-161 2000 rounds
| 3/23
48 h-m-p 0.4014 8.0000 0.0040
QuantileBeta(0.15, 0.00500, 3.03777) = 8.061897e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03833) = 8.060147e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.04056) = 8.053157e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.04129) = 8.050871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
Y 2158.389128 0 4.1698 2415
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.337672e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03966) = 8.055979e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03937) = 8.056871e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.03952) = 8.056425e-161 2000 rounds
| 3/23
49 h-m-p 1.5313 8.0000 0.0110
QuantileBeta(0.15, 0.00500, 3.04171) = 8.049578e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04827) = 8.029104e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
+ 2158.389105 m 8.0000 2461
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.300780e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05110) = 8.020335e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05081) = 8.021221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
| 3/23
50 h-m-p 0.1683 8.0000 0.5217
QuantileBeta(0.15, 0.00500, 3.03956) = 8.056273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04811) = 8.029622e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05024) = 8.022987e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05078) = 8.021330e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05091) = 8.020916e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05094) = 8.020812e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020786e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020780e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
-
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
Y 2158.389105 0 0.0000 2521
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.300780e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05110) = 8.020335e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05081) = 8.021221e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05095) = 8.020778e-161 2000 rounds
| 3/23
51 h-m-p 0.0160 8.0000 0.0168
QuantileBeta(0.15, 0.00500, 3.05099) = 8.020665e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05110) = 8.020328e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05153) = 8.018978e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05327) = 8.013582e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
C 2158.389101 0 0.3493 2569
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.298238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05189) = 8.017879e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05160) = 8.018765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05175) = 8.018322e-161 2000 rounds
| 3/23
52 h-m-p 0.6793 8.0000 0.0087
QuantileBeta(0.15, 0.00500, 3.05260) = 8.015664e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05517) = 8.007701e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
C 2158.389099 0 0.8248 2615
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.294899e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05293) = 8.014652e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05264) = 8.015537e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05279) = 8.015095e-161 2000 rounds
| 3/23
53 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 3.05275) = 8.015205e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05264) = 8.015537e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05261) = 8.015648e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
Y 2158.389098 0 5.3562 2662
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.295282e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05281) = 8.015022e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05252) = 8.015908e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05267) = 8.015465e-161 2000 rounds
| 3/23
54 h-m-p 0.8432 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 3.05263) = 8.015573e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05253) = 8.015896e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
+ 2158.389098 m 8.0000 2708
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.296340e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05248) = 8.016044e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05219) = 8.016930e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.05234) = 8.016487e-161 2000 rounds
| 3/23
55 h-m-p 0.9614 8.0000 0.0015
QuantileBeta(0.15, 0.00500, 3.05171) = 8.018436e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04982) = 8.024290e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
+ 2158.389097 m 8.0000 2754
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.313157e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04725) = 8.032293e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04696) = 8.033181e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.04711) = 8.032737e-161 2000 rounds
| 3/23
56 h-m-p 0.0279 3.3084 0.4164
QuantileBeta(0.15, 0.00500, 3.04175) = 8.049445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.02568) = 8.099985e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.96139) = 8.308618e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.70423) = 9.262063e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
+ 2158.388806 m 3.3084 2802
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.101693e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41262) = 1.064461e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41236) = 1.064600e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.41249) = 1.064531e-160 2000 rounds
| 4/23
57 h-m-p 0.8123 8.0000 0.7813
QuantileBeta(0.15, 0.00500, 3.04710) = 8.032741e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.95095) = 4.617956e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
C 2158.388328 0 1.0327 2848
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.792985e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21947) = 7.529710e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21918) = 7.530513e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21933) = 7.530111e-161 2000 rounds
| 4/23
58 h-m-p 1.6000 8.0000 0.0212
QuantileBeta(0.15, 0.00500, 3.25325) = 7.438404e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.35501) = 7.176153e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
+ 2158.388308 m 8.0000 2893
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.340385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38908) = 7.092412e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38878) = 7.093145e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.38893) = 7.092779e-161 2000 rounds
| 4/23
59 h-m-p 0.8063 8.0000 0.2103
QuantileBeta(0.15, 0.00500, 3.55853) = 6.703254e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.06734) = 5.754405e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
+ 2158.388191 m 8.0000 2938
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.653508e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07188) = 4.496352e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07151) = 4.496719e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.07170) = 4.496535e-161 2000 rounds
| 4/23
60 h-m-p 1.6000 8.0000 0.8898
QuantileBeta(0.15, 0.00500, 6.49531) = 3.432077e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.76616) = 2.006159e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
Y 2158.388113 0 3.0587 2983
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.921096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79346) = 2.822468e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79298) = 2.822654e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 7.79322) = 2.822561e-161 2000 rounds
| 4/23
61 h-m-p 1.6000 8.0000 0.8949
QuantileBeta(0.15, 0.00500, 9.22510) = 2.360035e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.52075) = 1.582066e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
Y 2158.388070 0 2.7255 3028
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.189953e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23260) = 2.116020e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23203) = 2.116142e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 10.23231) = 2.116081e-161 2000 rounds
| 4/23
62 h-m-p 1.6000 8.0000 1.3874
QuantileBeta(0.15, 0.00500, 12.45208) = 1.723414e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 19.11139) = 1.107034e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 21.33117) = 9.891067e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
Y 2158.388033 0 4.3107 3074
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.356931e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21316) = 1.311127e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21240) = 1.311190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 16.21278) = 1.311158e-161 2000 rounds
| 4/23
63 h-m-p 1.6000 8.0000 2.2855
QuantileBeta(0.15, 0.00500, 19.86958) = 1.063717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 30.83998) = 6.791720e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
Y 2158.388012 0 2.5897 3119
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.857705e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13204) = 9.524982e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13112) = 9.525386e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 22.13158) = 9.525184e-162 2000 rounds
| 4/23
64 h-m-p 1.6000 8.0000 2.9440
QuantileBeta(0.15, 0.00500, 26.84199) = 7.822303e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 40.97321) = 4.101948e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
Y 2158.387997 0 3.8654 3164
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.201010e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51181) = 5.028944e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51061) = 5.029126e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 33.51121) = 5.029035e-162 2000 rounds
| 4/23
65 h-m-p 1.6000 8.0000 4.9339
QuantileBeta(0.15, 0.00500, 41.40550) = 4.058604e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
Y 2158.387986 0 2.9666 3209
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 3.603473e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14898) = 2.084923e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14746) = 2.084989e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.14822) = 2.084956e-162 2000 rounds
| 4/23
66 h-m-p 1.5448 7.7240 6.5836
QuantileBeta(0.15, 0.00500, 58.31857) = 7.264183e-163 2000 rounds
Y 2158.387980 0 3.3158 3254 | 4/23
67 h-m-p 0.5626 2.8129 10.3174 ++ 2158.387975 m 2.8129 3299 | 5/23
68 h-m-p 1.6000 8.0000 0.0001 Y 2158.387974 0 0.9593 3344 | 5/23
69 h-m-p 1.6000 8.0000 0.0000 --Y 2158.387974 0 0.0250 3390
Out..
lnL = -2158.387974
3391 lfun, 40692 eigenQcodon, 671418 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2220.880119 S = -2183.010470 -29.184888
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 139 patterns 9:48
did 20 / 139 patterns 9:48
did 30 / 139 patterns 9:48
did 40 / 139 patterns 9:49
did 50 / 139 patterns 9:49
did 60 / 139 patterns 9:49
did 70 / 139 patterns 9:49
did 80 / 139 patterns 9:49
did 90 / 139 patterns 9:49
did 100 / 139 patterns 9:49
did 110 / 139 patterns 9:50
did 120 / 139 patterns 9:50
did 130 / 139 patterns 9:50
did 139 / 139 patterns 9:50
Time used: 9:50
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=364
D_melanogaster_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_sechellia_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_simulans_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_erecta_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_takahashii_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_biarmipes_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_suzukii_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_eugracilis_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_ficusphila_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_rhopaloa_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
D_elegans_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN
**************************************************
D_melanogaster_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_sechellia_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_simulans_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_erecta_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_takahashii_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_biarmipes_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_suzukii_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_eugracilis_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_ficusphila_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_rhopaloa_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
D_elegans_acj6-PF DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL
**************************************************
D_melanogaster_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_sechellia_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_simulans_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_erecta_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_takahashii_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_biarmipes_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_suzukii_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_eugracilis_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_ficusphila_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_rhopaloa_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
D_elegans_acj6-PF QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM
**************************************************
D_melanogaster_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_sechellia_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_simulans_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_erecta_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_takahashii_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_biarmipes_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_suzukii_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_eugracilis_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_ficusphila_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_rhopaloa_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
D_elegans_acj6-PF NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL
**************************************************
D_melanogaster_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_sechellia_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_simulans_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_erecta_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_takahashii_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_biarmipes_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_suzukii_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_eugracilis_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_ficusphila_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_rhopaloa_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
D_elegans_acj6-PF EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS
**************************************************
D_melanogaster_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_sechellia_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_simulans_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_erecta_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_takahashii_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_biarmipes_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_suzukii_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_eugracilis_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_ficusphila_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_rhopaloa_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
D_elegans_acj6-PF HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK
**************************************************
D_melanogaster_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_sechellia_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_simulans_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_erecta_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_takahashii_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_biarmipes_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_suzukii_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_eugracilis_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_ficusphila_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_rhopaloa_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
D_elegans_acj6-PF RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV
**************************************************
D_melanogaster_acj6-PF TPSMTGHGSAGFGY
D_sechellia_acj6-PF TPSMTGHGSAGFGY
D_simulans_acj6-PF TPSMTGHGSAGFGY
D_erecta_acj6-PF TPSMTGHGSAGFGY
D_takahashii_acj6-PF TPSMTGHGSAGFGY
D_biarmipes_acj6-PF TPSMTGHGSAGFGY
D_suzukii_acj6-PF TPSMTGHGSAGFGY
D_eugracilis_acj6-PF TPSMTGHGSAGFGY
D_ficusphila_acj6-PF TPSMTGHGSAGFGY
D_rhopaloa_acj6-PF TPSMTGHGSAGFGY
D_elegans_acj6-PF TPSMTGHGSAGFGY
**************
>D_melanogaster_acj6-PF ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATTAAGCACG ACGTCATGTACCATCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT CGCCGCTAACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCATACGGG GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCAG TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGATTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC CACAACAACATGATCGCCCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_sechellia_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC CACAACAATATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCTCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_simulans_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAACTGGA CATGCTGGATCCGACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC CACAACAACATGATCGCCCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCATCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_erecta_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCACCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTATCACCATCACTCCATGAGTGGGCCTCCCCAGCGTCCGTTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGATCCAACGGGCTCGATGACCACACTGGCGCCCATCTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACATCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCC CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_takahashii_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG CAGGAAAATCCCTTTTCCCGGCAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATTTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TAGCTGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GTGCGCTGTCGCAGAGCACGATCTGTCGCTTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCCGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCCGAAAAG CGTTCTTTGGAAGCCTACTTTGCCGTCCAGCCGAGGCCATCCGGTGAGAA AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_biarmipes_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCTCTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGACCCGACGGGCTCGATGACCACGCTGGCGCCCATCTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGTCACCATGGACACTCGGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGACGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGCTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCGTCCGGTGAGAA AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_suzukii_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGACGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGGATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCACTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGTCACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCAGCCGCTGGCCTGCATCCCGACACAGACACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGCTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACCCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGATCCGGACGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_eugracilis_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA TGCGTCGCTGTATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGCATACTCAGCAGAGCGGAGGCCTTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ATGTCATGTACCATCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGATCCAACGGGCTCAATGACCACGTTGGCGCCCATATCGGAGT CGCCTCTAACGCCAACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGCCACCATGGACACTCAGCGGTACATCATCCTGTTATCACAGCGGCAG TGGCAGCCGCTGGCCTGCATCCCGACACAGATACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGCGTTAC GCAGGCGGACGTGGGCAAAGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GAGCGCTGTCACAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCTGAGGCGCAGGCGAAAAACAAGAGGCGCGATCCCGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAA AATCGCAGCGATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCATCAATGACTGGCCACGGTTCAGCGGGATTTGGATAC >D_ficusphila_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTACCGAAGTTCGGAGCAGA TGCGCCGCTGCATGCCAAATCCGTCGGGTGATATCTTCGCGGGCATCAAC GATGGAATCCTCAGCAGAGCGGAGGCCTTGGCAGCCGTCGACATCCAGAA GCACCAAGCCCAGCACGTCCACAGCCAAATGCCCTCCCAGATCAAGCACG ACGTCATGTACCACCACCACTCCATGAGTGGGCCTCCCCAGCGTCCCCTG CAGGAAAATCCTTTCTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGACCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT CGCCGCTGACGCCCACACACCAACACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCTGCCGCTGGCCTGCATCCCGACACAGACACCGATCCCCGCGAGCTG GAGGCCTTCGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTAAAGTTACCTGGCGTCG GCGCGCTGTCGCAGAGCACGATCTGCAGGTTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGGCGCGACCCGGATGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCCCTGGAAGCCTACTTCGCCGTACAGCCGAGGCCATCCGGTGAGAA AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_rhopaloa_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GACGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGGAAAATCCTTTTTCCCGACAGATGCACCACTCGATGGACCAACTGGA CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATTTCGGAGT CCCCACTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGTTAAGTGGCCACACGGG GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCCCGCGAGCTG GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GCGCGCTGTCGCAGAGCACGATCTGTAGATTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGATCCGGACGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCCCTGGAAGCCTACTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAA AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC >D_elegans_acj6-PF ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA TGCGTCGCTGCATGCCAAATCCATCTGGTGATATCTTCGCGGGCATCAAC GATGGCATCCTCAGCAGAGCGGAGGCCCTGGCCGCCGTCGACATCCAGAA GCATCAAGCCCAGCATGTACATAGCCAAATGCCCTCCCAAATCAAGCACG ACGTCATGTACCACCATCACTCCATGAGTGGGCCCCCGCAACGTCCATTG CAGGAAAATCCTTTTTCTCGACAGATGCACCACTCGATGGACCAGCTGGA CATGCTGGATCCGACGGGCTCGATGACCACGTTGGCGCCCATCTCGGAGT CCCCTCTGACGCCCACACACCAGCACCTGCACGGTTCCTATCACAGCATG AATCACATGATGAGCCACCACCATCCGGGCACGCTAAGTGGCCACACGGG GGGACACCATGGACACTCAGCGGTACATCATCCTGTTATCACGGCGGCGG TGGCAGCCGCTGGCCTGCATCCCGACACCGACACCGATCCTCGCGAGCTG GAGGCGTTTGCGGAGCGGTTCAAGCAGCGGCGCATCAAGCTGGGTGTCAC GCAGGCGGACGTGGGCAAGGCCCTGGCCAATCTCAAGTTACCTGGCGTCG GCGCACTGTCGCAGAGCACGATCTGTCGATTCGAGAGCCTGACGCTGTCG CACAACAACATGATCGCCCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGA GGCCGAGGCGCAGGCGAAAAACAAGCGACGCGACCCGGACGCGCCCAGTG TCCTGCCGGCGGGCGAAAAGAAAAGGACTTCCATTGCGGCACCTGAAAAG CGTTCCCTGGAAGCCTACTTTGCCGTGCAGCCGAGGCCATCCGGTGAGAA AATCGCTGCCATTGCCGAAAAGCTGGATTTGAAGAAAAACGTGGTGCGCG TCTGGTTCTGCAATCAACGTCAAAAACAAAAACGTATAGTTAGTAGTGTA ACACCCTCAATGACTGGCCACGGTTCGGCGGGATTTGGATAC
>D_melanogaster_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_sechellia_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_simulans_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_erecta_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_takahashii_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_biarmipes_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_suzukii_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_eugracilis_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_ficusphila_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_rhopaloa_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY >D_elegans_acj6-PF MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSGDIFAGIN DGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHHHSMSGPPQRPL QENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPTHQHLHGSYHSM NHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGLHPDTDTDPREL EAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQSTICRFESLTLS HNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGEKKRTSIAAPEK RSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQRQKQKRIVSSV TPSMTGHGSAGFGY
#NEXUS
[ID: 4376139070]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_acj6-PF
D_sechellia_acj6-PF
D_simulans_acj6-PF
D_erecta_acj6-PF
D_takahashii_acj6-PF
D_biarmipes_acj6-PF
D_suzukii_acj6-PF
D_eugracilis_acj6-PF
D_ficusphila_acj6-PF
D_rhopaloa_acj6-PF
D_elegans_acj6-PF
;
end;
begin trees;
translate
1 D_melanogaster_acj6-PF,
2 D_sechellia_acj6-PF,
3 D_simulans_acj6-PF,
4 D_erecta_acj6-PF,
5 D_takahashii_acj6-PF,
6 D_biarmipes_acj6-PF,
7 D_suzukii_acj6-PF,
8 D_eugracilis_acj6-PF,
9 D_ficusphila_acj6-PF,
10 D_rhopaloa_acj6-PF,
11 D_elegans_acj6-PF
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.01686193,2:0.003143387,(3:0.001389047,(4:0.004487953,(5:0.03302293,((6:0.01912116,7:0.005905898)0.868:0.005763141,(9:0.09699484,(10:0.01106295,11:0.01577034)0.994:0.01704446)0.608:0.009219611)0.752:0.01092091,8:0.07212902)1.000:0.03031619)0.994:0.007514006)0.775:0.002877285);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.01686193,2:0.003143387,(3:0.001389047,(4:0.004487953,(5:0.03302293,((6:0.01912116,7:0.005905898):0.005763141,(9:0.09699484,(10:0.01106295,11:0.01577034):0.01704446):0.009219611):0.01092091,8:0.07212902):0.03031619):0.007514006):0.002877285);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2257.37 -2282.05
2 -2256.73 -2276.21
--------------------------------------
TOTAL -2257.00 -2281.36
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PF/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.389200 0.003138 0.287301 0.504191 0.384507 1405.33 1436.15 1.000
r(A<->C){all} 0.119417 0.001146 0.058768 0.190841 0.116106 795.84 908.99 1.000
r(A<->G){all} 0.251567 0.002956 0.147983 0.358029 0.247817 589.66 640.17 1.000
r(A<->T){all} 0.110706 0.001484 0.041559 0.187782 0.107179 757.43 817.06 1.000
r(C<->G){all} 0.065725 0.000407 0.030332 0.107925 0.063458 960.11 1006.60 1.000
r(C<->T){all} 0.441390 0.003780 0.323123 0.560051 0.441287 591.01 664.37 1.000
r(G<->T){all} 0.011194 0.000107 0.000002 0.031442 0.008227 921.04 1021.98 1.000
pi(A){all} 0.238453 0.000149 0.215876 0.262784 0.238250 986.36 1149.22 1.000
pi(C){all} 0.308173 0.000175 0.283215 0.334078 0.307752 1207.76 1210.44 1.000
pi(G){all} 0.270920 0.000168 0.245455 0.296428 0.271094 1117.11 1203.63 1.000
pi(T){all} 0.182454 0.000122 0.162519 0.205410 0.182323 1156.83 1195.96 1.000
alpha{1,2} 0.046441 0.000670 0.000113 0.086602 0.048221 1266.70 1325.95 1.000
alpha{3} 2.457735 0.659965 1.069537 4.040857 2.338692 1396.56 1448.78 1.000
pinvar{all} 0.746451 0.000694 0.695172 0.797072 0.747761 1101.42 1284.18 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/acj6-PF/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 364
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 4 4 5 4 | Ser TCT 3 3 2 2 2 2 | Tyr TAT 3 2 2 3 2 2 | Cys TGT 2 2 2 2 2 2
TTC 5 5 5 5 4 5 | TCC 7 7 8 8 7 7 | TAC 4 5 5 4 5 5 | TGC 2 2 2 2 2 2
Leu TTA 2 2 2 2 2 2 | TCA 2 2 2 2 3 2 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 2 2 2 2 2 1 | TCG 10 10 10 10 10 11 | TAG 0 0 0 0 0 0 | Trp TGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 1 0 0 0 0 0 | Pro CCT 6 6 6 6 3 6 | His CAT 11 9 9 9 9 9 | Arg CGT 5 5 5 5 4 3
CTC 3 4 4 3 3 3 | CCC 9 9 9 10 13 10 | CAC 15 17 17 17 17 17 | CGC 6 7 7 7 8 8
CTA 1 0 0 0 0 0 | CCA 5 5 5 5 5 3 | Gln CAA 9 9 9 8 9 9 | CGA 4 3 3 3 2 4
CTG 16 17 17 18 18 19 | CCG 7 7 7 6 6 8 | CAG 11 11 11 12 11 11 | CGG 2 2 2 2 3 2
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 2 2 3 2 | Thr ACT 2 2 2 2 2 2 | Asn AAT 5 6 5 5 5 5 | Ser AGT 8 8 8 8 8 8
ATC 11 12 12 12 11 12 | ACC 3 3 3 3 2 2 | AAC 5 4 5 5 5 5 | AGC 6 6 6 6 6 6
ATA 1 1 1 1 1 1 | ACA 5 5 5 5 4 4 | Lys AAA 9 9 9 9 9 9 | Arg AGA 1 1 1 1 1 1
Met ATG 19 19 19 19 19 19 | ACG 9 9 9 9 11 11 | AAG 11 11 11 11 11 11 | AGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 2 2 2 2 2 2 | Asp GAT 9 9 9 9 7 4 | Gly GGT 5 5 5 5 6 6
GTC 7 7 7 7 7 7 | GCC 12 12 12 12 12 13 | GAC 6 6 6 6 8 11 | GGC 9 9 9 9 10 10
GTA 3 3 3 3 4 3 | GCA 3 2 2 2 2 2 | Glu GAA 5 5 5 5 5 5 | GGA 7 7 7 7 5 5
GTG 4 4 4 4 3 4 | GCG 18 19 19 19 19 18 | GAG 11 11 11 11 11 11 | GGG 2 2 2 2 2 2
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 4 4 2 4 5 | Ser TCT 2 2 1 1 2 | Tyr TAT 2 2 1 2 2 | Cys TGT 2 3 1 2 2
TTC 5 5 7 5 4 | TCC 7 7 7 9 8 | TAC 5 5 6 5 5 | TGC 2 1 3 2 2
Leu TTA 2 2 2 2 1 | TCA 3 6 3 3 3 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 2 4 3 3 3 | TCG 10 7 11 9 9 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 0 0 0 | Pro CCT 5 6 5 4 6 | His CAT 9 10 5 9 9 | Arg CGT 4 5 4 5 5
CTC 3 3 2 3 3 | CCC 10 9 12 11 10 | CAC 17 16 21 17 17 | CGC 7 6 7 6 6
CTA 0 1 1 0 1 | CCA 5 8 3 6 5 | Gln CAA 9 8 6 9 8 | CGA 4 2 2 3 4
CTG 18 15 17 17 17 | CCG 7 4 7 6 6 | CAG 11 12 14 11 12 | CGG 2 2 3 2 2
----------------------------------------------------------------------------------------------------------------------
Ile ATT 3 2 3 3 2 | Thr ACT 2 2 2 2 2 | Asn AAT 5 5 5 5 5 | Ser AGT 8 8 8 8 8
ATC 11 10 11 11 12 | ACC 3 2 2 3 3 | AAC 5 5 5 5 5 | AGC 6 6 6 6 6
ATA 1 3 1 1 1 | ACA 4 5 4 3 3 | Lys AAA 9 9 8 8 8 | Arg AGA 1 2 1 2 1
Met ATG 19 19 19 19 19 | ACG 10 10 11 11 11 | AAG 11 11 12 12 12 | AGG 2 3 3 2 2
----------------------------------------------------------------------------------------------------------------------
Val GTT 2 3 2 2 2 | Ala GCT 2 2 3 2 2 | Asp GAT 7 10 6 6 6 | Gly GGT 6 4 5 5 5
GTC 7 5 7 7 6 | GCC 13 11 13 13 13 | GAC 8 5 9 9 9 | GGC 9 12 10 11 11
GTA 3 4 3 3 3 | GCA 2 4 2 2 3 | Glu GAA 5 5 5 5 5 | GGA 5 5 6 5 5
GTG 4 4 4 4 5 | GCG 18 18 17 18 17 | GAG 11 11 11 11 11 | GGG 3 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_acj6-PF
position 1: T:0.13187 C:0.30495 A:0.27473 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.19505 C:0.30220 A:0.15659 G:0.34615
Average T:0.18590 C:0.29670 A:0.24817 G:0.26923
#2: D_sechellia_acj6-PF
position 1: T:0.13187 C:0.30495 A:0.27473 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.18407 C:0.31593 A:0.14835 G:0.35165
Average T:0.18223 C:0.30128 A:0.24542 G:0.27106
#3: D_simulans_acj6-PF
position 1: T:0.13187 C:0.30495 A:0.27473 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.17857 C:0.32143 A:0.14835 G:0.35165
Average T:0.18040 C:0.30311 A:0.24542 G:0.27106
#4: D_erecta_acj6-PF
position 1: T:0.13187 C:0.30495 A:0.27473 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.18132 C:0.31868 A:0.14560 G:0.35440
Average T:0.18132 C:0.30220 A:0.24451 G:0.27198
#5: D_takahashii_acj6-PF
position 1: T:0.13187 C:0.30495 A:0.27473 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.17033 C:0.32967 A:0.14286 G:0.35714
Average T:0.17766 C:0.30586 A:0.24359 G:0.27289
#6: D_biarmipes_acj6-PF
position 1: T:0.12912 C:0.30769 A:0.27473 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.16209 C:0.33791 A:0.13736 G:0.36264
Average T:0.17399 C:0.30952 A:0.24176 G:0.27473
#7: D_suzukii_acj6-PF
position 1: T:0.13187 C:0.30495 A:0.27473 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.17308 C:0.32418 A:0.14560 G:0.35714
Average T:0.17857 C:0.30403 A:0.24451 G:0.27289
#8: D_eugracilis_acj6-PF
position 1: T:0.13736 C:0.29396 A:0.28022 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.18681 C:0.29670 A:0.17582 G:0.34066
Average T:0.18498 C:0.29121 A:0.25641 G:0.26740
#9: D_ficusphila_acj6-PF
position 1: T:0.13462 C:0.29945 A:0.27747 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.14560 C:0.35165 A:0.12912 G:0.37363
Average T:0.17033 C:0.31136 A:0.23993 G:0.27839
#10: D_rhopaloa_acj6-PF
position 1: T:0.13462 C:0.29945 A:0.27747 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.16484 C:0.33791 A:0.14286 G:0.35440
Average T:0.17674 C:0.30678 A:0.24451 G:0.27198
#11: D_elegans_acj6-PF
position 1: T:0.13187 C:0.30495 A:0.27473 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.17308 C:0.32967 A:0.14011 G:0.35714
Average T:0.17857 C:0.30586 A:0.24267 G:0.27289
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 44 | Ser S TCT 22 | Tyr Y TAT 23 | Cys C TGT 22
TTC 55 | TCC 82 | TAC 54 | TGC 22
Leu L TTA 21 | TCA 31 | *** * TAA 0 | *** * TGA 0
TTG 26 | TCG 107 | TAG 0 | Trp W TGG 22
------------------------------------------------------------------------------
Leu L CTT 1 | Pro P CCT 59 | His H CAT 98 | Arg R CGT 50
CTC 34 | CCC 112 | CAC 188 | CGC 75
CTA 4 | CCA 55 | Gln Q CAA 93 | CGA 34
CTG 189 | CCG 71 | CAG 127 | CGG 24
------------------------------------------------------------------------------
Ile I ATT 27 | Thr T ACT 22 | Asn N AAT 56 | Ser S AGT 88
ATC 125 | ACC 29 | AAC 54 | AGC 66
ATA 13 | ACA 47 | Lys K AAA 96 | Arg R AGA 13
Met M ATG 209 | ACG 111 | AAG 124 | AGG 24
------------------------------------------------------------------------------
Val V GTT 23 | Ala A GCT 23 | Asp D GAT 82 | Gly G GGT 57
GTC 74 | GCC 136 | GAC 83 | GGC 109
GTA 35 | GCA 26 | Glu E GAA 55 | GGA 64
GTG 44 | GCG 200 | GAG 121 | GGG 23
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.13262 C:0.30320 A:0.27572 G:0.28846
position 2: T:0.23077 C:0.28297 A:0.31319 G:0.17308
position 3: T:0.17408 C:0.32418 A:0.14660 G:0.35514
Average T:0.17915 C:0.30345 A:0.24517 G:0.27223
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_acj6-PF
D_sechellia_acj6-PF -1.0000 (0.0000 0.0358)
D_simulans_acj6-PF -1.0000 (0.0000 0.0358)-1.0000 (0.0000 0.0078)
D_erecta_acj6-PF -1.0000 (0.0000 0.0522)-1.0000 (0.0000 0.0277)-1.0000 (0.0000 0.0197)
D_takahashii_acj6-PF -1.0000 (0.0000 0.1544)-1.0000 (0.0000 0.1265)-1.0000 (0.0000 0.1265)-1.0000 (0.0000 0.1218)
D_biarmipes_acj6-PF -1.0000 (0.0000 0.1447)-1.0000 (0.0000 0.1171)-1.0000 (0.0000 0.1081)-1.0000 (0.0000 0.1036)-1.0000 (0.0000 0.0948)
D_suzukii_acj6-PF -1.0000 (0.0000 0.1309)-1.0000 (0.0000 0.1038)-1.0000 (0.0000 0.0949)-1.0000 (0.0000 0.0905)-1.0000 (0.0000 0.0905)-1.0000 (0.0000 0.0438)
D_eugracilis_acj6-PF -1.0000 (0.0000 0.1794)-1.0000 (0.0000 0.1845)-1.0000 (0.0000 0.1746)-1.0000 (0.0000 0.1696) 0.0069 (0.0012 0.1745)-1.0000 (0.0000 0.1741)-1.0000 (0.0000 0.1455)
D_ficusphila_acj6-PF -1.0000 (0.0000 0.2141)-1.0000 (0.0000 0.1889)-1.0000 (0.0000 0.1790)-1.0000 (0.0000 0.1739) 0.0062 (0.0012 0.1938)-1.0000 (0.0000 0.1687)-1.0000 (0.0000 0.1545)-1.0000 (0.0000 0.2415)
D_rhopaloa_acj6-PF -1.0000 (0.0000 0.1692)-1.0000 (0.0000 0.1454)-1.0000 (0.0000 0.1360)-1.0000 (0.0000 0.1406) 0.0102 (0.0012 0.1175)-1.0000 (0.0000 0.0949)-1.0000 (0.0000 0.0733)-1.0000 (0.0000 0.1651)-1.0000 (0.0000 0.1646)
D_elegans_acj6-PF -1.0000 (0.0000 0.1736)-1.0000 (0.0000 0.1497)-1.0000 (0.0000 0.1403)-1.0000 (0.0000 0.1356)-1.0000 (0.0000 0.1356)-1.0000 (0.0000 0.0903)-1.0000 (0.0000 0.0774)-1.0000 (0.0000 0.1647)-1.0000 (0.0000 0.1738)-1.0000 (0.0000 0.0481)
Model 0: one-ratio
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 20): -2158.434656 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023545 0.002846 0.002971 0.000004 0.009046 0.005644 0.042104 0.049313 0.013600 0.008651 0.026978 0.005919 0.009137 0.102731 0.015469 0.016466 0.020832 0.082446 2.166246 0.000100
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43770
(1: 0.023545, 2: 0.002846, (3: 0.000004, (4: 0.005644, (5: 0.049313, ((6: 0.026978, 7: 0.005919): 0.008651, (9: 0.102731, (10: 0.016466, 11: 0.020832): 0.015469): 0.009137): 0.013600, 8: 0.082446): 0.042104): 0.009046): 0.002971);
(D_melanogaster_acj6-PF: 0.023545, D_sechellia_acj6-PF: 0.002846, (D_simulans_acj6-PF: 0.000004, (D_erecta_acj6-PF: 0.005644, (D_takahashii_acj6-PF: 0.049313, ((D_biarmipes_acj6-PF: 0.026978, D_suzukii_acj6-PF: 0.005919): 0.008651, (D_ficusphila_acj6-PF: 0.102731, (D_rhopaloa_acj6-PF: 0.016466, D_elegans_acj6-PF: 0.020832): 0.015469): 0.009137): 0.013600, D_eugracilis_acj6-PF: 0.082446): 0.042104): 0.009046): 0.002971);
Detailed output identifying parameters
kappa (ts/tv) = 2.16625
omega (dN/dS) = 0.00010
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 822.9 269.1 0.0001 0.0000 0.0318 0.0 8.6
12..2 0.003 822.9 269.1 0.0001 0.0000 0.0038 0.0 1.0
12..13 0.003 822.9 269.1 0.0001 0.0000 0.0040 0.0 1.1
13..3 0.000 822.9 269.1 0.0001 0.0000 0.0000 0.0 0.0
13..14 0.009 822.9 269.1 0.0001 0.0000 0.0122 0.0 3.3
14..4 0.006 822.9 269.1 0.0001 0.0000 0.0076 0.0 2.1
14..15 0.042 822.9 269.1 0.0001 0.0000 0.0569 0.0 15.3
15..5 0.049 822.9 269.1 0.0001 0.0000 0.0667 0.0 17.9
15..16 0.014 822.9 269.1 0.0001 0.0000 0.0184 0.0 4.9
16..17 0.009 822.9 269.1 0.0001 0.0000 0.0117 0.0 3.1
17..6 0.027 822.9 269.1 0.0001 0.0000 0.0365 0.0 9.8
17..7 0.006 822.9 269.1 0.0001 0.0000 0.0080 0.0 2.2
16..18 0.009 822.9 269.1 0.0001 0.0000 0.0124 0.0 3.3
18..9 0.103 822.9 269.1 0.0001 0.0000 0.1389 0.0 37.4
18..19 0.015 822.9 269.1 0.0001 0.0000 0.0209 0.0 5.6
19..10 0.016 822.9 269.1 0.0001 0.0000 0.0223 0.0 6.0
19..11 0.021 822.9 269.1 0.0001 0.0000 0.0282 0.0 7.6
15..8 0.082 822.9 269.1 0.0001 0.0000 0.1115 0.0 30.0
tree length for dN: 0.0001
tree length for dS: 0.5919
Time used: 0:12
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 21): -2158.388457 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023547 0.002846 0.002971 0.000004 0.009046 0.005645 0.042107 0.049317 0.013601 0.008651 0.026980 0.005919 0.009137 0.102744 0.015471 0.016467 0.020833 0.082453 2.165595 0.999990 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43774
(1: 0.023547, 2: 0.002846, (3: 0.000004, (4: 0.005645, (5: 0.049317, ((6: 0.026980, 7: 0.005919): 0.008651, (9: 0.102744, (10: 0.016467, 11: 0.020833): 0.015471): 0.009137): 0.013601, 8: 0.082453): 0.042107): 0.009046): 0.002971);
(D_melanogaster_acj6-PF: 0.023547, D_sechellia_acj6-PF: 0.002846, (D_simulans_acj6-PF: 0.000004, (D_erecta_acj6-PF: 0.005645, (D_takahashii_acj6-PF: 0.049317, ((D_biarmipes_acj6-PF: 0.026980, D_suzukii_acj6-PF: 0.005919): 0.008651, (D_ficusphila_acj6-PF: 0.102744, (D_rhopaloa_acj6-PF: 0.016467, D_elegans_acj6-PF: 0.020833): 0.015471): 0.009137): 0.013601, D_eugracilis_acj6-PF: 0.082453): 0.042107): 0.009046): 0.002971);
Detailed output identifying parameters
kappa (ts/tv) = 2.16559
dN/dS (w) for site classes (K=2)
p: 0.99999 0.00001
w: 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 822.9 269.1 0.0000 0.0000 0.0319 0.0 8.6
12..2 0.003 822.9 269.1 0.0000 0.0000 0.0039 0.0 1.0
12..13 0.003 822.9 269.1 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 822.9 269.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 822.9 269.1 0.0000 0.0000 0.0122 0.0 3.3
14..4 0.006 822.9 269.1 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 822.9 269.1 0.0000 0.0000 0.0570 0.0 15.3
15..5 0.049 822.9 269.1 0.0000 0.0000 0.0667 0.0 18.0
15..16 0.014 822.9 269.1 0.0000 0.0000 0.0184 0.0 5.0
16..17 0.009 822.9 269.1 0.0000 0.0000 0.0117 0.0 3.1
17..6 0.027 822.9 269.1 0.0000 0.0000 0.0365 0.0 9.8
17..7 0.006 822.9 269.1 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 822.9 269.1 0.0000 0.0000 0.0124 0.0 3.3
18..9 0.103 822.9 269.1 0.0000 0.0000 0.1390 0.0 37.4
18..19 0.015 822.9 269.1 0.0000 0.0000 0.0209 0.0 5.6
19..10 0.016 822.9 269.1 0.0000 0.0000 0.0223 0.0 6.0
19..11 0.021 822.9 269.1 0.0000 0.0000 0.0282 0.0 7.6
15..8 0.082 822.9 269.1 0.0000 0.0000 0.1115 0.0 30.0
Time used: 0:32
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
check convergence..
lnL(ntime: 18 np: 23): -2158.385862 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023546 0.002846 0.002971 0.000004 0.009046 0.005644 0.042106 0.049316 0.013600 0.008651 0.026979 0.005919 0.009137 0.102741 0.015470 0.016467 0.020833 0.082451 2.165580 1.000000 0.000000 0.000001 24.217433
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43773
(1: 0.023546, 2: 0.002846, (3: 0.000004, (4: 0.005644, (5: 0.049316, ((6: 0.026979, 7: 0.005919): 0.008651, (9: 0.102741, (10: 0.016467, 11: 0.020833): 0.015470): 0.009137): 0.013600, 8: 0.082451): 0.042106): 0.009046): 0.002971);
(D_melanogaster_acj6-PF: 0.023546, D_sechellia_acj6-PF: 0.002846, (D_simulans_acj6-PF: 0.000004, (D_erecta_acj6-PF: 0.005644, (D_takahashii_acj6-PF: 0.049316, ((D_biarmipes_acj6-PF: 0.026979, D_suzukii_acj6-PF: 0.005919): 0.008651, (D_ficusphila_acj6-PF: 0.102741, (D_rhopaloa_acj6-PF: 0.016467, D_elegans_acj6-PF: 0.020833): 0.015470): 0.009137): 0.013600, D_eugracilis_acj6-PF: 0.082451): 0.042106): 0.009046): 0.002971);
Detailed output identifying parameters
kappa (ts/tv) = 2.16558
dN/dS (w) for site classes (K=3)
p: 1.00000 0.00000 0.00000
w: 0.00000 1.00000 24.21743
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 822.9 269.1 0.0000 0.0000 0.0319 0.0 8.6
12..2 0.003 822.9 269.1 0.0000 0.0000 0.0039 0.0 1.0
12..13 0.003 822.9 269.1 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 822.9 269.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 822.9 269.1 0.0000 0.0000 0.0122 0.0 3.3
14..4 0.006 822.9 269.1 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 822.9 269.1 0.0000 0.0000 0.0570 0.0 15.3
15..5 0.049 822.9 269.1 0.0000 0.0000 0.0667 0.0 18.0
15..16 0.014 822.9 269.1 0.0000 0.0000 0.0184 0.0 5.0
16..17 0.009 822.9 269.1 0.0000 0.0000 0.0117 0.0 3.1
17..6 0.027 822.9 269.1 0.0000 0.0000 0.0365 0.0 9.8
17..7 0.006 822.9 269.1 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 822.9 269.1 0.0000 0.0000 0.0124 0.0 3.3
18..9 0.103 822.9 269.1 0.0000 0.0000 0.1390 0.0 37.4
18..19 0.015 822.9 269.1 0.0000 0.0000 0.0209 0.0 5.6
19..10 0.016 822.9 269.1 0.0000 0.0000 0.0223 0.0 6.0
19..11 0.021 822.9 269.1 0.0000 0.0000 0.0282 0.0 7.6
15..8 0.082 822.9 269.1 0.0000 0.0000 0.1115 0.0 30.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_acj6-PF)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.457 0.113 0.070 0.058 0.053 0.051 0.050 0.050 0.049 0.049
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
sum of density on p0-p1 = 1.000000
Time used: 1:26
Model 3: discrete (3 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 24): -2158.385862 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023546 0.002846 0.002971 0.000004 0.009046 0.005644 0.042106 0.049316 0.013600 0.008651 0.026979 0.005919 0.009137 0.102741 0.015470 0.016467 0.020833 0.082451 2.165580 0.559254 0.230065 0.000001 0.000001 0.000001
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43773
(1: 0.023546, 2: 0.002846, (3: 0.000004, (4: 0.005644, (5: 0.049316, ((6: 0.026979, 7: 0.005919): 0.008651, (9: 0.102741, (10: 0.016467, 11: 0.020833): 0.015470): 0.009137): 0.013600, 8: 0.082451): 0.042106): 0.009046): 0.002971);
(D_melanogaster_acj6-PF: 0.023546, D_sechellia_acj6-PF: 0.002846, (D_simulans_acj6-PF: 0.000004, (D_erecta_acj6-PF: 0.005644, (D_takahashii_acj6-PF: 0.049316, ((D_biarmipes_acj6-PF: 0.026979, D_suzukii_acj6-PF: 0.005919): 0.008651, (D_ficusphila_acj6-PF: 0.102741, (D_rhopaloa_acj6-PF: 0.016467, D_elegans_acj6-PF: 0.020833): 0.015470): 0.009137): 0.013600, D_eugracilis_acj6-PF: 0.082451): 0.042106): 0.009046): 0.002971);
Detailed output identifying parameters
kappa (ts/tv) = 2.16558
dN/dS (w) for site classes (K=3)
p: 0.55925 0.23007 0.21068
w: 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 822.9 269.1 0.0000 0.0000 0.0319 0.0 8.6
12..2 0.003 822.9 269.1 0.0000 0.0000 0.0039 0.0 1.0
12..13 0.003 822.9 269.1 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 822.9 269.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 822.9 269.1 0.0000 0.0000 0.0122 0.0 3.3
14..4 0.006 822.9 269.1 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 822.9 269.1 0.0000 0.0000 0.0570 0.0 15.3
15..5 0.049 822.9 269.1 0.0000 0.0000 0.0667 0.0 18.0
15..16 0.014 822.9 269.1 0.0000 0.0000 0.0184 0.0 5.0
16..17 0.009 822.9 269.1 0.0000 0.0000 0.0117 0.0 3.1
17..6 0.027 822.9 269.1 0.0000 0.0000 0.0365 0.0 9.8
17..7 0.006 822.9 269.1 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 822.9 269.1 0.0000 0.0000 0.0124 0.0 3.3
18..9 0.103 822.9 269.1 0.0000 0.0000 0.1390 0.0 37.4
18..19 0.015 822.9 269.1 0.0000 0.0000 0.0209 0.0 5.6
19..10 0.016 822.9 269.1 0.0000 0.0000 0.0223 0.0 6.0
19..11 0.021 822.9 269.1 0.0000 0.0000 0.0282 0.0 7.6
15..8 0.082 822.9 269.1 0.0000 0.0000 0.1115 0.0 30.0
Naive Empirical Bayes (NEB) analysis
Time used: 1:54
Model 7: beta (10 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 21): -2158.385379 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023546 0.002846 0.002971 0.000004 0.009046 0.005644 0.042106 0.049316 0.013600 0.008651 0.026979 0.005919 0.009137 0.102741 0.015470 0.016467 0.020833 0.082451 2.165564 0.005000 99.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43773
(1: 0.023546, 2: 0.002846, (3: 0.000004, (4: 0.005644, (5: 0.049316, ((6: 0.026979, 7: 0.005919): 0.008651, (9: 0.102741, (10: 0.016467, 11: 0.020833): 0.015470): 0.009137): 0.013600, 8: 0.082451): 0.042106): 0.009046): 0.002971);
(D_melanogaster_acj6-PF: 0.023546, D_sechellia_acj6-PF: 0.002846, (D_simulans_acj6-PF: 0.000004, (D_erecta_acj6-PF: 0.005644, (D_takahashii_acj6-PF: 0.049316, ((D_biarmipes_acj6-PF: 0.026979, D_suzukii_acj6-PF: 0.005919): 0.008651, (D_ficusphila_acj6-PF: 0.102741, (D_rhopaloa_acj6-PF: 0.016467, D_elegans_acj6-PF: 0.020833): 0.015470): 0.009137): 0.013600, D_eugracilis_acj6-PF: 0.082451): 0.042106): 0.009046): 0.002971);
Detailed output identifying parameters
kappa (ts/tv) = 2.16556
Parameters in M7 (beta):
p = 0.00500 q = 99.00000
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 822.9 269.1 0.0000 0.0000 0.0319 0.0 8.6
12..2 0.003 822.9 269.1 0.0000 0.0000 0.0039 0.0 1.0
12..13 0.003 822.9 269.1 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 822.9 269.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 822.9 269.1 0.0000 0.0000 0.0122 0.0 3.3
14..4 0.006 822.9 269.1 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 822.9 269.1 0.0000 0.0000 0.0570 0.0 15.3
15..5 0.049 822.9 269.1 0.0000 0.0000 0.0667 0.0 18.0
15..16 0.014 822.9 269.1 0.0000 0.0000 0.0184 0.0 5.0
16..17 0.009 822.9 269.1 0.0000 0.0000 0.0117 0.0 3.1
17..6 0.027 822.9 269.1 0.0000 0.0000 0.0365 0.0 9.8
17..7 0.006 822.9 269.1 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 822.9 269.1 0.0000 0.0000 0.0124 0.0 3.3
18..9 0.103 822.9 269.1 0.0000 0.0000 0.1390 0.0 37.4
18..19 0.015 822.9 269.1 0.0000 0.0000 0.0209 0.0 5.6
19..10 0.016 822.9 269.1 0.0000 0.0000 0.0223 0.0 6.0
19..11 0.021 822.9 269.1 0.0000 0.0000 0.0282 0.0 7.6
15..8 0.082 822.9 269.1 0.0000 0.0000 0.1115 0.0 30.0
Time used: 5:30
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 2, (3, (4, (5, ((6, 7), (9, (10, 11))), 8)))); MP score: 141
lnL(ntime: 18 np: 23): -2158.387974 +0.000000
12..1 12..2 12..13 13..3 13..14 14..4 14..15 15..5 15..16 16..17 17..6 17..7 16..18 18..9 18..19 19..10 19..11 15..8
0.023547 0.002846 0.002971 0.000004 0.009046 0.005645 0.042107 0.049317 0.013601 0.008651 0.026980 0.005919 0.009137 0.102744 0.015471 0.016467 0.020833 0.082453 2.165586 0.999990 0.005000 99.000000 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.43774
(1: 0.023547, 2: 0.002846, (3: 0.000004, (4: 0.005645, (5: 0.049317, ((6: 0.026980, 7: 0.005919): 0.008651, (9: 0.102744, (10: 0.016467, 11: 0.020833): 0.015471): 0.009137): 0.013601, 8: 0.082453): 0.042107): 0.009046): 0.002971);
(D_melanogaster_acj6-PF: 0.023547, D_sechellia_acj6-PF: 0.002846, (D_simulans_acj6-PF: 0.000004, (D_erecta_acj6-PF: 0.005645, (D_takahashii_acj6-PF: 0.049317, ((D_biarmipes_acj6-PF: 0.026980, D_suzukii_acj6-PF: 0.005919): 0.008651, (D_ficusphila_acj6-PF: 0.102744, (D_rhopaloa_acj6-PF: 0.016467, D_elegans_acj6-PF: 0.020833): 0.015471): 0.009137): 0.013601, D_eugracilis_acj6-PF: 0.082453): 0.042107): 0.009046): 0.002971);
Detailed output identifying parameters
kappa (ts/tv) = 2.16559
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.00500 q = 99.00000
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 0.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.024 822.9 269.1 0.0000 0.0000 0.0319 0.0 8.6
12..2 0.003 822.9 269.1 0.0000 0.0000 0.0039 0.0 1.0
12..13 0.003 822.9 269.1 0.0000 0.0000 0.0040 0.0 1.1
13..3 0.000 822.9 269.1 0.0000 0.0000 0.0000 0.0 0.0
13..14 0.009 822.9 269.1 0.0000 0.0000 0.0122 0.0 3.3
14..4 0.006 822.9 269.1 0.0000 0.0000 0.0076 0.0 2.1
14..15 0.042 822.9 269.1 0.0000 0.0000 0.0570 0.0 15.3
15..5 0.049 822.9 269.1 0.0000 0.0000 0.0667 0.0 18.0
15..16 0.014 822.9 269.1 0.0000 0.0000 0.0184 0.0 5.0
16..17 0.009 822.9 269.1 0.0000 0.0000 0.0117 0.0 3.1
17..6 0.027 822.9 269.1 0.0000 0.0000 0.0365 0.0 9.8
17..7 0.006 822.9 269.1 0.0000 0.0000 0.0080 0.0 2.2
16..18 0.009 822.9 269.1 0.0000 0.0000 0.0124 0.0 3.3
18..9 0.103 822.9 269.1 0.0000 0.0000 0.1390 0.0 37.4
18..19 0.015 822.9 269.1 0.0000 0.0000 0.0209 0.0 5.6
19..10 0.016 822.9 269.1 0.0000 0.0000 0.0223 0.0 6.0
19..11 0.021 822.9 269.1 0.0000 0.0000 0.0282 0.0 7.6
15..8 0.082 822.9 269.1 0.0000 0.0000 0.1115 0.0 30.0
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_acj6-PF)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.017 0.146 0.837
ws: 0.707 0.082 0.039 0.029 0.026 0.024 0.023 0.023 0.023 0.023
Time used: 9:50
Model 1: NearlyNeutral -2158.388457 Model 2: PositiveSelection -2158.385862 Model 0: one-ratio -2158.434656 Model 3: discrete -2158.385862 Model 7: beta -2158.385379 Model 8: beta&w>1 -2158.387974 Model 0 vs 1 0.09239799999977549 Model 2 vs 1 0.005189999999856809 Model 8 vs 7 0.005190000000766304
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
