>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=10, Len=375
C1 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C2 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C3 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C4 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C5 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C6 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C7 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C8 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C9 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
C10 MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
**************************************************
C1 SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C2 SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C3 SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C4 SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C5 SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C6 SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C7 SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C8 SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C9 SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
C10 SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
*:************************************************
C1 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C2 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C3 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C4 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C5 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C6 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C7 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C8 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C9 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
C10 HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
**************************************************
C1 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C2 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C3 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C4 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C5 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C6 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C7 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C8 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C9 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
C10 HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
**************************************************
C1 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C2 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C3 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C4 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C5 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C6 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C7 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C8 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C9 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
C10 HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
**************************************************
C1 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C2 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C3 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C4 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C5 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C6 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C7 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C8 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C9 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
C10 TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
**************************************************
C1 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C2 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C3 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C4 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C5 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C6 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C7 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C8 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C9 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
C10 KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
**************************************************
C1 RQKQKRIVSSVTPSMTGHGSAGFGY
C2 RQKQKRIVSSVTPSMTGHGSAGFGY
C3 RQKQKRIVSSVTPSMTGHGSAGFGY
C4 RQKQKRIVSSVTPSMTGHGSAGFGY
C5 RQKQKRIVSSVTPSMTGHGSAGFGY
C6 RQKQKRIVSSVTPSMTGHGSAGFGY
C7 RQKQKRIVSSVTPSMTGHGSAGFGY
C8 RQKQKRIVSSVTPSMTGHGSAGFGY
C9 RQKQKRIVSSVTPSMTGHGSAGFGY
C10 RQKQKRIVSSVTPSMTGHGSAGFGY
*************************
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
ns S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 10 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 375 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 375 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [33750]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [33750]--->[33750]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/acj6-PE/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.618 Mb, Max= 31.588 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
FORMAT of file /tmp/tmp5936424180483920252aln Not Supported[FATAL:T-COFFEE]
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:375 S:100 BS:375
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# PW_SEQ_DISTANCES
BOT 0 1 100.00 C1 C2 100.00
TOP 1 0 100.00 C2 C1 100.00
BOT 0 2 100.00 C1 C3 100.00
TOP 2 0 100.00 C3 C1 100.00
BOT 0 3 100.00 C1 C4 100.00
TOP 3 0 100.00 C4 C1 100.00
BOT 0 4 100.00 C1 C5 100.00
TOP 4 0 100.00 C5 C1 100.00
BOT 0 5 100.00 C1 C6 100.00
TOP 5 0 100.00 C6 C1 100.00
BOT 0 6 100.00 C1 C7 100.00
TOP 6 0 100.00 C7 C1 100.00
BOT 0 7 99.73 C1 C8 99.73
TOP 7 0 99.73 C8 C1 99.73
BOT 0 8 99.73 C1 C9 99.73
TOP 8 0 99.73 C9 C1 99.73
BOT 0 9 99.73 C1 C10 99.73
TOP 9 0 99.73 C10 C1 99.73
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 100.00 C2 C4 100.00
TOP 3 1 100.00 C4 C2 100.00
BOT 1 4 100.00 C2 C5 100.00
TOP 4 1 100.00 C5 C2 100.00
BOT 1 5 100.00 C2 C6 100.00
TOP 5 1 100.00 C6 C2 100.00
BOT 1 6 100.00 C2 C7 100.00
TOP 6 1 100.00 C7 C2 100.00
BOT 1 7 99.73 C2 C8 99.73
TOP 7 1 99.73 C8 C2 99.73
BOT 1 8 99.73 C2 C9 99.73
TOP 8 1 99.73 C9 C2 99.73
BOT 1 9 99.73 C2 C10 99.73
TOP 9 1 99.73 C10 C2 99.73
BOT 2 3 100.00 C3 C4 100.00
TOP 3 2 100.00 C4 C3 100.00
BOT 2 4 100.00 C3 C5 100.00
TOP 4 2 100.00 C5 C3 100.00
BOT 2 5 100.00 C3 C6 100.00
TOP 5 2 100.00 C6 C3 100.00
BOT 2 6 100.00 C3 C7 100.00
TOP 6 2 100.00 C7 C3 100.00
BOT 2 7 99.73 C3 C8 99.73
TOP 7 2 99.73 C8 C3 99.73
BOT 2 8 99.73 C3 C9 99.73
TOP 8 2 99.73 C9 C3 99.73
BOT 2 9 99.73 C3 C10 99.73
TOP 9 2 99.73 C10 C3 99.73
BOT 3 4 100.00 C4 C5 100.00
TOP 4 3 100.00 C5 C4 100.00
BOT 3 5 100.00 C4 C6 100.00
TOP 5 3 100.00 C6 C4 100.00
BOT 3 6 100.00 C4 C7 100.00
TOP 6 3 100.00 C7 C4 100.00
BOT 3 7 99.73 C4 C8 99.73
TOP 7 3 99.73 C8 C4 99.73
BOT 3 8 99.73 C4 C9 99.73
TOP 8 3 99.73 C9 C4 99.73
BOT 3 9 99.73 C4 C10 99.73
TOP 9 3 99.73 C10 C4 99.73
BOT 4 5 100.00 C5 C6 100.00
TOP 5 4 100.00 C6 C5 100.00
BOT 4 6 100.00 C5 C7 100.00
TOP 6 4 100.00 C7 C5 100.00
BOT 4 7 99.73 C5 C8 99.73
TOP 7 4 99.73 C8 C5 99.73
BOT 4 8 99.73 C5 C9 99.73
TOP 8 4 99.73 C9 C5 99.73
BOT 4 9 99.73 C5 C10 99.73
TOP 9 4 99.73 C10 C5 99.73
BOT 5 6 100.00 C6 C7 100.00
TOP 6 5 100.00 C7 C6 100.00
BOT 5 7 99.73 C6 C8 99.73
TOP 7 5 99.73 C8 C6 99.73
BOT 5 8 99.73 C6 C9 99.73
TOP 8 5 99.73 C9 C6 99.73
BOT 5 9 99.73 C6 C10 99.73
TOP 9 5 99.73 C10 C6 99.73
BOT 6 7 99.73 C7 C8 99.73
TOP 7 6 99.73 C8 C7 99.73
BOT 6 8 99.73 C7 C9 99.73
TOP 8 6 99.73 C9 C7 99.73
BOT 6 9 99.73 C7 C10 99.73
TOP 9 6 99.73 C10 C7 99.73
BOT 7 8 100.00 C8 C9 100.00
TOP 8 7 100.00 C9 C8 100.00
BOT 7 9 100.00 C8 C10 100.00
TOP 9 7 100.00 C10 C8 100.00
BOT 8 9 100.00 C9 C10 100.00
TOP 9 8 100.00 C10 C9 100.00
AVG 0 C1 * 99.91
AVG 1 C2 * 99.91
AVG 2 C3 * 99.91
AVG 3 C4 * 99.91
AVG 4 C5 * 99.91
AVG 5 C6 * 99.91
AVG 6 C7 * 99.91
AVG 7 C8 * 99.79
AVG 8 C9 * 99.79
AVG 9 C10 * 99.79
TOT TOT * 99.88
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
C2 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C3 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C4 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C5 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C6 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C7 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C8 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C9 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
C10 ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
***************** ********************************
C1 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C2 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C3 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C4 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C5 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C6 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C7 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C8 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
C9 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
C10 CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
************************************************.*
C1 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT
C2 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT
C3 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT
C4 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT
C5 TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT
C6 TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT
C7 TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT
C8 TGCGTCGCTGTATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT
C9 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT
C10 TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT
****:***** **************************.***** ******
C1 TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGAATCCTCAGCAG
C2 TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGAATCCTCAGCAG
C3 TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGAATCCTCAGCAG
C4 TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGAATCCTCAGCAG
C5 TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGACGGCATCCTCAGCAG
C6 TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGACGGCATCCTCAGCAG
C7 TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGGATCCTCAGCAG
C8 TCAATCGAGGGTGATATCTTCGCGGGCATCAACGATGGCATACTCAGCAG
C9 TCTATCGAGGGTGATATCTTCGCGGGCATCAACGACGGCATCCTCAGCAG
C10 TCTATCGAGGGTGATATCTTCGCGGGCATCAACGATGGCATCCTCAGCAG
**:.******************************* ** **.********
C1 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCCCAGCATG
C2 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCCCAGCATG
C3 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCCCAGCATG
C4 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCCCAGCATG
C5 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
C6 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
C7 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
C8 AGCGGAGGCCTTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
C9 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
C10 AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
********** ************************* *************
C1 TACATAGCCAAATGCCCTCCCAAATTAAGCACGACGTCATGTACCATCAT
C2 TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
C3 TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
C4 TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTATCACCAT
C5 TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
C6 TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
C7 TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
C8 TACATAGCCAAATGCCCTCCCAAATCAAGCACGATGTCATGTACCATCAT
C9 TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
C10 TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
************************* ******** ******** ** ***
C1 CACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGGAAAATCCTTTTTC
C2 CACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGGAAAATCCTTTTTC
C3 CACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGGAAAATCCTTTTTC
C4 CACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGGAAAATCCTTTTTC
C5 CACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGGAAAATCCCTTTTC
C6 CACTCCATGAGTGGGCCCCCGCAACGTCCTCTGCAGGAAAATCCTTTTTC
C7 CACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGGAAAATCCTTTTTC
C8 CACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGGAAAATCCTTTTTC
C9 CACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGGAAAATCCTTTTTC
C10 CACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGGAAAATCCTTTTTC
***************** ** **.***** ************* *****
C1 TCGACAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGG
C2 TCGACAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGG
C3 TCGACAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGG
C4 TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGG
C5 CCGGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGG
C6 TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGG
C7 TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGG
C8 TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGG
C9 CCGACAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGG
C10 TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGG
**.***********************.************** **.****
C1 GCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTAACGCCCACA
C2 GCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACA
C3 GCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACA
C4 GCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACA
C5 GCTCGATGACCACGCTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACA
C6 GCTCGATGACCACGCTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACA
C7 GCTCGATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACA
C8 GCTCAATGACCACGTTGGCGCCCATATCGGAGTCGCCTCTAACGCCAACA
C9 GCTCGATGACCACGTTGGCGCCCATTTCGGAGTCCCCACTGACGCCCACA
C10 GCTCGATGACCACGTTGGCGCCCATCTCGGAGTCCCCTCTGACGCCCACA
****.********. ********** ******** ** **.*****.***
C1 CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C2 CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C3 CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C4 CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C5 CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C6 CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C7 CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C8 CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C9 CACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
C10 CACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
*****.********************************************
C1 CCACCATCCGGGCACGTTAAGTGGCCATACGGGGGGACATCATGGACACT
C2 CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACT
C3 CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACT
C4 CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACT
C5 CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACT
C6 CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACT
C7 CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACT
C8 CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGCCACCATGGACACT
C9 CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACT
C10 CCACCATCCGGGCACGCTAAGTGGCCACACGGGGGGACACCATGGACACT
**************** ********** ******** ** **********
C1 CGGCGGTACATCATCCTGTTATCACGGCGGCAGTGGCTGCCGCTGGCCTG
C2 CGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTG
C3 CGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTG
C4 CGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTG
C5 CAGCGGTACATCATCCTGTTATCACGGCGGCGGTAGCTGCCGCTGGCCTG
C6 CGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTG
C7 CAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTG
C8 CAGCGGTACATCATCCTGTTATCACAGCGGCAGTGGCAGCCGCTGGCCTG
C9 CAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTG
C10 CAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTG
*.***********************.*****.**.**:************
C1 CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
C2 CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
C3 CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
C4 CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
C5 CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
C6 CATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
C7 CATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
C8 CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
C9 CATCCCGACACCGACACCGATCCCCGCGAGCTGGAGGCGTTTGCGGAGCG
C10 CATCCCGACACCGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
***********.** ******** **************************
C1 ATTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
C2 CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
C3 CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
C4 CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
C5 CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
C6 CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
C7 CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
C8 GTTCAAGCAGCGGCGCATCAAGCTGGGCGTTACGCAGGCGGACGTGGGCA
C9 GTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
C10 GTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
************************** ** *******************
C1 AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
C2 AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
C3 AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
C4 AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
C5 AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAGAGC
C6 AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
C7 AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
C8 AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCACAGAGC
C9 AGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGC
C10 AGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCACTGTCGCAGAGC
*.******************************** **.*****.******
C1 ACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGC
C2 ACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAATATGATCGC
C3 ACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGC
C4 ACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGC
C5 ACGATCTGTCGCTTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
C6 ACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
C7 ACGATCTGTCGATTCGAGAGCCTGACCCTGTCGCACAACAACATGATCGC
C8 ACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
C9 ACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
C10 ACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
*********.*.************** ***** ******** ********
C1 CCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
C2 CCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
C3 CCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
C4 CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
C5 CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
C6 CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
C7 CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
C8 CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGGCGA
C9 CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
C10 CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
*** ******************************** *************
C1 AAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
C2 AAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
C3 AAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
C4 AAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
C5 AAAACAAGCGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
C6 AAAACAAGCGGCGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAA
C7 AAAACAAGCGGCGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAA
C8 AAAACAAGAGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
C9 AAAACAAGCGACGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAA
C10 AAAACAAGCGACGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAA
********.*.***** ** ** ***************************
C1 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTA
C2 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTA
C3 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
C4 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
C5 AAGAAAAGGACTTCCATTGCGGCACCCGAAAAGCGTTCTTTGGAAGCCTA
C6 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGCTCCCTGGAAGCCTA
C7 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
C8 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
C9 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
C10 AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
************************** ******** ** **********
C1 CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
C2 CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
C3 CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
C4 CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
C5 CTTTGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
C6 CTTCGCCGTCCAGCCGAGGCCGTCCGGTGAGAAAATCGCTGCCATTGCCG
C7 CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCG
C8 CTTCGCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
C9 CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCG
C10 CTTTGCCGTGCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCG
*** ***** ***********.*****************:** *******
C1 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C2 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C3 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C4 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C5 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C6 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C7 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C8 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C9 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
C10 AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
**************************************************
C1 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGG
C2 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGG
C3 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGG
C4 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
C5 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
C6 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
C7 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
C8 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGG
C9 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
C10 CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
**************************************.***********
C1 CCACGGTTCGGCGGGATTTGGATAC
C2 CCACGGTTCGGCGGGATTTGGATAC
C3 CCACGGTTCGGCGGGATTTGGATAC
C4 CCACGGTTCGGCGGGATTTGGATAC
C5 CCACGGTTCGGCGGGATTTGGATAC
C6 CCACGGTTCGGCGGGATTTGGATAC
C7 CCACGGTTCGGCGGGATTTGGATAC
C8 CCACGGTTCAGCGGGATTTGGATAC
C9 CCACGGTTCGGCGGGATTTGGATAC
C10 CCACGGTTCGGCGGGATTTGGATAC
*********.***************
>C1
ATGACAATGTCGATGTATTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT
TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGAATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATTAAGCACGACGTCATGTACCATCAT
CACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGGAAAATCCTTTTTC
TCGACAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGG
GCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTAACGCCCACA
CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCATACGGGGGGACATCATGGACACT
CGGCGGTACATCATCCTGTTATCACGGCGGCAGTGGCTGCCGCTGGCCTG
CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
ATTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
ACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGC
CCTTAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTA
CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C2
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT
TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGAATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
CACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGGAAAATCCTTTTTC
TCGACAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGG
GCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACA
CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACT
CGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTG
CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
ACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAATATGATCGC
CCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCTCTGGAAGCCTA
CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C3
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCCTGCGAT
TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGAATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
CACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGGAAAATCCTTTTTC
TCGACAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGG
GCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACA
CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACT
CGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTG
CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
ACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGC
CCTCAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C4
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT
TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGAATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCACCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTATCACCAT
CACTCCATGAGTGGGCCTCCCCAGCGTCCGTTGCAGGAAAATCCTTTTTC
TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGG
GCTCGATGACCACACTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACA
CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACATCATGGACACT
CGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCTGCCGCTGGCCTG
CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
ACGATCTGTCGATTCGAGAGCCTGACCCTGTCCCACAACAACATGATCGC
CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGGCGCGATCCGGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C5
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT
TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGACGGCATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
CACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGGAAAATCCCTTTTC
CCGGCAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGG
GCTCGATGACCACGCTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACA
CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACT
CAGCGGTACATCATCCTGTTATCACGGCGGCGGTAGCTGCCGCTGGCCTG
CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGTGCGCTGTCGCAGAGC
ACGATCTGTCGCTTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCCGAAAAGCGTTCTTTGGAAGCCTA
CTTTGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C6
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT
TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGACGGCATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
CACTCCATGAGTGGGCCCCCGCAACGTCCTCTGCAGGAAAATCCTTTTTC
TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGACCCGACGG
GCTCGATGACCACGCTGGCGCCCATCTCGGAGTCGCCGCTGACGCCCACA
CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACT
CGGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTG
CATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
ACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGGCGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGCTCCCTGGAAGCCTA
CTTCGCCGTCCAGCCGAGGCCGTCCGGTGAGAAAATCGCTGCCATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C7
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGACGCTGCATGCCAAATCCATCTATTCACATCTCGTCATCTTGCGAT
TCTCTCGAGGGTGATATCTTCGCGGGCATCAACGATGGGATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
CACTCCATGAGTGGGCCCCCGCAACGTCCACTGCAGGAAAATCCTTTTTC
TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGG
GCTCGATGACCACGTTGGCGCCCATTTCGGAGTCGCCGCTGACGCCCACA
CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGTCACCATGGACACT
CAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTG
CATCCCGACACAGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
CTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCGCAGAGC
ACGATCTGTCGATTCGAGAGCCTGACCCTGTCGCACAACAACATGATCGC
CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGGCGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C8
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAGA
TGCGTCGCTGTATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT
TCAATCGAGGGTGATATCTTCGCGGGCATCAACGATGGCATACTCAGCAG
AGCGGAGGCCTTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGATGTCATGTACCATCAT
CACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGGAAAATCCTTTTTC
TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCAACGG
GCTCAATGACCACGTTGGCGCCCATATCGGAGTCGCCTCTAACGCCAACA
CACCAACACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGCCACCATGGACACT
CAGCGGTACATCATCCTGTTATCACAGCGGCAGTGGCAGCCGCTGGCCTG
CATCCCGACACAGATACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
GTTCAAGCAGCGGCGCATCAAGCTGGGCGTTACGCAGGCGGACGTGGGCA
AAGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGAGCGCTGTCACAGAGC
ACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCTGAGGCGCAGGCGA
AAAACAAGAGGCGCGATCCCGATGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
CTTCGCCGTACAGCCGAGGCCATCCGGTGAGAAAATCGCAGCGATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCATCAATGACTGG
CCACGGTTCAGCGGGATTTGGATAC
>C9
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT
TCTATCGAGGGTGATATCTTCGCGGGCATCAACGACGGCATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
CACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGGAAAATCCTTTTTC
CCGACAGATGCACCACTCGATGGACCAACTGGACATGCTGGATCCGACGG
GCTCGATGACCACGTTGGCGCCCATTTCGGAGTCCCCACTGACGCCCACA
CACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGTTAAGTGGCCACACGGGGGGACACCATGGACACT
CAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTG
CATCCCGACACCGACACCGATCCCCGCGAGCTGGAGGCGTTTGCGGAGCG
GTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCGCTGTCGCAGAGC
ACGATCTGTAGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGACGCGATCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
CTTCGCCGTCCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C10
ATGACAATGTCGATGTACTCGACGACGGATAAAATGAAAATGTCAGCGCC
CAGTTGTTTTCCAGGACGCTACAGTCCCTCCTATCGAAGTTCGGAGCAAA
TGCGTCGCTGCATGCCAAATCCATCTATTCACATCTCATCATCTTGCGAT
TCTATCGAGGGTGATATCTTCGCGGGCATCAACGATGGCATCCTCAGCAG
AGCGGAGGCCCTGGCCGCCGTCGACATCCAGAAGCATCAAGCCCAGCATG
TACATAGCCAAATGCCCTCCCAAATCAAGCACGACGTCATGTACCACCAT
CACTCCATGAGTGGGCCCCCGCAACGTCCATTGCAGGAAAATCCTTTTTC
TCGACAGATGCACCACTCGATGGACCAGCTGGACATGCTGGATCCGACGG
GCTCGATGACCACGTTGGCGCCCATCTCGGAGTCCCCTCTGACGCCCACA
CACCAGCACCTGCACGGTTCCTATCACAGCATGAATCACATGATGAGCCA
CCACCATCCGGGCACGCTAAGTGGCCACACGGGGGGACACCATGGACACT
CAGCGGTACATCATCCTGTTATCACGGCGGCGGTGGCAGCCGCTGGCCTG
CATCCCGACACCGACACCGATCCTCGCGAGCTGGAGGCGTTTGCGGAGCG
GTTCAAGCAGCGGCGCATCAAGCTGGGTGTCACGCAGGCGGACGTGGGCA
AGGCCCTGGCCAATCTCAAGTTACCTGGCGTCGGCGCACTGTCGCAGAGC
ACGATCTGTCGATTCGAGAGCCTGACGCTGTCGCACAACAACATGATCGC
CCTGAAGCCCATCCTGCAGGCGTGGCTCGAGGAGGCCGAGGCGCAGGCGA
AAAACAAGCGACGCGACCCGGACGCGCCCAGTGTCCTGCCGGCGGGCGAA
AAGAAAAGGACTTCCATTGCGGCACCTGAAAAGCGTTCCCTGGAAGCCTA
CTTTGCCGTGCAGCCGAGGCCATCCGGTGAGAAAATCGCTGCCATTGCCG
AAAAGCTGGATTTGAAGAAAAACGTGGTGCGCGTCTGGTTCTGCAATCAA
CGTCAAAAACAAAAACGTATAGTTAGTAGTGTAACACCCTCAATGACTGG
CCACGGTTCGGCGGGATTTGGATAC
>C1
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C2
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C3
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C4
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C5
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C6
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C7
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SLEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C8
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C9
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
>C10
MTMSMYSTTDKMKMSAPSCFPGRYSPSYRSSEQMRRCMPNPSIHISSSCD
SIEGDIFAGINDGILSRAEALAAVDIQKHQAQHVHSQMPSQIKHDVMYHH
HSMSGPPQRPLQENPFSRQMHHSMDQLDMLDPTGSMTTLAPISESPLTPT
HQHLHGSYHSMNHMMSHHHPGTLSGHTGGHHGHSAVHHPVITAAVAAAGL
HPDTDTDPRELEAFAERFKQRRIKLGVTQADVGKALANLKLPGVGALSQS
TICRFESLTLSHNNMIALKPILQAWLEEAEAQAKNKRRDPDAPSVLPAGE
KKRTSIAAPEKRSLEAYFAVQPRPSGEKIAAIAEKLDLKKNVVRVWFCNQ
RQKQKRIVSSVTPSMTGHGSAGFGY
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 10 taxa and 1125 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479800165
Setting output file names to "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1392683696
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4548808046
Seed = 1970493799
Swapseed = 1479800165
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 12 unique site patterns
Division 2 has 4 unique site patterns
Division 3 has 60 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -3845.070056 -- -24.412588
Chain 2 -- -3861.422964 -- -24.412588
Chain 3 -- -3836.473505 -- -24.412588
Chain 4 -- -3895.682995 -- -24.412588
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -3864.331323 -- -24.412588
Chain 2 -- -3878.841652 -- -24.412588
Chain 3 -- -3896.399036 -- -24.412588
Chain 4 -- -3854.688446 -- -24.412588
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-3845.070] (-3861.423) (-3836.474) (-3895.683) * [-3864.331] (-3878.842) (-3896.399) (-3854.688)
500 -- [-2318.900] (-2328.151) (-2326.764) (-2313.856) * (-2313.703) (-2334.154) (-2330.473) [-2321.567] -- 0:00:00
1000 -- (-2302.100) [-2288.521] (-2310.546) (-2291.278) * (-2299.375) (-2292.976) [-2278.738] (-2297.693) -- 0:00:00
1500 -- [-2288.665] (-2279.646) (-2290.793) (-2278.614) * (-2275.015) (-2268.618) [-2257.381] (-2268.496) -- 0:00:00
2000 -- (-2281.833) [-2275.893] (-2276.107) (-2281.816) * (-2266.257) (-2261.800) [-2236.496] (-2268.107) -- 0:08:19
2500 -- (-2271.622) (-2255.995) [-2269.490] (-2288.196) * (-2238.681) (-2235.172) (-2231.426) [-2225.836] -- 0:06:39
3000 -- (-2260.693) [-2235.194] (-2251.375) (-2280.342) * [-2223.883] (-2233.785) (-2226.060) (-2223.600) -- 0:05:32
3500 -- (-2256.170) [-2233.122] (-2246.499) (-2273.972) * [-2210.438] (-2234.150) (-2221.896) (-2227.528) -- 0:04:44
4000 -- (-2250.633) [-2220.264] (-2233.346) (-2254.185) * [-2214.768] (-2240.650) (-2213.379) (-2235.905) -- 0:04:09
4500 -- (-2243.149) [-2209.851] (-2231.945) (-2261.185) * [-2216.922] (-2223.373) (-2222.832) (-2219.225) -- 0:03:41
5000 -- (-2228.972) (-2215.858) [-2213.908] (-2244.380) * [-2226.330] (-2219.983) (-2217.665) (-2222.800) -- 0:03:19
Average standard deviation of split frequencies: 0.073330
5500 -- [-2230.210] (-2210.877) (-2208.111) (-2262.569) * (-2219.354) (-2216.646) (-2208.301) [-2212.735] -- 0:06:01
6000 -- (-2227.386) (-2215.359) [-2218.375] (-2245.730) * (-2216.367) (-2221.249) [-2208.672] (-2217.559) -- 0:05:31
6500 -- (-2216.054) (-2213.856) [-2213.015] (-2244.966) * (-2213.565) (-2214.106) [-2208.777] (-2212.640) -- 0:05:05
7000 -- (-2213.404) (-2218.086) [-2207.246] (-2226.644) * (-2221.519) [-2210.040] (-2220.891) (-2216.166) -- 0:04:43
7500 -- (-2219.526) (-2222.923) [-2201.118] (-2221.640) * (-2214.927) (-2220.142) (-2220.833) [-2211.517] -- 0:04:24
8000 -- (-2217.098) (-2218.401) (-2216.860) [-2217.223] * [-2209.622] (-2218.994) (-2221.484) (-2212.394) -- 0:04:08
8500 -- [-2223.455] (-2221.702) (-2206.181) (-2218.935) * (-2211.391) (-2225.701) [-2207.812] (-2221.589) -- 0:03:53
9000 -- (-2218.991) (-2211.975) [-2218.748] (-2215.083) * (-2224.520) (-2213.585) (-2214.085) [-2214.641] -- 0:03:40
9500 -- (-2217.496) (-2212.023) (-2223.931) [-2208.433] * (-2211.353) [-2212.976] (-2216.686) (-2229.747) -- 0:05:12
10000 -- [-2214.494] (-2210.365) (-2203.184) (-2210.650) * (-2214.381) (-2220.303) (-2206.355) [-2212.196] -- 0:04:57
Average standard deviation of split frequencies: 0.066291
10500 -- (-2227.822) [-2204.929] (-2219.369) (-2216.901) * (-2216.571) (-2216.361) [-2217.572] (-2222.407) -- 0:04:42
11000 -- (-2237.241) (-2209.029) [-2208.776] (-2215.044) * (-2211.271) (-2218.188) [-2209.121] (-2207.084) -- 0:04:29
11500 -- (-2222.000) (-2215.865) [-2212.092] (-2225.291) * (-2215.320) (-2213.930) [-2217.509] (-2212.951) -- 0:04:17
12000 -- [-2218.766] (-2212.940) (-2211.437) (-2222.301) * [-2206.198] (-2233.696) (-2215.172) (-2209.563) -- 0:04:07
12500 -- (-2229.084) (-2210.749) (-2211.226) [-2220.151] * (-2208.390) [-2220.003] (-2214.768) (-2211.399) -- 0:03:57
13000 -- (-2221.631) (-2212.941) [-2205.336] (-2215.460) * (-2205.560) (-2223.475) (-2213.288) [-2208.862] -- 0:03:47
13500 -- (-2220.729) (-2210.457) (-2205.488) [-2202.970] * [-2209.315] (-2218.916) (-2212.318) (-2219.785) -- 0:04:52
14000 -- (-2213.201) (-2213.058) (-2212.201) [-2212.937] * [-2216.502] (-2220.915) (-2211.989) (-2216.241) -- 0:04:41
14500 -- (-2218.464) (-2212.907) (-2217.932) [-2211.540] * [-2212.094] (-2211.887) (-2219.469) (-2208.685) -- 0:04:31
15000 -- (-2211.070) (-2217.351) [-2205.558] (-2210.249) * (-2223.014) (-2219.522) (-2217.626) [-2204.336] -- 0:04:22
Average standard deviation of split frequencies: 0.047594
15500 -- (-2216.377) (-2218.535) (-2217.816) [-2208.034] * [-2213.166] (-2224.002) (-2209.975) (-2216.279) -- 0:04:14
16000 -- (-2217.245) (-2223.539) (-2215.990) [-2205.722] * (-2217.734) (-2214.310) (-2219.574) [-2218.214] -- 0:04:06
16500 -- [-2220.994] (-2213.992) (-2213.901) (-2221.031) * (-2221.085) (-2217.313) (-2226.150) [-2205.298] -- 0:03:58
17000 -- [-2207.013] (-2214.986) (-2224.128) (-2219.533) * (-2211.473) [-2214.633] (-2206.394) (-2222.024) -- 0:03:51
17500 -- (-2223.686) [-2207.880] (-2216.000) (-2210.295) * [-2210.489] (-2208.385) (-2211.676) (-2212.364) -- 0:04:40
18000 -- [-2208.723] (-2218.912) (-2218.662) (-2216.921) * (-2218.803) [-2203.882] (-2207.918) (-2210.085) -- 0:04:32
18500 -- (-2211.378) (-2217.712) (-2217.115) [-2210.995] * (-2225.506) [-2205.224] (-2211.618) (-2219.668) -- 0:04:25
19000 -- [-2207.205] (-2215.758) (-2212.154) (-2223.109) * (-2214.592) [-2206.824] (-2219.044) (-2213.211) -- 0:04:18
19500 -- (-2219.222) [-2213.715] (-2225.236) (-2215.692) * (-2220.258) (-2211.376) [-2206.607] (-2214.505) -- 0:04:11
20000 -- (-2219.786) (-2217.792) (-2213.944) [-2215.187] * (-2220.204) (-2212.841) [-2214.571] (-2219.720) -- 0:04:05
Average standard deviation of split frequencies: 0.045620
20500 -- (-2222.332) [-2212.207] (-2205.447) (-2221.348) * (-2206.628) [-2228.038] (-2207.745) (-2226.010) -- 0:04:46
21000 -- (-2217.386) (-2225.538) [-2212.670] (-2213.536) * [-2208.788] (-2214.002) (-2206.766) (-2223.506) -- 0:04:39
21500 -- (-2214.791) (-2218.611) (-2205.273) [-2212.463] * [-2210.782] (-2218.986) (-2220.961) (-2211.067) -- 0:04:33
22000 -- (-2207.978) [-2215.990] (-2206.793) (-2216.724) * (-2216.101) (-2213.474) [-2209.184] (-2209.453) -- 0:04:26
22500 -- (-2210.930) [-2211.418] (-2202.986) (-2226.900) * [-2202.649] (-2218.866) (-2205.460) (-2212.273) -- 0:04:20
23000 -- [-2207.224] (-2208.670) (-2207.649) (-2219.010) * (-2211.030) (-2215.319) (-2216.800) [-2210.906] -- 0:04:14
23500 -- (-2206.263) [-2215.992] (-2219.708) (-2219.496) * (-2213.575) (-2221.567) [-2206.167] (-2214.497) -- 0:04:50
24000 -- [-2216.228] (-2217.789) (-2217.376) (-2216.449) * (-2208.253) (-2214.102) [-2205.206] (-2208.822) -- 0:04:44
24500 -- (-2224.413) (-2216.998) (-2217.084) [-2210.642] * (-2221.706) (-2214.722) [-2212.885] (-2206.783) -- 0:04:38
25000 -- (-2214.441) (-2228.110) (-2220.376) [-2212.213] * (-2204.957) [-2207.780] (-2205.099) (-2212.631) -- 0:04:33
Average standard deviation of split frequencies: 0.034867
25500 -- (-2214.509) [-2205.872] (-2208.440) (-2214.287) * [-2211.344] (-2209.979) (-2205.815) (-2214.227) -- 0:04:27
26000 -- (-2211.965) (-2225.171) [-2217.678] (-2208.620) * (-2216.142) [-2205.796] (-2215.973) (-2209.469) -- 0:04:59
26500 -- (-2216.115) (-2208.286) (-2217.826) [-2208.580] * (-2216.025) (-2214.312) [-2214.709] (-2215.993) -- 0:04:53
27000 -- [-2219.485] (-2213.316) (-2209.811) (-2214.157) * [-2215.456] (-2207.552) (-2209.466) (-2218.727) -- 0:04:48
27500 -- (-2211.299) (-2211.853) [-2202.418] (-2225.273) * (-2207.483) (-2217.964) [-2209.097] (-2222.615) -- 0:04:42
28000 -- [-2207.379] (-2213.108) (-2213.830) (-2225.379) * (-2214.064) (-2210.537) [-2210.345] (-2220.965) -- 0:04:37
28500 -- [-2214.541] (-2211.908) (-2214.957) (-2224.270) * (-2219.058) [-2212.026] (-2212.490) (-2218.270) -- 0:04:32
29000 -- (-2221.575) [-2208.129] (-2210.439) (-2214.736) * (-2216.929) [-2209.015] (-2218.392) (-2217.659) -- 0:04:27
29500 -- [-2209.995] (-2209.428) (-2211.129) (-2221.113) * (-2212.963) (-2207.979) [-2211.419] (-2231.292) -- 0:04:56
30000 -- (-2217.553) (-2205.985) (-2216.891) [-2213.155] * (-2218.184) [-2219.278] (-2228.255) (-2213.313) -- 0:04:51
Average standard deviation of split frequencies: 0.039528
30500 -- (-2220.814) (-2209.920) (-2212.595) [-2212.435] * (-2224.408) (-2209.165) [-2209.179] (-2210.005) -- 0:04:46
31000 -- (-2214.024) (-2235.891) [-2215.232] (-2227.521) * (-2218.028) [-2208.727] (-2220.934) (-2214.029) -- 0:04:41
31500 -- (-2220.150) (-2218.591) [-2209.879] (-2228.665) * (-2222.374) (-2215.045) (-2212.808) [-2203.992] -- 0:04:36
32000 -- [-2204.420] (-2210.629) (-2218.877) (-2217.098) * [-2212.143] (-2217.526) (-2211.119) (-2209.642) -- 0:04:32
32500 -- (-2207.358) (-2212.592) [-2216.039] (-2216.512) * (-2208.103) (-2211.871) (-2211.169) [-2204.191] -- 0:04:27
33000 -- (-2222.808) [-2210.522] (-2221.025) (-2229.884) * (-2214.374) (-2219.082) (-2213.008) [-2212.913] -- 0:04:23
33500 -- (-2209.641) (-2215.156) [-2210.920] (-2216.686) * (-2212.155) (-2212.697) [-2217.106] (-2222.059) -- 0:04:48
34000 -- (-2217.462) (-2216.447) [-2214.073] (-2211.399) * (-2214.305) (-2208.191) [-2211.880] (-2224.199) -- 0:04:44
34500 -- (-2226.648) [-2215.133] (-2209.582) (-2211.729) * (-2215.733) (-2213.743) [-2208.602] (-2210.109) -- 0:04:39
35000 -- (-2203.276) [-2205.819] (-2210.856) (-2216.579) * (-2214.764) [-2216.035] (-2212.927) (-2219.732) -- 0:04:35
Average standard deviation of split frequencies: 0.038276
35500 -- (-2215.961) (-2213.041) (-2209.649) [-2220.616] * (-2218.800) (-2219.247) [-2202.604] (-2213.166) -- 0:04:31
36000 -- [-2212.220] (-2217.606) (-2220.847) (-2218.866) * (-2218.160) (-2217.815) (-2218.568) [-2213.039] -- 0:04:27
36500 -- [-2214.363] (-2208.446) (-2207.471) (-2221.542) * (-2213.204) (-2207.309) (-2212.754) [-2209.240] -- 0:04:50
37000 -- (-2210.686) (-2220.817) [-2209.236] (-2226.571) * [-2211.822] (-2207.730) (-2221.678) (-2215.988) -- 0:04:46
37500 -- (-2214.890) [-2208.161] (-2208.972) (-2236.490) * (-2214.796) [-2208.420] (-2216.090) (-2222.742) -- 0:04:42
38000 -- (-2216.460) (-2214.558) [-2210.165] (-2228.431) * (-2215.956) [-2216.559] (-2223.372) (-2207.663) -- 0:04:38
38500 -- [-2207.875] (-2218.225) (-2217.010) (-2223.952) * (-2218.451) (-2218.537) [-2217.156] (-2220.148) -- 0:04:34
39000 -- (-2204.667) (-2207.121) [-2210.737] (-2218.900) * (-2219.020) (-2212.662) (-2215.693) [-2212.390] -- 0:04:31
39500 -- (-2216.360) [-2206.274] (-2214.160) (-2215.045) * [-2216.724] (-2210.394) (-2217.102) (-2220.980) -- 0:04:51
40000 -- (-2216.117) (-2216.208) [-2214.444] (-2215.053) * (-2219.742) [-2208.312] (-2228.499) (-2213.204) -- 0:04:48
Average standard deviation of split frequencies: 0.038640
40500 -- (-2220.920) (-2208.587) [-2203.923] (-2217.087) * (-2215.433) (-2221.715) (-2220.274) [-2214.310] -- 0:04:44
41000 -- (-2226.178) (-2220.091) [-2209.118] (-2228.916) * (-2234.392) (-2210.526) (-2226.508) [-2217.548] -- 0:04:40
41500 -- (-2222.212) (-2227.784) (-2207.233) [-2215.219] * [-2216.042] (-2212.508) (-2216.769) (-2207.506) -- 0:04:37
42000 -- (-2216.445) (-2211.125) (-2212.300) [-2208.750] * [-2203.752] (-2210.544) (-2215.229) (-2214.549) -- 0:04:33
42500 -- (-2216.542) (-2222.988) [-2212.160] (-2215.830) * (-2207.017) (-2220.758) [-2209.839] (-2218.493) -- 0:04:30
43000 -- (-2221.855) (-2217.791) (-2212.782) [-2222.381] * [-2210.701] (-2221.012) (-2209.269) (-2214.078) -- 0:04:27
43500 -- (-2221.078) (-2219.199) [-2208.804] (-2222.977) * (-2229.893) (-2217.410) [-2207.204] (-2225.021) -- 0:04:45
44000 -- (-2225.896) [-2219.094] (-2225.085) (-2213.035) * (-2215.565) (-2210.985) [-2208.187] (-2217.843) -- 0:04:42
44500 -- [-2213.655] (-2222.867) (-2219.687) (-2218.098) * (-2214.097) [-2214.766] (-2209.309) (-2211.166) -- 0:04:39
45000 -- (-2217.396) (-2212.551) [-2221.424] (-2209.704) * (-2211.091) (-2207.692) (-2224.078) [-2215.088] -- 0:04:35
Average standard deviation of split frequencies: 0.038064
45500 -- (-2207.226) (-2212.349) (-2212.421) [-2208.742] * (-2212.847) (-2217.228) (-2217.230) [-2204.272] -- 0:04:32
46000 -- (-2222.131) (-2210.978) [-2207.221] (-2209.133) * (-2215.446) (-2217.986) (-2214.616) [-2212.191] -- 0:04:29
46500 -- (-2218.378) [-2208.674] (-2213.171) (-2216.944) * (-2208.261) [-2214.065] (-2213.482) (-2217.557) -- 0:04:47
47000 -- (-2212.718) (-2217.065) (-2230.962) [-2208.997] * (-2227.805) [-2209.819] (-2210.156) (-2214.661) -- 0:04:43
47500 -- (-2203.893) (-2215.441) [-2214.791] (-2231.338) * (-2205.718) [-2207.460] (-2209.722) (-2215.716) -- 0:04:40
48000 -- (-2229.103) (-2220.390) [-2212.888] (-2219.277) * (-2208.316) (-2216.584) [-2215.879] (-2221.238) -- 0:04:37
48500 -- [-2220.052] (-2227.209) (-2217.502) (-2218.041) * (-2214.744) [-2207.097] (-2215.360) (-2217.750) -- 0:04:34
49000 -- (-2217.217) (-2220.403) (-2213.893) [-2205.883] * [-2226.240] (-2223.085) (-2208.242) (-2219.779) -- 0:04:31
49500 -- (-2223.427) (-2214.929) [-2212.923] (-2224.323) * (-2219.078) (-2210.408) (-2211.083) [-2213.283] -- 0:04:28
50000 -- [-2213.834] (-2216.501) (-2209.333) (-2213.207) * (-2228.239) (-2205.709) [-2212.021] (-2219.366) -- 0:04:45
Average standard deviation of split frequencies: 0.030775
50500 -- (-2209.226) (-2220.056) [-2207.111] (-2222.123) * (-2220.640) (-2210.074) [-2208.189] (-2224.864) -- 0:04:42
51000 -- (-2213.836) (-2214.180) [-2206.538] (-2228.647) * (-2210.830) (-2210.049) (-2227.813) [-2214.321] -- 0:04:39
51500 -- [-2211.429] (-2216.332) (-2208.567) (-2219.714) * (-2222.548) [-2204.607] (-2218.981) (-2222.227) -- 0:04:36
52000 -- [-2208.940] (-2220.205) (-2209.074) (-2223.746) * (-2210.776) (-2220.195) (-2216.394) [-2211.385] -- 0:04:33
52500 -- (-2216.948) (-2213.326) [-2220.003] (-2216.535) * (-2212.490) [-2218.618] (-2216.270) (-2228.327) -- 0:04:30
53000 -- (-2218.948) (-2220.016) [-2215.411] (-2211.952) * (-2227.444) (-2216.317) [-2208.263] (-2210.641) -- 0:04:28
53500 -- (-2211.125) (-2209.428) [-2213.099] (-2211.000) * (-2220.253) (-2217.274) [-2218.483] (-2219.235) -- 0:04:43
54000 -- (-2212.035) (-2211.126) [-2212.227] (-2219.947) * (-2209.563) (-2207.817) [-2206.359] (-2217.121) -- 0:04:40
54500 -- (-2209.845) (-2226.483) (-2218.051) [-2216.367] * (-2211.052) (-2216.951) [-2203.778] (-2226.878) -- 0:04:37
55000 -- (-2212.832) (-2215.241) [-2214.539] (-2220.575) * (-2210.528) [-2209.002] (-2209.668) (-2213.152) -- 0:04:34
Average standard deviation of split frequencies: 0.032377
55500 -- (-2212.124) (-2225.762) (-2217.574) [-2205.541] * (-2219.033) (-2210.943) (-2237.560) [-2210.597] -- 0:04:32
56000 -- (-2209.352) (-2214.563) [-2204.621] (-2211.799) * (-2222.690) (-2220.763) [-2209.179] (-2228.475) -- 0:04:29
56500 -- (-2217.951) (-2231.005) (-2209.375) [-2215.027] * (-2211.156) (-2209.640) [-2208.239] (-2210.339) -- 0:04:43
57000 -- (-2216.461) (-2217.274) (-2210.393) [-2211.600] * (-2211.776) [-2210.227] (-2212.263) (-2222.269) -- 0:04:41
57500 -- [-2214.366] (-2216.563) (-2214.422) (-2215.631) * (-2209.496) [-2205.501] (-2208.936) (-2216.489) -- 0:04:38
58000 -- (-2208.186) [-2219.652] (-2208.519) (-2214.017) * [-2217.120] (-2222.096) (-2205.673) (-2218.783) -- 0:04:36
58500 -- [-2211.463] (-2209.573) (-2220.032) (-2205.462) * (-2222.631) (-2214.698) (-2205.398) [-2210.915] -- 0:04:33
59000 -- (-2215.689) (-2208.919) (-2215.176) [-2210.641] * [-2210.136] (-2209.826) (-2220.877) (-2216.258) -- 0:04:31
59500 -- (-2224.414) [-2212.846] (-2219.426) (-2214.609) * (-2217.413) (-2220.532) [-2207.171] (-2206.465) -- 0:04:28
60000 -- (-2216.431) (-2220.070) [-2210.571] (-2208.073) * (-2220.413) (-2220.480) (-2206.632) [-2212.260] -- 0:04:26
Average standard deviation of split frequencies: 0.031679
60500 -- [-2206.736] (-2210.111) (-2212.698) (-2212.016) * (-2219.262) [-2213.076] (-2209.884) (-2224.474) -- 0:04:39
61000 -- (-2209.709) (-2226.431) [-2214.132] (-2209.783) * (-2210.862) [-2216.509] (-2222.934) (-2215.520) -- 0:04:37
61500 -- (-2205.621) (-2223.241) [-2206.895] (-2214.119) * (-2208.202) (-2217.446) (-2210.674) [-2207.795] -- 0:04:34
62000 -- (-2220.173) [-2215.645] (-2207.511) (-2220.482) * [-2205.398] (-2218.580) (-2229.559) (-2203.661) -- 0:04:32
62500 -- (-2217.371) (-2234.365) [-2209.696] (-2209.921) * [-2210.450] (-2221.746) (-2219.828) (-2213.903) -- 0:04:30
63000 -- (-2210.171) (-2226.643) [-2216.436] (-2220.193) * (-2218.524) (-2218.611) (-2216.483) [-2213.321] -- 0:04:27
63500 -- (-2214.008) (-2211.855) [-2208.187] (-2214.959) * (-2211.309) (-2216.172) (-2215.846) [-2209.701] -- 0:04:25
64000 -- [-2214.141] (-2215.846) (-2226.661) (-2209.380) * (-2213.344) (-2214.945) (-2213.075) [-2211.010] -- 0:04:37
64500 -- (-2218.239) (-2218.967) [-2210.755] (-2209.200) * (-2221.063) (-2219.618) [-2220.040] (-2216.643) -- 0:04:35
65000 -- (-2219.966) (-2212.432) (-2215.787) [-2204.436] * (-2213.196) (-2218.976) (-2205.060) [-2209.702] -- 0:04:33
Average standard deviation of split frequencies: 0.029590
65500 -- (-2233.707) [-2206.888] (-2215.932) (-2218.359) * [-2211.838] (-2213.257) (-2210.816) (-2228.575) -- 0:04:31
66000 -- (-2219.135) (-2209.557) [-2206.639] (-2209.011) * (-2219.127) (-2212.100) [-2216.506] (-2227.427) -- 0:04:28
66500 -- (-2213.655) (-2217.221) [-2214.414] (-2217.849) * (-2215.497) [-2211.140] (-2218.627) (-2211.040) -- 0:04:26
67000 -- (-2214.646) [-2204.567] (-2216.465) (-2217.336) * (-2212.415) (-2217.329) [-2212.661] (-2216.454) -- 0:04:24
67500 -- (-2215.213) (-2209.466) [-2211.271] (-2217.553) * [-2209.000] (-2214.637) (-2216.381) (-2220.606) -- 0:04:36
68000 -- (-2219.360) [-2210.055] (-2205.986) (-2211.137) * [-2212.166] (-2216.134) (-2216.742) (-2215.754) -- 0:04:34
68500 -- [-2214.858] (-2214.009) (-2215.107) (-2223.080) * [-2219.800] (-2221.811) (-2212.478) (-2220.411) -- 0:04:31
69000 -- (-2217.419) (-2212.383) (-2215.282) [-2221.220] * (-2214.700) [-2207.390] (-2214.021) (-2212.612) -- 0:04:29
69500 -- (-2230.519) (-2222.174) [-2211.721] (-2207.317) * (-2215.905) (-2220.461) [-2209.324] (-2216.567) -- 0:04:27
70000 -- (-2217.598) (-2210.745) (-2228.864) [-2217.349] * [-2205.441] (-2222.234) (-2219.602) (-2219.481) -- 0:04:25
Average standard deviation of split frequencies: 0.020965
70500 -- (-2214.451) (-2215.218) (-2209.501) [-2210.267] * (-2220.794) [-2220.000] (-2214.851) (-2210.175) -- 0:04:23
71000 -- (-2219.321) (-2214.149) [-2203.530] (-2222.599) * (-2214.642) (-2230.663) (-2220.089) [-2210.235] -- 0:04:21
71500 -- (-2211.820) [-2210.081] (-2212.658) (-2219.002) * [-2205.913] (-2213.155) (-2214.353) (-2219.642) -- 0:04:32
72000 -- (-2225.860) (-2214.316) [-2209.199] (-2224.975) * (-2207.644) (-2215.202) [-2226.065] (-2217.157) -- 0:04:30
72500 -- (-2223.261) (-2221.053) [-2214.372] (-2222.519) * (-2210.839) [-2210.220] (-2215.644) (-2226.149) -- 0:04:28
73000 -- (-2214.884) [-2209.342] (-2212.300) (-2230.251) * (-2215.549) (-2213.705) [-2204.945] (-2209.358) -- 0:04:26
73500 -- (-2214.279) [-2211.038] (-2219.487) (-2218.254) * (-2219.998) (-2210.936) (-2210.704) [-2207.523] -- 0:04:24
74000 -- [-2208.395] (-2210.397) (-2212.139) (-2212.305) * (-2218.586) [-2211.889] (-2214.298) (-2211.061) -- 0:04:22
74500 -- (-2215.936) (-2224.435) (-2206.758) [-2216.041] * (-2216.917) [-2215.427] (-2215.832) (-2220.638) -- 0:04:20
75000 -- [-2215.896] (-2218.891) (-2208.111) (-2219.269) * [-2213.531] (-2213.877) (-2212.996) (-2222.456) -- 0:04:31
Average standard deviation of split frequencies: 0.023379
75500 -- (-2222.442) (-2219.388) [-2205.857] (-2207.594) * [-2211.657] (-2217.767) (-2227.801) (-2213.259) -- 0:04:29
76000 -- (-2209.725) (-2236.343) [-2216.455] (-2212.257) * [-2208.679] (-2217.232) (-2219.925) (-2214.553) -- 0:04:27
76500 -- [-2207.747] (-2216.626) (-2222.897) (-2204.283) * [-2208.404] (-2214.867) (-2228.049) (-2213.344) -- 0:04:25
77000 -- (-2221.258) (-2209.463) [-2209.030] (-2207.244) * (-2209.797) [-2215.258] (-2212.501) (-2220.526) -- 0:04:23
77500 -- [-2215.042] (-2216.667) (-2211.675) (-2218.195) * (-2211.055) (-2210.793) (-2224.735) [-2207.098] -- 0:04:21
78000 -- (-2217.194) (-2203.192) (-2215.342) [-2211.049] * (-2213.354) [-2210.417] (-2211.865) (-2202.566) -- 0:04:20
78500 -- [-2207.755] (-2214.315) (-2216.530) (-2204.994) * (-2216.754) [-2210.443] (-2206.307) (-2206.183) -- 0:04:29
79000 -- [-2208.954] (-2209.018) (-2217.683) (-2209.782) * (-2210.868) (-2209.162) [-2209.167] (-2212.377) -- 0:04:28
79500 -- [-2210.231] (-2210.800) (-2217.493) (-2224.171) * [-2205.247] (-2210.585) (-2209.773) (-2216.185) -- 0:04:26
80000 -- [-2205.098] (-2214.436) (-2212.122) (-2220.806) * (-2218.604) (-2216.045) (-2212.009) [-2210.598] -- 0:04:24
Average standard deviation of split frequencies: 0.019779
80500 -- (-2219.986) (-2209.654) (-2219.404) [-2211.019] * (-2218.317) [-2210.893] (-2202.061) (-2211.258) -- 0:04:22
81000 -- (-2223.733) (-2208.558) [-2218.329] (-2218.084) * (-2220.935) [-2210.605] (-2220.307) (-2206.299) -- 0:04:20
81500 -- (-2216.467) [-2204.394] (-2219.320) (-2212.438) * (-2213.100) (-2216.048) (-2211.649) [-2209.486] -- 0:04:19
82000 -- [-2208.839] (-2207.185) (-2211.976) (-2220.338) * (-2216.846) (-2211.536) [-2212.853] (-2207.844) -- 0:04:28
82500 -- [-2214.184] (-2205.942) (-2220.430) (-2220.194) * (-2221.751) (-2216.340) (-2225.064) [-2208.391] -- 0:04:26
83000 -- [-2208.523] (-2213.316) (-2216.174) (-2225.460) * [-2214.589] (-2215.305) (-2224.791) (-2213.156) -- 0:04:25
83500 -- (-2213.661) [-2210.346] (-2210.396) (-2218.937) * (-2219.130) [-2209.912] (-2209.852) (-2209.757) -- 0:04:23
84000 -- [-2211.150] (-2214.373) (-2212.384) (-2224.001) * (-2228.797) (-2209.259) [-2214.096] (-2208.993) -- 0:04:21
84500 -- (-2216.246) (-2215.864) (-2219.205) [-2219.021] * (-2221.977) (-2219.839) (-2217.626) [-2215.790] -- 0:04:20
85000 -- (-2208.898) (-2219.375) (-2220.118) [-2209.303] * [-2219.058] (-2215.334) (-2227.347) (-2221.050) -- 0:04:18
Average standard deviation of split frequencies: 0.021143
85500 -- (-2215.107) [-2208.818] (-2220.962) (-2209.382) * (-2215.719) [-2206.720] (-2232.166) (-2217.212) -- 0:04:16
86000 -- [-2209.249] (-2215.928) (-2215.978) (-2208.383) * (-2215.843) [-2214.369] (-2225.854) (-2217.096) -- 0:04:25
86500 -- [-2210.932] (-2212.832) (-2212.860) (-2222.203) * (-2216.345) [-2216.787] (-2232.574) (-2208.520) -- 0:04:24
87000 -- [-2215.433] (-2217.466) (-2208.586) (-2228.387) * (-2215.159) [-2215.019] (-2229.343) (-2231.197) -- 0:04:22
87500 -- (-2213.182) (-2220.692) [-2210.604] (-2214.529) * [-2213.571] (-2213.885) (-2214.183) (-2208.393) -- 0:04:20
88000 -- (-2211.088) (-2219.817) [-2215.817] (-2210.684) * (-2220.020) (-2220.242) (-2218.196) [-2208.755] -- 0:04:19
88500 -- (-2210.519) (-2217.071) (-2228.458) [-2212.921] * (-2227.500) [-2206.840] (-2214.670) (-2205.576) -- 0:04:17
89000 -- (-2222.259) [-2215.039] (-2213.425) (-2211.848) * (-2227.215) (-2212.088) (-2210.458) [-2208.159] -- 0:04:15
89500 -- (-2215.850) [-2206.685] (-2210.404) (-2213.660) * (-2215.498) [-2210.725] (-2214.412) (-2208.537) -- 0:04:14
90000 -- (-2220.617) (-2209.317) [-2206.507] (-2216.565) * (-2214.586) (-2224.911) [-2208.841] (-2212.125) -- 0:04:22
Average standard deviation of split frequencies: 0.019597
90500 -- [-2207.907] (-2222.072) (-2216.233) (-2214.028) * (-2223.914) (-2207.956) (-2211.926) [-2208.023] -- 0:04:21
91000 -- [-2210.581] (-2211.283) (-2220.495) (-2219.850) * (-2210.166) (-2214.421) (-2220.534) [-2217.571] -- 0:04:19
91500 -- (-2203.118) (-2217.179) (-2209.932) [-2210.366] * [-2212.040] (-2211.130) (-2215.927) (-2211.878) -- 0:04:18
92000 -- (-2200.140) [-2211.750] (-2221.093) (-2211.407) * (-2206.358) [-2214.144] (-2210.190) (-2213.451) -- 0:04:16
92500 -- (-2216.496) (-2224.139) (-2208.257) [-2206.543] * (-2210.966) [-2208.542] (-2206.257) (-2215.691) -- 0:04:15
93000 -- (-2212.123) (-2222.497) (-2224.600) [-2209.405] * (-2215.270) (-2216.198) [-2218.020] (-2212.249) -- 0:04:23
93500 -- (-2212.784) (-2223.863) [-2212.840] (-2213.480) * [-2211.724] (-2214.189) (-2214.189) (-2213.101) -- 0:04:21
94000 -- [-2212.879] (-2215.588) (-2202.736) (-2212.667) * (-2211.872) (-2213.395) (-2212.190) [-2217.170] -- 0:04:20
94500 -- [-2214.770] (-2225.185) (-2220.701) (-2224.601) * (-2210.737) [-2209.273] (-2215.941) (-2219.255) -- 0:04:18
95000 -- [-2204.477] (-2215.467) (-2210.787) (-2217.495) * (-2210.094) (-2217.532) [-2212.477] (-2216.164) -- 0:04:17
Average standard deviation of split frequencies: 0.021045
95500 -- (-2211.003) (-2213.924) [-2209.799] (-2223.571) * (-2222.879) (-2214.909) (-2209.795) [-2209.690] -- 0:04:15
96000 -- (-2213.973) (-2209.187) [-2212.021] (-2215.412) * (-2211.716) (-2216.325) [-2205.898] (-2216.289) -- 0:04:14
96500 -- (-2215.733) (-2220.273) (-2210.979) [-2214.879] * (-2221.223) (-2218.936) (-2205.416) [-2221.692] -- 0:04:12
97000 -- [-2206.659] (-2228.320) (-2211.454) (-2213.836) * (-2232.200) (-2213.581) [-2208.845] (-2216.635) -- 0:04:20
97500 -- [-2213.327] (-2225.344) (-2222.784) (-2213.634) * [-2216.725] (-2208.949) (-2213.696) (-2215.702) -- 0:04:19
98000 -- (-2213.541) (-2214.245) (-2213.918) [-2208.759] * (-2217.563) (-2218.312) (-2207.986) [-2220.519] -- 0:04:17
98500 -- (-2209.873) [-2213.674] (-2208.864) (-2214.300) * (-2210.157) (-2223.883) (-2216.220) [-2215.164] -- 0:04:16
99000 -- (-2212.298) [-2227.636] (-2217.636) (-2221.376) * (-2213.053) (-2215.852) [-2214.996] (-2223.442) -- 0:04:14
99500 -- [-2208.687] (-2219.187) (-2213.186) (-2216.172) * [-2206.311] (-2224.890) (-2217.722) (-2212.513) -- 0:04:13
100000 -- [-2215.315] (-2220.229) (-2220.999) (-2214.860) * (-2214.616) (-2217.016) (-2238.094) [-2205.173] -- 0:04:21
Average standard deviation of split frequencies: 0.019066
100500 -- (-2213.223) [-2214.902] (-2210.877) (-2211.709) * (-2213.114) (-2205.711) [-2209.616] (-2213.391) -- 0:04:19
101000 -- (-2226.771) (-2213.160) (-2215.410) [-2222.169] * (-2209.876) (-2217.302) [-2208.315] (-2218.040) -- 0:04:18
101500 -- [-2213.335] (-2213.687) (-2217.703) (-2221.480) * [-2213.994] (-2218.564) (-2220.085) (-2221.132) -- 0:04:16
102000 -- (-2213.936) (-2223.282) (-2212.857) [-2213.862] * (-2221.465) [-2208.764] (-2205.725) (-2215.816) -- 0:04:15
102500 -- (-2217.592) (-2211.328) (-2210.238) [-2223.911] * [-2215.250] (-2219.509) (-2218.610) (-2204.828) -- 0:04:13
103000 -- [-2215.006] (-2215.136) (-2218.341) (-2223.487) * [-2209.104] (-2209.352) (-2215.156) (-2218.811) -- 0:04:12
103500 -- (-2223.888) [-2213.443] (-2215.558) (-2218.407) * [-2218.181] (-2217.497) (-2226.536) (-2220.029) -- 0:04:19
104000 -- [-2214.856] (-2226.023) (-2212.422) (-2235.972) * (-2213.542) (-2216.723) (-2223.529) [-2209.115] -- 0:04:18
104500 -- (-2222.719) (-2216.897) [-2217.281] (-2227.597) * (-2212.827) [-2208.293] (-2220.114) (-2215.500) -- 0:04:17
105000 -- (-2216.323) (-2208.977) [-2208.500] (-2217.629) * (-2215.782) (-2221.585) (-2221.470) [-2213.961] -- 0:04:15
Average standard deviation of split frequencies: 0.022871
105500 -- [-2214.921] (-2210.710) (-2218.004) (-2209.878) * (-2207.720) (-2212.602) [-2207.777] (-2217.886) -- 0:04:14
106000 -- (-2214.960) (-2220.694) [-2208.167] (-2211.749) * (-2220.571) [-2210.202] (-2216.058) (-2212.781) -- 0:04:13
106500 -- (-2211.394) (-2217.713) (-2206.122) [-2206.131] * (-2209.962) (-2222.668) (-2212.788) [-2211.563] -- 0:04:20
107000 -- [-2212.078] (-2217.902) (-2212.582) (-2221.166) * (-2219.077) (-2211.382) [-2209.302] (-2212.721) -- 0:04:18
107500 -- [-2219.983] (-2228.729) (-2205.134) (-2219.985) * (-2211.808) (-2219.738) [-2213.852] (-2224.056) -- 0:04:17
108000 -- (-2214.776) (-2208.362) [-2207.612] (-2216.755) * (-2212.011) (-2212.115) (-2232.906) [-2218.817] -- 0:04:16
108500 -- [-2209.108] (-2206.015) (-2209.557) (-2224.778) * (-2212.053) (-2216.526) [-2220.551] (-2213.982) -- 0:04:14
109000 -- [-2213.018] (-2220.676) (-2208.458) (-2219.393) * (-2216.581) [-2210.460] (-2215.407) (-2222.346) -- 0:04:13
109500 -- (-2216.689) [-2213.056] (-2208.639) (-2210.721) * (-2215.521) [-2211.175] (-2212.298) (-2225.627) -- 0:04:12
110000 -- (-2224.100) (-2225.597) (-2208.114) [-2211.424] * (-2216.494) (-2223.404) [-2214.979] (-2222.562) -- 0:04:10
Average standard deviation of split frequencies: 0.023124
110500 -- [-2207.169] (-2214.312) (-2212.636) (-2228.795) * (-2216.003) (-2223.381) [-2207.181] (-2219.158) -- 0:04:17
111000 -- (-2221.060) (-2217.764) [-2202.126] (-2217.457) * (-2220.861) [-2211.426] (-2208.845) (-2212.908) -- 0:04:16
111500 -- (-2218.324) (-2215.578) (-2206.209) [-2211.804] * [-2208.226] (-2207.868) (-2226.505) (-2225.953) -- 0:04:14
112000 -- (-2212.415) (-2211.905) (-2209.589) [-2214.485] * (-2209.527) [-2210.714] (-2216.144) (-2216.710) -- 0:04:13
112500 -- (-2209.822) (-2215.152) [-2215.095] (-2217.222) * [-2207.143] (-2215.628) (-2212.694) (-2229.492) -- 0:04:12
113000 -- (-2214.242) (-2211.403) [-2202.694] (-2218.984) * (-2214.736) (-2215.391) [-2219.078] (-2219.622) -- 0:04:11
113500 -- (-2210.072) [-2219.159] (-2213.967) (-2225.366) * [-2218.209] (-2206.081) (-2217.631) (-2214.239) -- 0:04:09
114000 -- (-2216.646) [-2211.178] (-2218.806) (-2217.026) * (-2211.731) (-2220.919) [-2215.482] (-2215.851) -- 0:04:16
114500 -- [-2213.066] (-2224.514) (-2212.532) (-2215.356) * (-2217.717) (-2214.863) [-2209.050] (-2226.525) -- 0:04:15
115000 -- (-2210.881) (-2219.789) (-2209.967) [-2207.402] * (-2225.009) [-2214.222] (-2214.101) (-2222.931) -- 0:04:13
Average standard deviation of split frequencies: 0.022351
115500 -- (-2217.373) (-2226.257) [-2217.463] (-2215.666) * (-2215.893) (-2224.886) (-2215.015) [-2214.221] -- 0:04:12
116000 -- [-2210.079] (-2211.035) (-2215.510) (-2216.699) * (-2226.605) (-2215.292) [-2209.688] (-2216.039) -- 0:04:11
116500 -- (-2216.324) (-2216.232) (-2223.105) [-2219.412] * (-2213.000) (-2215.819) (-2210.632) [-2214.887] -- 0:04:10
117000 -- (-2211.730) [-2222.670] (-2217.064) (-2217.453) * (-2210.018) (-2215.761) [-2213.167] (-2230.355) -- 0:04:16
117500 -- (-2212.845) (-2215.096) (-2219.222) [-2209.613] * (-2223.500) (-2211.210) (-2214.580) [-2218.474] -- 0:04:15
118000 -- (-2232.283) [-2218.062] (-2220.649) (-2217.052) * (-2226.311) [-2226.943] (-2207.566) (-2206.160) -- 0:04:14
118500 -- (-2219.921) (-2207.693) [-2215.915] (-2220.547) * (-2222.939) (-2228.319) [-2219.348] (-2221.133) -- 0:04:12
119000 -- (-2225.825) (-2209.401) (-2216.787) [-2209.259] * (-2222.753) (-2213.420) (-2216.698) [-2208.052] -- 0:04:11
119500 -- (-2207.570) [-2208.335] (-2213.158) (-2217.779) * [-2208.524] (-2213.067) (-2225.097) (-2226.449) -- 0:04:10
120000 -- [-2210.764] (-2208.493) (-2209.660) (-2209.590) * (-2211.832) (-2224.156) [-2211.859] (-2212.817) -- 0:04:09
Average standard deviation of split frequencies: 0.022238
120500 -- (-2210.482) (-2209.825) (-2216.450) [-2213.181] * (-2222.709) [-2215.302] (-2209.332) (-2216.145) -- 0:04:08
121000 -- [-2208.550] (-2206.963) (-2204.978) (-2215.989) * (-2222.993) (-2216.064) (-2210.412) [-2214.420] -- 0:04:14
121500 -- [-2211.385] (-2214.881) (-2221.498) (-2216.782) * [-2211.972] (-2219.652) (-2212.601) (-2213.745) -- 0:04:13
122000 -- [-2214.081] (-2212.817) (-2216.711) (-2217.382) * (-2215.593) (-2220.175) [-2205.947] (-2224.946) -- 0:04:11
122500 -- [-2212.838] (-2207.834) (-2218.999) (-2217.005) * (-2219.449) [-2218.337] (-2212.876) (-2228.212) -- 0:04:10
123000 -- [-2214.341] (-2215.219) (-2211.095) (-2219.797) * (-2219.220) (-2209.708) (-2218.701) [-2215.697] -- 0:04:09
123500 -- [-2216.185] (-2211.784) (-2220.158) (-2222.651) * (-2212.128) (-2212.428) [-2208.519] (-2213.601) -- 0:04:08
124000 -- (-2212.630) (-2211.059) [-2209.642] (-2212.324) * [-2219.332] (-2223.799) (-2216.461) (-2217.199) -- 0:04:07
124500 -- (-2220.418) (-2223.635) (-2214.404) [-2210.834] * (-2216.151) (-2209.120) (-2218.906) [-2217.016] -- 0:04:13
125000 -- (-2223.998) (-2208.142) (-2216.487) [-2211.644] * (-2221.124) [-2215.889] (-2210.857) (-2211.804) -- 0:04:12
Average standard deviation of split frequencies: 0.021297
125500 -- (-2223.339) (-2206.249) (-2214.556) [-2209.200] * (-2214.122) [-2211.967] (-2204.121) (-2221.289) -- 0:04:10
126000 -- [-2209.377] (-2211.238) (-2216.924) (-2205.410) * (-2211.747) (-2236.424) [-2211.606] (-2216.816) -- 0:04:09
126500 -- (-2211.655) (-2209.032) (-2220.127) [-2208.210] * (-2212.592) (-2214.151) [-2205.267] (-2222.498) -- 0:04:08
127000 -- (-2221.599) (-2208.085) (-2213.134) [-2214.430] * [-2208.280] (-2207.221) (-2212.968) (-2216.221) -- 0:04:14
127500 -- (-2211.033) [-2207.196] (-2210.967) (-2209.260) * (-2217.058) (-2205.002) [-2208.521] (-2226.906) -- 0:04:13
128000 -- [-2207.378] (-2216.586) (-2210.079) (-2214.701) * [-2213.355] (-2211.938) (-2212.497) (-2216.331) -- 0:04:12
128500 -- (-2219.865) [-2207.896] (-2208.853) (-2220.185) * [-2205.000] (-2216.621) (-2211.180) (-2208.306) -- 0:04:10
129000 -- (-2218.698) (-2207.966) (-2213.875) [-2206.706] * (-2211.787) (-2223.210) [-2207.459] (-2212.106) -- 0:04:09
129500 -- (-2215.647) [-2217.022] (-2217.134) (-2209.012) * [-2210.212] (-2216.048) (-2224.359) (-2207.939) -- 0:04:15
130000 -- (-2217.439) (-2224.286) [-2212.779] (-2213.722) * (-2215.241) (-2201.907) (-2209.709) [-2210.910] -- 0:04:14
Average standard deviation of split frequencies: 0.018871
130500 -- [-2206.845] (-2215.283) (-2224.621) (-2222.563) * (-2212.743) [-2212.340] (-2214.417) (-2217.422) -- 0:04:13
131000 -- [-2210.918] (-2220.130) (-2227.406) (-2215.196) * (-2221.331) (-2211.960) (-2202.029) [-2204.842] -- 0:04:12
131500 -- (-2225.628) (-2210.714) (-2228.655) [-2217.806] * (-2205.312) [-2214.593] (-2213.527) (-2219.554) -- 0:04:10
132000 -- (-2225.927) (-2217.788) (-2224.696) [-2207.071] * [-2211.239] (-2210.407) (-2223.359) (-2209.971) -- 0:04:09
132500 -- (-2215.198) [-2215.020] (-2215.057) (-2207.927) * (-2210.731) [-2217.056] (-2208.043) (-2223.243) -- 0:04:08
133000 -- (-2225.744) (-2222.108) (-2225.913) [-2208.049] * (-2220.589) [-2211.641] (-2211.731) (-2211.878) -- 0:04:07
133500 -- (-2211.705) (-2213.156) (-2226.133) [-2213.599] * (-2215.236) [-2225.919] (-2223.904) (-2216.082) -- 0:04:13
134000 -- [-2208.178] (-2216.927) (-2219.767) (-2209.489) * (-2222.374) (-2222.772) (-2214.874) [-2205.931] -- 0:04:12
134500 -- (-2216.856) (-2219.605) (-2201.904) [-2207.564] * (-2225.362) [-2206.083] (-2213.910) (-2222.343) -- 0:04:10
135000 -- [-2212.120] (-2211.747) (-2208.781) (-2233.087) * (-2219.173) [-2223.844] (-2221.781) (-2213.049) -- 0:04:09
Average standard deviation of split frequencies: 0.023521
135500 -- (-2223.968) [-2207.185] (-2206.058) (-2217.151) * [-2209.263] (-2217.598) (-2220.314) (-2223.447) -- 0:04:08
136000 -- (-2213.012) [-2203.497] (-2227.127) (-2218.522) * (-2220.008) (-2213.388) [-2205.635] (-2218.381) -- 0:04:07
136500 -- [-2212.226] (-2206.142) (-2219.080) (-2214.392) * [-2215.209] (-2218.388) (-2206.828) (-2214.852) -- 0:04:06
137000 -- (-2212.861) (-2200.620) (-2219.064) [-2208.755] * (-2212.135) (-2209.704) [-2225.486] (-2211.221) -- 0:04:05
137500 -- (-2222.490) (-2217.721) (-2216.839) [-2209.746] * (-2226.340) [-2204.935] (-2217.716) (-2216.967) -- 0:04:10
138000 -- (-2211.265) [-2228.938] (-2220.548) (-2214.575) * [-2215.731] (-2205.623) (-2215.989) (-2228.063) -- 0:04:09
138500 -- (-2224.325) (-2214.787) [-2209.825] (-2210.192) * (-2212.659) (-2209.730) [-2208.467] (-2223.684) -- 0:04:08
139000 -- [-2209.211] (-2221.965) (-2214.739) (-2208.251) * [-2214.680] (-2205.721) (-2214.139) (-2220.037) -- 0:04:07
139500 -- (-2216.841) (-2214.473) [-2214.910] (-2225.113) * (-2211.430) [-2207.695] (-2219.287) (-2218.693) -- 0:04:06
140000 -- (-2214.039) (-2224.360) [-2211.085] (-2212.524) * [-2214.813] (-2201.484) (-2214.606) (-2219.118) -- 0:04:05
Average standard deviation of split frequencies: 0.021396
140500 -- (-2213.088) (-2216.693) (-2217.287) [-2209.290] * [-2207.876] (-2216.730) (-2216.869) (-2219.422) -- 0:04:04
141000 -- (-2214.835) (-2206.731) (-2216.342) [-2215.397] * [-2212.248] (-2229.399) (-2213.355) (-2207.416) -- 0:04:09
141500 -- [-2208.355] (-2220.398) (-2217.572) (-2212.045) * (-2213.699) (-2208.911) [-2219.465] (-2210.547) -- 0:04:08
142000 -- (-2222.305) (-2217.611) (-2214.385) [-2212.881] * [-2210.093] (-2218.524) (-2225.060) (-2213.217) -- 0:04:07
142500 -- (-2212.508) (-2218.835) (-2215.150) [-2216.066] * [-2207.906] (-2219.815) (-2216.944) (-2215.154) -- 0:04:06
143000 -- [-2220.762] (-2218.709) (-2211.425) (-2216.623) * [-2202.404] (-2212.705) (-2212.539) (-2215.045) -- 0:04:05
143500 -- (-2208.123) (-2216.361) [-2213.084] (-2211.645) * (-2213.191) (-2216.839) [-2207.628] (-2216.078) -- 0:04:04
144000 -- (-2210.015) [-2210.541] (-2209.928) (-2214.975) * (-2212.671) [-2207.833] (-2215.555) (-2217.451) -- 0:04:03
144500 -- [-2214.615] (-2229.415) (-2220.793) (-2212.071) * (-2212.088) [-2209.860] (-2218.282) (-2211.121) -- 0:04:02
145000 -- (-2219.695) [-2219.282] (-2219.419) (-2203.116) * (-2210.458) (-2207.545) (-2216.539) [-2210.338] -- 0:04:07
Average standard deviation of split frequencies: 0.017297
145500 -- (-2217.099) [-2218.444] (-2216.410) (-2210.651) * [-2209.974] (-2219.294) (-2219.196) (-2216.668) -- 0:04:06
146000 -- (-2213.699) (-2210.219) [-2212.112] (-2213.992) * [-2209.895] (-2216.293) (-2215.618) (-2209.644) -- 0:04:05
146500 -- (-2214.607) [-2207.446] (-2213.262) (-2210.164) * (-2207.056) (-2221.796) (-2224.063) [-2216.286] -- 0:04:04
147000 -- [-2211.414] (-2226.813) (-2219.341) (-2213.603) * [-2205.475] (-2217.944) (-2231.660) (-2208.452) -- 0:04:03
147500 -- [-2210.753] (-2228.443) (-2234.907) (-2214.415) * (-2216.176) (-2220.980) [-2213.883] (-2214.570) -- 0:04:08
148000 -- (-2208.226) (-2220.592) (-2224.190) [-2204.609] * (-2211.066) (-2218.239) [-2216.401] (-2220.063) -- 0:04:07
148500 -- (-2207.415) (-2211.043) (-2234.146) [-2211.023] * (-2210.376) (-2225.466) (-2215.717) [-2210.863] -- 0:04:06
149000 -- (-2205.271) [-2214.403] (-2220.934) (-2214.831) * (-2216.561) (-2215.081) [-2213.027] (-2213.844) -- 0:04:05
149500 -- (-2212.504) [-2215.637] (-2225.903) (-2216.074) * [-2213.562] (-2216.180) (-2213.085) (-2215.276) -- 0:04:04
150000 -- (-2208.012) [-2212.116] (-2221.763) (-2222.990) * [-2208.860] (-2213.280) (-2208.261) (-2211.858) -- 0:04:03
Average standard deviation of split frequencies: 0.016091
150500 -- (-2214.635) [-2210.737] (-2232.507) (-2227.010) * (-2213.585) (-2220.313) [-2204.980] (-2212.813) -- 0:04:02
151000 -- (-2209.606) (-2211.794) [-2213.939] (-2213.307) * [-2222.437] (-2228.936) (-2213.100) (-2215.246) -- 0:04:01
151500 -- (-2209.477) [-2201.200] (-2216.498) (-2217.066) * (-2219.462) (-2214.948) (-2204.960) [-2212.241] -- 0:04:06
152000 -- (-2218.284) (-2217.727) (-2220.790) [-2214.983] * (-2210.062) (-2223.762) [-2219.801] (-2209.934) -- 0:04:05
152500 -- (-2222.414) (-2211.880) (-2223.188) [-2212.824] * (-2209.804) (-2209.013) [-2203.406] (-2225.171) -- 0:04:04
153000 -- (-2230.961) [-2209.471] (-2213.676) (-2210.362) * (-2204.494) [-2211.900] (-2211.475) (-2211.490) -- 0:04:03
153500 -- [-2213.292] (-2215.764) (-2215.897) (-2204.531) * (-2219.705) (-2215.758) [-2208.261] (-2209.225) -- 0:04:02
154000 -- (-2210.640) (-2220.015) [-2217.168] (-2238.727) * (-2218.821) (-2206.461) (-2208.969) [-2204.860] -- 0:04:07
154500 -- (-2210.894) (-2229.989) [-2211.548] (-2217.345) * (-2217.908) (-2213.196) (-2214.297) [-2213.987] -- 0:04:06
155000 -- [-2212.240] (-2218.399) (-2214.707) (-2214.311) * (-2211.780) (-2211.948) [-2205.443] (-2222.679) -- 0:04:05
Average standard deviation of split frequencies: 0.014246
155500 -- (-2216.133) [-2210.249] (-2216.380) (-2213.237) * [-2207.172] (-2223.737) (-2211.347) (-2223.919) -- 0:04:04
156000 -- [-2213.468] (-2217.899) (-2212.374) (-2213.550) * [-2220.091] (-2213.118) (-2210.782) (-2222.899) -- 0:04:03
156500 -- (-2210.619) (-2214.884) [-2204.663] (-2212.110) * (-2209.844) [-2210.737] (-2216.237) (-2215.440) -- 0:04:02
157000 -- [-2207.041] (-2225.635) (-2210.356) (-2214.946) * [-2207.380] (-2210.566) (-2225.586) (-2220.268) -- 0:04:06
157500 -- (-2220.304) [-2220.885] (-2212.693) (-2219.407) * [-2212.188] (-2220.372) (-2212.882) (-2207.978) -- 0:04:06
158000 -- [-2209.329] (-2211.176) (-2217.128) (-2211.205) * (-2222.420) (-2224.712) [-2211.554] (-2216.917) -- 0:04:05
158500 -- (-2206.951) [-2210.429] (-2202.934) (-2211.849) * (-2213.493) [-2211.854] (-2207.452) (-2221.721) -- 0:04:04
159000 -- (-2213.904) (-2216.472) (-2222.339) [-2215.638] * [-2207.249] (-2222.752) (-2225.830) (-2217.162) -- 0:04:03
159500 -- (-2210.209) (-2209.930) [-2219.733] (-2213.798) * [-2204.582] (-2211.228) (-2213.798) (-2214.857) -- 0:04:02
160000 -- (-2207.294) (-2209.894) [-2218.478] (-2207.210) * [-2208.199] (-2216.636) (-2210.607) (-2212.894) -- 0:04:06
Average standard deviation of split frequencies: 0.012413
160500 -- (-2219.175) [-2207.383] (-2229.689) (-2208.968) * (-2210.029) (-2221.709) [-2213.597] (-2207.330) -- 0:04:05
161000 -- (-2217.921) (-2218.057) (-2215.056) [-2207.096] * [-2214.604] (-2228.899) (-2216.332) (-2205.893) -- 0:04:04
161500 -- (-2212.857) (-2221.661) (-2229.524) [-2217.112] * (-2215.392) (-2223.301) [-2210.199] (-2213.903) -- 0:04:04
162000 -- (-2219.909) (-2227.729) [-2220.434] (-2228.512) * (-2209.153) [-2219.110] (-2217.459) (-2218.295) -- 0:04:03
162500 -- (-2210.916) (-2221.416) [-2207.709] (-2221.265) * (-2217.905) (-2223.378) (-2224.762) [-2206.108] -- 0:04:07
163000 -- (-2225.179) (-2224.035) [-2215.235] (-2212.275) * (-2213.150) (-2220.528) (-2218.734) [-2215.174] -- 0:04:06
163500 -- (-2226.941) (-2219.410) [-2215.057] (-2213.202) * (-2216.808) [-2213.904] (-2223.439) (-2226.346) -- 0:04:05
164000 -- (-2242.494) [-2212.642] (-2222.563) (-2205.875) * [-2210.887] (-2215.267) (-2213.196) (-2218.466) -- 0:04:04
164500 -- [-2216.031] (-2219.270) (-2214.567) (-2202.858) * (-2213.262) (-2215.036) [-2212.550] (-2208.912) -- 0:04:03
165000 -- (-2219.017) [-2217.239] (-2214.544) (-2210.244) * (-2217.270) (-2216.421) (-2218.106) [-2208.536] -- 0:04:02
Average standard deviation of split frequencies: 0.012982
165500 -- (-2230.938) (-2215.794) [-2212.457] (-2224.700) * [-2209.069] (-2221.638) (-2225.744) (-2220.047) -- 0:04:07
166000 -- (-2224.236) [-2201.020] (-2217.934) (-2215.674) * (-2205.833) [-2209.761] (-2217.783) (-2220.665) -- 0:04:06
166500 -- (-2219.469) (-2209.489) (-2214.693) [-2213.157] * (-2214.151) (-2215.798) [-2210.332] (-2218.478) -- 0:04:05
167000 -- (-2207.817) (-2214.149) (-2207.338) [-2206.932] * [-2208.267] (-2234.022) (-2220.220) (-2215.742) -- 0:04:04
167500 -- (-2220.153) [-2216.325] (-2208.820) (-2212.913) * [-2213.062] (-2221.923) (-2221.346) (-2230.687) -- 0:04:03
168000 -- [-2214.119] (-2214.992) (-2225.694) (-2210.452) * (-2215.413) (-2217.755) (-2211.596) [-2215.201] -- 0:04:02
168500 -- (-2212.948) (-2219.214) (-2220.377) [-2206.537] * [-2214.349] (-2232.677) (-2216.374) (-2219.205) -- 0:04:06
169000 -- (-2210.144) (-2219.983) [-2205.713] (-2209.861) * (-2211.318) (-2221.491) (-2211.593) [-2214.624] -- 0:04:05
169500 -- [-2225.327] (-2219.080) (-2216.096) (-2213.418) * (-2215.038) (-2225.101) (-2216.303) [-2208.526] -- 0:04:04
170000 -- [-2214.588] (-2221.032) (-2211.520) (-2216.401) * (-2204.939) [-2212.404] (-2225.136) (-2210.274) -- 0:04:04
Average standard deviation of split frequencies: 0.011261
170500 -- [-2212.830] (-2218.326) (-2224.560) (-2220.017) * [-2212.790] (-2224.868) (-2218.162) (-2214.345) -- 0:04:03
171000 -- (-2211.363) (-2215.202) [-2210.816] (-2217.188) * (-2214.538) (-2216.683) [-2209.590] (-2214.836) -- 0:04:07
171500 -- [-2218.482] (-2218.663) (-2212.275) (-2212.153) * (-2224.001) (-2222.629) (-2224.644) [-2215.593] -- 0:04:06
172000 -- [-2215.528] (-2218.320) (-2211.466) (-2209.433) * (-2223.640) (-2222.530) (-2207.771) [-2217.018] -- 0:04:05
172500 -- (-2214.359) (-2213.588) [-2215.300] (-2207.686) * [-2222.770] (-2210.147) (-2220.647) (-2221.796) -- 0:04:04
173000 -- (-2217.367) [-2208.465] (-2233.856) (-2206.177) * (-2219.768) (-2212.810) [-2209.931] (-2216.211) -- 0:04:03
173500 -- [-2208.184] (-2220.900) (-2223.821) (-2216.727) * [-2213.435] (-2209.835) (-2216.805) (-2213.383) -- 0:04:02
174000 -- (-2214.591) (-2208.681) [-2213.447] (-2208.493) * [-2214.687] (-2212.445) (-2216.623) (-2220.490) -- 0:04:06
174500 -- [-2215.501] (-2209.813) (-2219.399) (-2217.543) * (-2228.189) (-2214.601) [-2206.015] (-2218.831) -- 0:04:05
175000 -- [-2215.474] (-2217.366) (-2216.326) (-2215.309) * (-2216.387) [-2214.678] (-2202.272) (-2209.332) -- 0:04:05
Average standard deviation of split frequencies: 0.010508
175500 -- (-2226.386) [-2206.308] (-2214.288) (-2214.266) * [-2207.978] (-2210.795) (-2219.241) (-2221.009) -- 0:04:04
176000 -- (-2212.711) (-2221.767) (-2212.242) [-2209.361] * (-2213.482) [-2218.573] (-2211.621) (-2218.344) -- 0:04:03
176500 -- (-2218.276) [-2212.018] (-2219.013) (-2212.141) * (-2211.077) (-2205.221) (-2216.575) [-2216.417] -- 0:04:02
177000 -- (-2214.243) (-2216.215) (-2208.147) [-2210.152] * [-2220.712] (-2212.063) (-2218.629) (-2214.179) -- 0:04:01
177500 -- (-2204.638) (-2212.681) (-2221.095) [-2209.206] * (-2223.769) [-2208.877] (-2226.158) (-2225.972) -- 0:04:05
178000 -- (-2214.480) (-2224.502) (-2216.812) [-2214.206] * (-2213.233) [-2210.199] (-2209.371) (-2212.904) -- 0:04:04
178500 -- [-2212.859] (-2219.877) (-2211.956) (-2219.705) * (-2218.233) (-2216.294) (-2207.234) [-2217.097] -- 0:04:03
179000 -- [-2214.435] (-2208.473) (-2213.876) (-2218.032) * [-2211.282] (-2215.087) (-2211.647) (-2223.430) -- 0:04:03
179500 -- (-2210.427) (-2212.276) (-2215.319) [-2210.013] * (-2211.388) [-2217.793] (-2213.121) (-2211.915) -- 0:04:02
180000 -- (-2222.886) [-2216.651] (-2206.181) (-2216.429) * [-2213.771] (-2217.128) (-2215.167) (-2213.727) -- 0:04:01
Average standard deviation of split frequencies: 0.012645
180500 -- (-2215.947) [-2211.680] (-2205.719) (-2216.478) * (-2219.664) (-2224.507) [-2211.611] (-2215.069) -- 0:04:00
181000 -- (-2221.183) (-2204.813) (-2209.292) [-2206.489] * [-2208.596] (-2215.926) (-2214.870) (-2209.035) -- 0:04:04
181500 -- (-2221.318) (-2211.909) (-2211.027) [-2206.465] * [-2217.549] (-2216.830) (-2205.928) (-2221.252) -- 0:04:03
182000 -- (-2223.332) (-2223.562) (-2211.299) [-2209.129] * (-2210.600) (-2213.503) [-2207.700] (-2212.956) -- 0:04:02
182500 -- [-2216.672] (-2216.642) (-2204.960) (-2213.446) * [-2208.571] (-2220.326) (-2212.631) (-2211.858) -- 0:04:01
183000 -- [-2210.064] (-2217.109) (-2219.115) (-2217.148) * (-2208.293) (-2217.488) (-2220.067) [-2220.799] -- 0:04:01
183500 -- (-2215.533) [-2213.583] (-2213.220) (-2225.164) * [-2209.841] (-2211.855) (-2207.743) (-2232.605) -- 0:04:00
184000 -- (-2216.300) (-2208.262) [-2209.255] (-2208.822) * [-2209.476] (-2215.906) (-2206.021) (-2219.417) -- 0:04:03
184500 -- (-2209.630) [-2203.645] (-2225.427) (-2219.645) * (-2222.074) (-2217.749) [-2211.532] (-2214.146) -- 0:04:03
185000 -- (-2217.605) (-2213.700) [-2217.769] (-2209.848) * [-2211.250] (-2236.823) (-2212.445) (-2219.955) -- 0:04:02
Average standard deviation of split frequencies: 0.013452
185500 -- (-2210.443) (-2217.751) [-2216.524] (-2211.238) * (-2213.433) (-2217.554) [-2210.060] (-2219.589) -- 0:04:01
186000 -- (-2223.095) [-2205.110] (-2211.000) (-2213.006) * [-2215.090] (-2212.591) (-2209.741) (-2219.731) -- 0:04:00
186500 -- (-2218.823) [-2207.237] (-2224.726) (-2216.400) * [-2215.775] (-2217.018) (-2220.492) (-2205.163) -- 0:03:59
187000 -- (-2224.698) [-2214.107] (-2213.783) (-2223.915) * (-2213.887) (-2207.275) (-2207.755) [-2208.786] -- 0:03:59
187500 -- [-2211.595] (-2233.461) (-2225.650) (-2213.685) * (-2211.536) (-2210.348) (-2215.158) [-2211.613] -- 0:04:02
188000 -- (-2222.242) (-2209.962) [-2203.830] (-2223.367) * [-2210.902] (-2218.962) (-2212.767) (-2209.246) -- 0:04:01
188500 -- (-2226.156) [-2201.582] (-2207.009) (-2226.761) * [-2214.246] (-2219.151) (-2216.345) (-2210.581) -- 0:04:01
189000 -- (-2227.829) (-2214.052) [-2212.664] (-2212.313) * (-2216.566) (-2211.367) (-2214.377) [-2202.936] -- 0:04:00
189500 -- (-2223.592) (-2212.127) [-2209.324] (-2204.259) * (-2222.802) [-2211.623] (-2215.747) (-2218.007) -- 0:03:59
190000 -- (-2208.235) (-2205.483) [-2210.976] (-2203.985) * (-2221.322) (-2211.351) (-2215.824) [-2217.186] -- 0:03:58
Average standard deviation of split frequencies: 0.014074
190500 -- (-2212.845) (-2210.954) (-2211.021) [-2207.049] * (-2214.793) [-2216.612] (-2220.018) (-2211.803) -- 0:03:57
191000 -- (-2212.436) [-2217.753] (-2215.685) (-2228.690) * (-2221.983) (-2216.311) [-2210.504] (-2216.166) -- 0:03:57
191500 -- (-2206.999) [-2208.573] (-2214.655) (-2220.770) * (-2216.510) (-2212.773) [-2209.120] (-2214.464) -- 0:04:00
192000 -- [-2207.550] (-2224.535) (-2223.119) (-2223.700) * (-2237.040) (-2219.622) (-2213.472) [-2206.412] -- 0:03:59
192500 -- (-2214.045) (-2220.816) [-2208.740] (-2224.982) * [-2214.002] (-2215.698) (-2212.322) (-2220.987) -- 0:03:59
193000 -- (-2213.817) (-2211.469) (-2216.315) [-2212.074] * [-2208.915] (-2215.509) (-2214.235) (-2215.256) -- 0:03:58
193500 -- (-2210.901) [-2211.044] (-2215.705) (-2211.547) * [-2231.765] (-2231.096) (-2209.037) (-2216.612) -- 0:03:57
194000 -- [-2209.772] (-2215.893) (-2217.481) (-2223.247) * (-2225.986) (-2217.969) [-2206.338] (-2215.058) -- 0:04:00
194500 -- [-2212.506] (-2211.367) (-2219.950) (-2214.844) * (-2224.931) [-2218.261] (-2215.709) (-2219.256) -- 0:04:00
195000 -- (-2216.050) (-2220.820) [-2216.327] (-2222.370) * (-2221.199) (-2226.982) (-2206.244) [-2211.891] -- 0:03:59
Average standard deviation of split frequencies: 0.011656
195500 -- [-2213.985] (-2208.093) (-2219.667) (-2222.987) * (-2218.983) (-2215.917) (-2211.306) [-2216.525] -- 0:03:58
196000 -- [-2207.627] (-2208.137) (-2217.107) (-2222.604) * (-2217.389) [-2215.066] (-2224.274) (-2203.454) -- 0:03:57
196500 -- (-2219.879) (-2211.900) [-2211.206] (-2216.817) * (-2214.658) [-2214.424] (-2216.491) (-2212.867) -- 0:03:57
197000 -- (-2213.209) (-2215.812) (-2222.070) [-2208.644] * (-2216.056) (-2212.213) [-2210.220] (-2215.106) -- 0:03:56
197500 -- (-2206.796) [-2214.592] (-2214.168) (-2210.764) * (-2221.631) [-2206.369] (-2206.581) (-2205.369) -- 0:03:59
198000 -- (-2218.098) (-2209.151) (-2204.426) [-2214.492] * (-2223.105) (-2212.570) [-2215.808] (-2214.364) -- 0:03:58
198500 -- [-2211.966] (-2209.677) (-2213.561) (-2232.297) * (-2221.945) (-2214.977) [-2226.047] (-2209.054) -- 0:03:58
199000 -- (-2207.550) [-2207.635] (-2210.342) (-2227.235) * [-2212.725] (-2226.713) (-2227.812) (-2213.687) -- 0:03:57
199500 -- (-2217.817) (-2210.170) (-2213.046) [-2216.664] * (-2224.060) (-2217.930) (-2218.226) [-2213.566] -- 0:03:56
200000 -- (-2214.169) [-2209.991] (-2220.499) (-2216.787) * (-2230.203) (-2208.482) (-2218.608) [-2212.035] -- 0:03:56
Average standard deviation of split frequencies: 0.011927
200500 -- (-2216.748) [-2213.246] (-2214.327) (-2213.302) * (-2211.559) (-2221.645) (-2215.422) [-2212.058] -- 0:03:55
201000 -- (-2215.163) (-2219.120) (-2218.206) [-2216.879] * (-2209.289) (-2212.519) [-2215.742] (-2211.364) -- 0:03:58
201500 -- (-2210.191) (-2223.946) (-2211.699) [-2217.739] * (-2208.664) (-2218.175) (-2209.162) [-2224.303] -- 0:03:57
202000 -- (-2212.214) (-2220.235) [-2207.699] (-2218.796) * (-2203.689) (-2222.653) (-2219.832) [-2210.501] -- 0:03:57
202500 -- [-2207.968] (-2214.930) (-2213.235) (-2209.406) * [-2213.481] (-2217.568) (-2217.152) (-2209.322) -- 0:03:56
203000 -- (-2215.943) (-2211.011) [-2207.275] (-2205.467) * (-2218.264) (-2216.373) [-2203.435] (-2214.975) -- 0:03:55
203500 -- [-2215.254] (-2219.572) (-2217.905) (-2207.100) * [-2209.223] (-2211.086) (-2220.097) (-2212.385) -- 0:03:54
204000 -- (-2211.102) [-2224.761] (-2226.517) (-2216.737) * (-2209.769) (-2215.257) (-2216.066) [-2219.418] -- 0:03:54
204500 -- (-2225.564) [-2212.624] (-2224.103) (-2214.250) * (-2207.252) (-2216.273) (-2212.300) [-2207.769] -- 0:03:53
205000 -- (-2215.868) [-2209.256] (-2210.652) (-2210.070) * [-2210.759] (-2217.839) (-2215.241) (-2214.826) -- 0:03:56
Average standard deviation of split frequencies: 0.011442
205500 -- (-2217.762) (-2213.618) (-2216.355) [-2215.760] * [-2213.788] (-2212.683) (-2216.163) (-2227.798) -- 0:03:55
206000 -- (-2224.116) [-2222.910] (-2225.954) (-2216.113) * (-2206.853) (-2219.698) [-2217.547] (-2218.255) -- 0:03:55
206500 -- (-2211.417) [-2214.176] (-2218.709) (-2209.811) * (-2218.047) (-2215.456) [-2207.776] (-2211.077) -- 0:03:54
207000 -- (-2214.564) (-2209.780) (-2218.488) [-2215.947] * (-2220.158) [-2204.565] (-2212.260) (-2218.233) -- 0:03:53
207500 -- [-2212.462] (-2218.515) (-2214.823) (-2224.557) * (-2212.628) [-2214.441] (-2216.543) (-2218.956) -- 0:03:52
208000 -- (-2216.963) (-2209.831) [-2212.275] (-2211.434) * (-2233.428) (-2207.846) (-2205.253) [-2209.131] -- 0:03:52
208500 -- (-2208.376) (-2208.110) [-2208.113] (-2212.181) * (-2220.094) [-2208.222] (-2218.185) (-2217.183) -- 0:03:51
209000 -- [-2210.963] (-2221.423) (-2218.145) (-2216.509) * [-2207.974] (-2209.936) (-2208.254) (-2211.339) -- 0:03:54
209500 -- [-2208.564] (-2206.255) (-2215.830) (-2210.126) * [-2212.531] (-2221.699) (-2218.667) (-2223.437) -- 0:03:53
210000 -- (-2214.072) (-2213.376) (-2216.256) [-2214.962] * (-2216.074) (-2211.016) [-2213.411] (-2211.582) -- 0:03:53
Average standard deviation of split frequencies: 0.010156
210500 -- (-2209.016) [-2207.888] (-2210.384) (-2213.876) * [-2213.533] (-2209.463) (-2213.316) (-2209.104) -- 0:03:52
211000 -- (-2214.318) (-2204.450) (-2207.600) [-2219.452] * (-2206.845) (-2211.139) (-2220.965) [-2205.316] -- 0:03:51
211500 -- (-2221.012) [-2206.331] (-2214.536) (-2216.968) * (-2207.355) [-2215.321] (-2214.558) (-2213.455) -- 0:03:51
212000 -- [-2203.651] (-2208.790) (-2215.326) (-2219.586) * (-2215.780) (-2221.864) (-2213.172) [-2210.613] -- 0:03:50
212500 -- (-2209.286) [-2205.890] (-2207.494) (-2223.143) * (-2215.481) [-2207.819] (-2215.962) (-2213.336) -- 0:03:53
213000 -- (-2213.642) (-2208.533) [-2205.143] (-2211.910) * (-2210.215) [-2211.132] (-2218.172) (-2213.110) -- 0:03:52
213500 -- (-2215.730) [-2205.083] (-2218.779) (-2224.705) * (-2219.836) [-2209.612] (-2219.932) (-2213.979) -- 0:03:52
214000 -- (-2210.457) (-2209.989) (-2210.373) [-2213.828] * (-2210.481) (-2213.860) (-2208.533) [-2220.130] -- 0:03:51
214500 -- (-2222.777) [-2209.136] (-2230.453) (-2207.554) * [-2210.000] (-2214.911) (-2216.457) (-2210.870) -- 0:03:50
215000 -- (-2208.128) [-2204.002] (-2219.200) (-2205.947) * (-2213.953) [-2218.035] (-2211.249) (-2217.965) -- 0:03:50
Average standard deviation of split frequencies: 0.010073
215500 -- (-2207.943) [-2203.778] (-2228.577) (-2205.975) * (-2215.255) (-2209.722) (-2217.141) [-2215.926] -- 0:03:49
216000 -- (-2211.792) (-2209.192) (-2224.130) [-2210.306] * (-2224.101) (-2214.906) (-2208.666) [-2214.869] -- 0:03:48
216500 -- (-2212.665) [-2210.652] (-2222.735) (-2217.185) * (-2214.168) [-2207.738] (-2210.568) (-2228.584) -- 0:03:51
217000 -- [-2213.156] (-2219.219) (-2221.090) (-2216.680) * (-2210.377) (-2211.214) (-2204.746) [-2220.207] -- 0:03:50
217500 -- [-2203.556] (-2224.812) (-2209.681) (-2203.417) * (-2217.672) (-2215.264) [-2209.842] (-2210.932) -- 0:03:50
218000 -- [-2203.801] (-2214.349) (-2229.184) (-2208.745) * [-2208.485] (-2220.200) (-2211.400) (-2208.221) -- 0:03:49
218500 -- (-2213.572) [-2207.163] (-2216.952) (-2217.120) * (-2208.006) (-2231.976) [-2202.241] (-2213.961) -- 0:03:48
219000 -- (-2212.868) [-2213.969] (-2217.273) (-2222.634) * (-2214.934) (-2230.889) [-2215.817] (-2217.330) -- 0:03:48
219500 -- [-2209.399] (-2211.392) (-2214.646) (-2217.190) * [-2210.915] (-2221.569) (-2223.908) (-2216.749) -- 0:03:47
220000 -- [-2217.386] (-2219.117) (-2217.635) (-2208.142) * (-2221.157) (-2215.801) (-2220.418) [-2210.919] -- 0:03:50
Average standard deviation of split frequencies: 0.009038
220500 -- [-2214.359] (-2215.517) (-2212.440) (-2211.265) * [-2207.100] (-2211.244) (-2215.714) (-2205.608) -- 0:03:49
221000 -- (-2220.806) (-2213.308) [-2211.346] (-2210.764) * (-2219.801) (-2212.946) (-2215.789) [-2211.083] -- 0:03:49
221500 -- (-2225.908) (-2216.870) (-2210.938) [-2213.860] * (-2218.156) (-2215.026) (-2213.052) [-2206.269] -- 0:03:48
222000 -- [-2215.161] (-2211.168) (-2202.399) (-2216.069) * [-2223.122] (-2214.994) (-2215.725) (-2209.846) -- 0:03:47
222500 -- (-2216.122) [-2217.577] (-2230.036) (-2214.391) * (-2220.848) [-2206.727] (-2215.024) (-2205.610) -- 0:03:47
223000 -- (-2222.033) (-2209.339) [-2219.059] (-2224.959) * (-2207.531) [-2203.709] (-2226.109) (-2213.386) -- 0:03:49
223500 -- (-2219.749) [-2202.283] (-2220.194) (-2213.082) * (-2209.485) [-2208.603] (-2218.191) (-2214.094) -- 0:03:49
224000 -- [-2220.500] (-2219.472) (-2212.339) (-2217.942) * (-2217.752) (-2209.396) [-2214.136] (-2210.362) -- 0:03:48
224500 -- (-2214.897) (-2210.556) (-2205.850) [-2209.445] * [-2207.719] (-2209.333) (-2218.725) (-2217.802) -- 0:03:47
225000 -- (-2213.385) (-2212.137) (-2211.032) [-2224.431] * (-2213.736) (-2211.841) [-2216.152] (-2218.234) -- 0:03:47
Average standard deviation of split frequencies: 0.007862
225500 -- [-2215.455] (-2218.748) (-2212.265) (-2210.766) * [-2208.040] (-2217.762) (-2213.001) (-2216.552) -- 0:03:46
226000 -- (-2217.207) (-2209.844) (-2220.613) [-2204.509] * (-2222.903) (-2225.230) (-2213.123) [-2207.354] -- 0:03:46
226500 -- (-2220.044) (-2218.697) [-2207.749] (-2226.917) * (-2217.936) (-2213.561) (-2212.627) [-2208.194] -- 0:03:48
227000 -- (-2219.246) [-2211.360] (-2221.207) (-2212.695) * (-2217.320) (-2213.305) [-2210.114] (-2212.162) -- 0:03:48
227500 -- (-2215.884) (-2215.438) [-2208.388] (-2217.222) * (-2216.921) (-2212.634) (-2218.393) [-2208.366] -- 0:03:47
228000 -- (-2227.670) [-2213.174] (-2220.621) (-2220.084) * [-2209.787] (-2215.484) (-2216.551) (-2211.338) -- 0:03:46
228500 -- [-2220.092] (-2215.786) (-2209.237) (-2216.610) * [-2205.517] (-2225.040) (-2214.979) (-2213.530) -- 0:03:46
229000 -- (-2217.118) [-2211.771] (-2207.285) (-2216.056) * [-2213.930] (-2215.973) (-2214.838) (-2215.009) -- 0:03:45
229500 -- (-2213.313) [-2215.363] (-2210.413) (-2209.863) * (-2218.990) (-2221.270) (-2223.033) [-2216.022] -- 0:03:44
230000 -- (-2207.155) (-2209.719) (-2225.123) [-2207.425] * (-2215.776) (-2211.175) (-2217.603) [-2209.909] -- 0:03:47
Average standard deviation of split frequencies: 0.007703
230500 -- [-2215.673] (-2209.276) (-2218.596) (-2210.290) * (-2227.754) (-2227.055) (-2219.454) [-2202.208] -- 0:03:47
231000 -- [-2208.008] (-2216.840) (-2211.390) (-2210.722) * [-2210.949] (-2223.502) (-2217.105) (-2208.487) -- 0:03:46
231500 -- (-2224.775) [-2209.079] (-2212.192) (-2210.048) * [-2223.456] (-2224.554) (-2218.581) (-2214.448) -- 0:03:45
232000 -- (-2222.579) (-2212.383) (-2226.792) [-2212.271] * (-2225.002) [-2217.779] (-2217.421) (-2214.148) -- 0:03:45
232500 -- [-2207.208] (-2209.942) (-2217.786) (-2215.833) * [-2208.528] (-2214.760) (-2211.734) (-2217.109) -- 0:03:44
233000 -- (-2206.022) [-2221.124] (-2225.630) (-2221.974) * [-2208.405] (-2228.075) (-2213.903) (-2221.395) -- 0:03:43
233500 -- (-2210.394) (-2222.707) [-2212.884] (-2222.942) * (-2213.797) (-2217.267) [-2216.973] (-2212.013) -- 0:03:43
234000 -- (-2211.318) (-2209.532) [-2216.125] (-2214.506) * [-2209.938] (-2218.620) (-2213.486) (-2221.474) -- 0:03:45
234500 -- (-2209.172) (-2220.102) (-2219.059) [-2208.169] * (-2220.119) [-2204.823] (-2221.791) (-2218.975) -- 0:03:45
235000 -- (-2213.875) (-2210.812) [-2208.807] (-2211.069) * (-2210.108) (-2210.320) (-2215.134) [-2221.013] -- 0:03:44
Average standard deviation of split frequencies: 0.007990
235500 -- (-2218.483) (-2219.191) [-2207.379] (-2220.120) * [-2213.993] (-2216.326) (-2214.389) (-2220.168) -- 0:03:43
236000 -- (-2217.822) (-2212.311) [-2210.634] (-2205.858) * [-2208.561] (-2211.426) (-2221.634) (-2215.826) -- 0:03:43
236500 -- [-2217.645] (-2218.112) (-2214.009) (-2220.913) * (-2221.837) [-2212.982] (-2204.824) (-2216.975) -- 0:03:42
237000 -- (-2215.251) (-2211.919) [-2212.411] (-2213.249) * (-2216.944) [-2208.134] (-2213.858) (-2212.893) -- 0:03:42
237500 -- (-2214.807) (-2219.322) [-2216.981] (-2211.415) * (-2219.194) (-2222.159) (-2207.821) [-2208.311] -- 0:03:44
238000 -- (-2213.156) (-2218.448) (-2209.718) [-2215.264] * (-2211.910) (-2210.797) [-2208.090] (-2221.594) -- 0:03:44
238500 -- (-2229.471) (-2212.276) (-2214.116) [-2212.938] * (-2224.670) [-2217.380] (-2203.623) (-2217.652) -- 0:03:43
239000 -- (-2211.159) (-2210.831) [-2209.210] (-2220.295) * [-2211.812] (-2217.326) (-2212.511) (-2222.384) -- 0:03:42
239500 -- (-2227.456) (-2225.836) [-2213.866] (-2221.571) * [-2209.956] (-2227.443) (-2214.490) (-2220.650) -- 0:03:42
240000 -- (-2219.728) (-2217.081) [-2203.058] (-2234.233) * [-2206.825] (-2213.470) (-2220.517) (-2211.925) -- 0:03:41
Average standard deviation of split frequencies: 0.008287
240500 -- [-2204.887] (-2209.934) (-2207.846) (-2212.581) * (-2226.394) (-2213.214) (-2213.018) [-2208.883] -- 0:03:41
241000 -- (-2209.184) [-2204.583] (-2206.974) (-2216.029) * (-2221.926) (-2217.065) (-2212.589) [-2204.967] -- 0:03:40
241500 -- (-2219.789) (-2217.733) [-2218.373] (-2224.062) * (-2216.326) (-2213.884) [-2213.088] (-2209.126) -- 0:03:42
242000 -- (-2206.475) [-2219.894] (-2217.613) (-2213.013) * (-2208.721) (-2209.302) [-2209.606] (-2215.035) -- 0:03:42
242500 -- [-2211.608] (-2204.960) (-2217.292) (-2215.275) * [-2204.210] (-2220.167) (-2216.760) (-2215.871) -- 0:03:41
243000 -- (-2208.395) (-2215.148) (-2226.255) [-2212.861] * (-2222.541) (-2208.350) (-2211.672) [-2206.114] -- 0:03:41
243500 -- (-2206.260) (-2219.614) (-2208.184) [-2223.006] * [-2209.096] (-2225.997) (-2214.563) (-2209.352) -- 0:03:40
244000 -- [-2218.161] (-2210.689) (-2212.247) (-2218.341) * (-2212.016) [-2213.628] (-2220.400) (-2214.791) -- 0:03:43
244500 -- (-2219.675) [-2210.998] (-2228.031) (-2207.832) * (-2215.222) [-2206.901] (-2218.225) (-2205.549) -- 0:03:42
245000 -- (-2209.387) [-2211.119] (-2218.331) (-2206.527) * (-2215.786) (-2211.305) (-2223.384) [-2213.202] -- 0:03:41
Average standard deviation of split frequencies: 0.009581
245500 -- (-2209.291) (-2217.781) (-2225.837) [-2204.479] * (-2223.949) (-2212.338) [-2212.278] (-2220.679) -- 0:03:41
246000 -- [-2224.123] (-2226.735) (-2226.757) (-2210.953) * [-2206.397] (-2227.925) (-2205.756) (-2214.127) -- 0:03:40
246500 -- (-2216.712) [-2218.462] (-2216.135) (-2209.497) * (-2212.623) (-2209.807) [-2217.023] (-2213.742) -- 0:03:40
247000 -- [-2214.769] (-2203.300) (-2223.564) (-2214.298) * (-2212.850) [-2210.969] (-2220.881) (-2212.681) -- 0:03:39
247500 -- [-2213.849] (-2207.860) (-2216.300) (-2215.034) * (-2206.531) (-2209.026) [-2213.310] (-2213.469) -- 0:03:38
248000 -- (-2227.810) [-2203.009] (-2217.342) (-2214.383) * [-2208.998] (-2222.441) (-2214.096) (-2214.228) -- 0:03:41
248500 -- (-2204.006) [-2213.727] (-2210.537) (-2214.578) * (-2214.021) (-2215.082) [-2202.727] (-2210.477) -- 0:03:40
249000 -- (-2220.473) (-2210.550) [-2213.022] (-2220.254) * (-2214.859) (-2220.297) [-2212.485] (-2210.245) -- 0:03:40
249500 -- (-2214.985) (-2208.399) (-2217.876) [-2208.908] * [-2209.350] (-2234.173) (-2212.059) (-2215.575) -- 0:03:39
250000 -- (-2201.596) (-2218.513) [-2224.988] (-2218.627) * (-2212.815) [-2209.895] (-2215.975) (-2213.308) -- 0:03:39
Average standard deviation of split frequencies: 0.010271
250500 -- (-2202.646) (-2223.297) (-2212.846) [-2204.593] * (-2209.423) (-2209.547) [-2212.520] (-2217.624) -- 0:03:38
251000 -- (-2213.541) (-2215.498) (-2234.749) [-2220.155] * (-2208.744) [-2209.891] (-2215.988) (-2224.663) -- 0:03:37
251500 -- [-2205.805] (-2218.939) (-2218.888) (-2206.195) * (-2212.002) (-2213.092) (-2225.178) [-2223.665] -- 0:03:37
252000 -- (-2208.782) [-2219.628] (-2213.436) (-2212.527) * (-2211.314) [-2214.293] (-2205.545) (-2218.815) -- 0:03:39
252500 -- (-2214.451) (-2215.830) [-2223.744] (-2217.348) * (-2216.538) [-2207.207] (-2212.247) (-2222.652) -- 0:03:39
253000 -- (-2207.567) (-2211.091) (-2221.172) [-2209.118] * (-2206.334) (-2213.080) [-2216.395] (-2211.554) -- 0:03:38
253500 -- (-2215.372) [-2215.631] (-2209.044) (-2214.808) * [-2204.640] (-2205.085) (-2207.934) (-2213.756) -- 0:03:37
254000 -- [-2207.968] (-2226.305) (-2207.305) (-2211.215) * (-2221.141) (-2217.336) [-2205.152] (-2202.053) -- 0:03:37
254500 -- (-2230.892) (-2210.601) [-2211.734] (-2202.494) * (-2219.668) [-2211.732] (-2224.664) (-2219.221) -- 0:03:36
255000 -- (-2228.878) (-2204.535) (-2221.260) [-2209.123] * (-2213.643) [-2206.181] (-2218.526) (-2217.684) -- 0:03:36
Average standard deviation of split frequencies: 0.011332
255500 -- (-2214.747) (-2209.087) [-2215.330] (-2208.978) * (-2211.674) [-2209.657] (-2219.799) (-2213.785) -- 0:03:38
256000 -- (-2217.233) [-2205.889] (-2220.867) (-2220.959) * [-2219.173] (-2228.555) (-2210.105) (-2217.869) -- 0:03:37
256500 -- (-2218.608) [-2210.968] (-2205.547) (-2214.195) * (-2214.662) (-2228.001) (-2215.498) [-2219.390] -- 0:03:37
257000 -- [-2215.727] (-2208.369) (-2214.484) (-2222.777) * [-2209.267] (-2218.865) (-2213.720) (-2225.127) -- 0:03:36
257500 -- (-2215.442) [-2199.346] (-2210.991) (-2211.288) * (-2218.593) [-2208.377] (-2213.803) (-2210.110) -- 0:03:36
258000 -- [-2206.523] (-2210.563) (-2215.427) (-2212.380) * (-2218.590) (-2215.260) (-2215.988) [-2208.207] -- 0:03:35
258500 -- [-2210.382] (-2211.820) (-2220.901) (-2206.691) * (-2221.083) [-2210.769] (-2211.606) (-2216.615) -- 0:03:38
259000 -- (-2216.334) (-2205.278) (-2215.787) [-2213.019] * (-2213.281) [-2213.909] (-2220.760) (-2208.657) -- 0:03:37
259500 -- (-2212.290) (-2212.819) [-2215.678] (-2211.960) * (-2214.533) (-2217.517) (-2223.827) [-2208.361] -- 0:03:36
260000 -- (-2219.858) (-2208.983) (-2210.508) [-2214.019] * (-2216.433) (-2215.902) [-2210.203] (-2212.492) -- 0:03:36
Average standard deviation of split frequencies: 0.009321
260500 -- (-2216.506) [-2211.034] (-2212.090) (-2220.535) * (-2211.840) [-2216.287] (-2213.028) (-2210.404) -- 0:03:35
261000 -- (-2207.909) [-2206.768] (-2207.716) (-2207.772) * [-2211.091] (-2213.298) (-2220.939) (-2221.195) -- 0:03:35
261500 -- (-2211.470) [-2214.844] (-2217.710) (-2218.336) * (-2212.423) (-2225.499) [-2214.702] (-2215.829) -- 0:03:34
262000 -- (-2213.338) [-2210.156] (-2215.090) (-2212.360) * [-2210.311] (-2206.687) (-2216.445) (-2208.135) -- 0:03:36
262500 -- (-2215.712) (-2215.522) (-2208.652) [-2216.511] * (-2224.026) (-2216.993) [-2201.565] (-2212.419) -- 0:03:36
263000 -- (-2208.089) (-2216.163) [-2211.333] (-2214.145) * [-2206.377] (-2217.967) (-2213.127) (-2217.007) -- 0:03:35
263500 -- (-2212.209) (-2223.134) [-2207.975] (-2224.288) * [-2211.309] (-2221.945) (-2215.079) (-2219.364) -- 0:03:35
264000 -- [-2208.592] (-2218.127) (-2213.944) (-2221.519) * (-2216.258) [-2204.031] (-2215.257) (-2214.186) -- 0:03:34
264500 -- (-2212.728) (-2217.218) [-2205.218] (-2221.492) * (-2204.638) [-2206.958] (-2218.354) (-2221.753) -- 0:03:34
265000 -- [-2203.893] (-2218.811) (-2216.953) (-2211.049) * (-2209.292) [-2210.074] (-2220.170) (-2212.170) -- 0:03:33
Average standard deviation of split frequencies: 0.008861
265500 -- (-2216.329) (-2218.757) [-2206.830] (-2225.572) * (-2213.924) (-2210.119) [-2209.082] (-2213.610) -- 0:03:33
266000 -- (-2205.564) (-2230.995) (-2216.110) [-2223.405] * [-2212.088] (-2216.378) (-2211.572) (-2212.947) -- 0:03:35
266500 -- (-2202.284) (-2214.434) (-2211.793) [-2219.068] * (-2207.393) (-2213.657) (-2219.301) [-2211.274] -- 0:03:34
267000 -- [-2207.942] (-2215.201) (-2209.847) (-2213.139) * (-2215.219) [-2215.836] (-2214.738) (-2226.522) -- 0:03:34
267500 -- [-2214.645] (-2215.723) (-2205.060) (-2214.524) * [-2211.896] (-2227.615) (-2210.770) (-2212.909) -- 0:03:33
268000 -- (-2215.509) (-2216.623) [-2202.500] (-2212.217) * [-2212.176] (-2209.159) (-2213.167) (-2209.362) -- 0:03:33
268500 -- (-2216.182) (-2222.200) (-2223.191) [-2212.267] * [-2207.923] (-2211.065) (-2214.823) (-2213.680) -- 0:03:32
269000 -- [-2209.291] (-2220.924) (-2205.356) (-2214.527) * (-2210.513) [-2211.632] (-2220.977) (-2210.361) -- 0:03:31
269500 -- (-2221.188) [-2207.680] (-2212.308) (-2213.710) * (-2209.885) (-2215.962) (-2207.307) [-2206.242] -- 0:03:34
270000 -- (-2216.757) (-2224.478) (-2213.799) [-2212.419] * (-2220.850) (-2234.201) [-2208.070] (-2210.758) -- 0:03:33
Average standard deviation of split frequencies: 0.010182
270500 -- (-2211.428) (-2217.301) [-2211.547] (-2217.867) * (-2211.880) (-2211.873) [-2208.812] (-2219.457) -- 0:03:33
271000 -- [-2211.103] (-2211.146) (-2220.204) (-2217.624) * (-2216.684) (-2207.448) (-2216.765) [-2217.826] -- 0:03:32
271500 -- [-2213.235] (-2206.222) (-2213.808) (-2223.343) * (-2219.968) (-2209.500) (-2209.716) [-2214.490] -- 0:03:31
272000 -- [-2210.600] (-2217.176) (-2214.393) (-2221.591) * (-2216.390) (-2214.013) [-2207.725] (-2217.009) -- 0:03:31
272500 -- (-2215.535) [-2206.296] (-2216.404) (-2221.926) * (-2206.056) (-2220.482) [-2205.946] (-2212.185) -- 0:03:30
273000 -- [-2216.825] (-2214.996) (-2214.338) (-2221.048) * (-2222.494) (-2209.313) (-2224.139) [-2213.898] -- 0:03:33
273500 -- (-2217.467) [-2212.751] (-2215.597) (-2215.931) * (-2219.540) (-2219.672) (-2216.867) [-2217.025] -- 0:03:32
274000 -- (-2211.271) (-2208.190) (-2217.971) [-2216.475] * (-2224.476) (-2215.983) (-2212.968) [-2210.288] -- 0:03:31
274500 -- [-2220.898] (-2211.296) (-2222.429) (-2207.326) * [-2215.736] (-2227.419) (-2208.530) (-2213.794) -- 0:03:31
275000 -- (-2221.047) (-2208.235) [-2217.217] (-2213.699) * (-2209.484) (-2206.963) [-2205.674] (-2217.598) -- 0:03:30
Average standard deviation of split frequencies: 0.009197
275500 -- (-2233.302) [-2213.166] (-2220.494) (-2213.841) * (-2213.133) [-2210.645] (-2212.884) (-2216.840) -- 0:03:30
276000 -- (-2216.473) [-2213.731] (-2218.654) (-2220.962) * [-2213.741] (-2209.767) (-2234.328) (-2220.124) -- 0:03:29
276500 -- [-2207.027] (-2216.446) (-2212.107) (-2220.680) * (-2212.651) [-2205.963] (-2220.422) (-2214.491) -- 0:03:31
277000 -- (-2208.148) [-2222.879] (-2233.558) (-2214.630) * (-2225.802) (-2210.756) (-2226.550) [-2215.266] -- 0:03:31
277500 -- (-2217.469) (-2234.671) (-2227.585) [-2213.197] * (-2216.302) (-2221.931) (-2215.123) [-2224.424] -- 0:03:30
278000 -- (-2217.492) (-2217.182) (-2229.662) [-2209.725] * (-2209.713) [-2215.255] (-2214.207) (-2230.485) -- 0:03:30
278500 -- [-2216.863] (-2212.627) (-2212.378) (-2226.273) * (-2210.545) [-2210.596] (-2212.427) (-2212.197) -- 0:03:29
279000 -- [-2205.642] (-2211.110) (-2225.595) (-2225.904) * [-2205.538] (-2225.263) (-2214.578) (-2211.026) -- 0:03:31
279500 -- (-2212.537) [-2216.014] (-2215.515) (-2223.834) * [-2228.726] (-2219.396) (-2231.278) (-2208.280) -- 0:03:31
280000 -- [-2206.160] (-2217.297) (-2223.817) (-2216.291) * [-2225.396] (-2224.528) (-2214.383) (-2224.330) -- 0:03:30
Average standard deviation of split frequencies: 0.008140
280500 -- (-2213.315) [-2206.995] (-2212.609) (-2209.292) * (-2220.347) [-2212.665] (-2216.195) (-2217.851) -- 0:03:30
281000 -- (-2214.440) [-2212.191] (-2215.215) (-2211.057) * (-2225.194) (-2216.188) (-2223.140) [-2212.534] -- 0:03:29
281500 -- (-2214.510) [-2214.443] (-2211.209) (-2207.196) * (-2213.975) (-2224.491) (-2217.868) [-2215.101] -- 0:03:29
282000 -- [-2220.846] (-2236.207) (-2215.490) (-2214.846) * (-2219.809) (-2238.359) (-2218.772) [-2213.283] -- 0:03:28
282500 -- (-2211.746) [-2205.672] (-2210.049) (-2224.664) * [-2212.105] (-2228.090) (-2219.003) (-2221.578) -- 0:03:28
283000 -- (-2217.364) [-2210.287] (-2218.634) (-2223.706) * (-2226.190) [-2213.330] (-2213.012) (-2223.379) -- 0:03:30
283500 -- (-2216.477) [-2215.996] (-2209.900) (-2211.784) * (-2226.299) [-2217.316] (-2217.145) (-2213.129) -- 0:03:29
284000 -- (-2208.598) (-2209.364) [-2211.359] (-2229.273) * (-2216.120) (-2221.056) (-2214.342) [-2218.751] -- 0:03:29
284500 -- (-2207.172) [-2218.439] (-2212.786) (-2218.397) * (-2215.375) [-2220.272] (-2211.774) (-2217.800) -- 0:03:28
285000 -- (-2210.991) (-2219.637) [-2215.592] (-2212.829) * [-2210.196] (-2214.083) (-2212.278) (-2219.522) -- 0:03:28
Average standard deviation of split frequencies: 0.007607
285500 -- [-2210.857] (-2215.259) (-2216.823) (-2212.377) * (-2213.866) (-2220.148) (-2212.460) [-2212.704] -- 0:03:27
286000 -- (-2225.564) (-2216.161) [-2207.695] (-2209.925) * (-2209.321) (-2224.564) (-2214.208) [-2209.257] -- 0:03:27
286500 -- (-2222.997) (-2233.761) [-2205.923] (-2210.941) * (-2217.439) (-2224.277) (-2211.651) [-2211.168] -- 0:03:26
287000 -- (-2217.827) (-2215.889) [-2217.444] (-2217.437) * [-2209.771] (-2214.409) (-2207.704) (-2217.453) -- 0:03:28
287500 -- (-2221.893) [-2205.718] (-2216.039) (-2221.308) * (-2209.356) (-2225.419) (-2213.835) [-2216.541] -- 0:03:28
288000 -- (-2223.636) [-2206.053] (-2220.346) (-2211.921) * (-2228.232) [-2213.132] (-2217.060) (-2207.109) -- 0:03:27
288500 -- (-2226.107) [-2208.433] (-2214.128) (-2215.662) * [-2205.508] (-2217.109) (-2210.080) (-2202.671) -- 0:03:27
289000 -- (-2214.053) (-2207.272) (-2211.653) [-2212.441] * (-2210.102) (-2211.980) (-2216.201) [-2204.779] -- 0:03:26
289500 -- (-2210.725) (-2221.674) (-2205.607) [-2213.325] * (-2213.779) (-2216.959) [-2209.777] (-2203.560) -- 0:03:26
290000 -- (-2207.806) [-2208.345] (-2211.873) (-2212.789) * (-2209.432) (-2217.197) [-2201.271] (-2211.942) -- 0:03:25
Average standard deviation of split frequencies: 0.007360
290500 -- [-2213.270] (-2207.242) (-2212.453) (-2217.418) * (-2212.716) (-2213.580) (-2210.151) [-2207.208] -- 0:03:27
291000 -- [-2202.810] (-2215.974) (-2212.583) (-2211.414) * (-2206.473) (-2218.029) [-2210.283] (-2206.710) -- 0:03:27
291500 -- [-2209.088] (-2212.335) (-2208.942) (-2217.738) * [-2217.352] (-2211.034) (-2211.077) (-2208.693) -- 0:03:26
292000 -- (-2212.159) (-2212.980) (-2211.539) [-2214.220] * (-2212.914) (-2216.025) [-2213.461] (-2218.116) -- 0:03:26
292500 -- (-2209.627) (-2217.529) (-2222.458) [-2212.088] * (-2209.591) (-2221.794) [-2212.476] (-2216.443) -- 0:03:25
293000 -- (-2217.408) [-2215.569] (-2220.855) (-2222.026) * (-2209.134) (-2214.676) (-2214.938) [-2206.776] -- 0:03:25
293500 -- (-2208.662) (-2216.218) (-2213.868) [-2215.719] * (-2214.207) [-2212.852] (-2231.483) (-2224.830) -- 0:03:24
294000 -- [-2215.445] (-2215.371) (-2211.557) (-2213.211) * (-2207.894) [-2212.812] (-2206.777) (-2214.499) -- 0:03:24
294500 -- [-2219.130] (-2216.586) (-2212.641) (-2214.739) * (-2213.514) (-2215.871) (-2220.885) [-2222.212] -- 0:03:26
295000 -- (-2215.106) [-2206.579] (-2219.672) (-2209.947) * [-2210.710] (-2224.748) (-2215.034) (-2217.889) -- 0:03:25
Average standard deviation of split frequencies: 0.007228
295500 -- (-2223.860) [-2207.218] (-2218.726) (-2208.221) * (-2206.723) (-2214.914) (-2221.001) [-2209.129] -- 0:03:25
296000 -- (-2216.363) (-2212.953) (-2208.224) [-2209.061] * (-2218.512) (-2214.758) (-2221.850) [-2213.920] -- 0:03:24
296500 -- (-2213.410) (-2221.435) [-2208.059] (-2209.913) * (-2212.336) (-2213.241) (-2206.188) [-2211.647] -- 0:03:24
297000 -- (-2221.373) [-2214.646] (-2212.694) (-2210.443) * (-2219.873) [-2212.865] (-2214.247) (-2216.281) -- 0:03:23
297500 -- (-2220.549) (-2205.551) (-2213.901) [-2221.195] * [-2224.767] (-2224.411) (-2209.226) (-2217.348) -- 0:03:23
298000 -- (-2230.037) [-2214.020] (-2209.482) (-2228.372) * (-2211.248) (-2221.051) [-2205.688] (-2213.616) -- 0:03:22
298500 -- (-2219.171) (-2211.440) (-2214.300) [-2209.254] * (-2228.360) (-2216.487) (-2216.659) [-2212.058] -- 0:03:24
299000 -- (-2210.696) [-2206.421] (-2215.327) (-2211.057) * [-2209.130] (-2211.161) (-2211.611) (-2212.150) -- 0:03:23
299500 -- [-2211.666] (-2217.069) (-2216.744) (-2208.326) * [-2211.202] (-2214.282) (-2214.021) (-2207.948) -- 0:03:23
300000 -- [-2207.912] (-2215.888) (-2219.109) (-2215.880) * (-2217.365) [-2214.622] (-2215.414) (-2215.970) -- 0:03:23
Average standard deviation of split frequencies: 0.007719
300500 -- [-2208.850] (-2220.747) (-2218.448) (-2217.911) * [-2208.887] (-2218.905) (-2211.938) (-2217.577) -- 0:03:22
301000 -- [-2212.506] (-2215.752) (-2224.474) (-2215.529) * (-2216.239) (-2222.932) [-2205.284] (-2223.463) -- 0:03:22
301500 -- (-2220.661) (-2219.743) [-2211.317] (-2220.472) * (-2219.125) [-2210.138] (-2223.443) (-2209.072) -- 0:03:21
302000 -- (-2222.369) (-2218.967) [-2219.816] (-2211.323) * (-2227.947) (-2210.503) [-2207.927] (-2215.369) -- 0:03:21
302500 -- (-2220.258) (-2211.845) (-2217.459) [-2207.229] * (-2211.870) (-2210.035) [-2205.183] (-2208.072) -- 0:03:22
303000 -- (-2228.791) (-2214.105) (-2214.143) [-2205.750] * (-2214.840) (-2211.410) (-2212.511) [-2207.213] -- 0:03:22
303500 -- (-2218.774) (-2214.207) [-2208.230] (-2209.091) * (-2213.528) (-2209.064) [-2208.278] (-2217.186) -- 0:03:21
304000 -- (-2217.332) (-2212.898) (-2228.292) [-2207.832] * (-2219.399) (-2211.322) [-2203.814] (-2214.904) -- 0:03:21
304500 -- (-2227.823) (-2214.651) [-2214.460] (-2204.744) * [-2210.896] (-2216.061) (-2217.136) (-2211.022) -- 0:03:20
305000 -- (-2227.868) (-2205.282) (-2219.954) [-2213.051] * (-2219.924) (-2209.628) (-2225.150) [-2209.950] -- 0:03:20
Average standard deviation of split frequencies: 0.008058
305500 -- (-2221.857) (-2213.818) (-2210.749) [-2210.238] * [-2222.019] (-2216.000) (-2219.391) (-2210.835) -- 0:03:20
306000 -- (-2211.653) (-2217.758) [-2219.702] (-2212.461) * [-2209.527] (-2212.341) (-2213.042) (-2216.021) -- 0:03:19
306500 -- (-2227.635) (-2210.784) (-2220.089) [-2210.595] * (-2212.320) (-2216.224) (-2219.827) [-2220.904] -- 0:03:21
307000 -- (-2208.049) [-2222.276] (-2215.569) (-2220.894) * (-2215.784) [-2211.741] (-2229.260) (-2226.836) -- 0:03:20
307500 -- (-2207.339) (-2218.977) [-2213.419] (-2210.624) * [-2211.899] (-2216.182) (-2218.823) (-2220.297) -- 0:03:20
308000 -- (-2218.545) (-2213.990) [-2209.395] (-2217.458) * (-2217.676) [-2205.052] (-2215.721) (-2218.738) -- 0:03:19
308500 -- (-2211.113) (-2214.528) [-2203.192] (-2216.616) * [-2210.007] (-2207.717) (-2216.402) (-2215.247) -- 0:03:19
309000 -- (-2221.250) (-2209.164) (-2209.201) [-2212.880] * (-2206.218) (-2223.876) [-2213.454] (-2219.807) -- 0:03:19
309500 -- (-2208.778) (-2210.813) (-2212.062) [-2212.077] * (-2217.886) [-2212.407] (-2209.170) (-2240.826) -- 0:03:18
310000 -- [-2203.725] (-2217.547) (-2225.838) (-2214.364) * (-2214.201) (-2213.284) [-2214.567] (-2211.482) -- 0:03:18
Average standard deviation of split frequencies: 0.008521
310500 -- [-2210.368] (-2217.873) (-2209.571) (-2216.399) * (-2223.742) (-2213.293) [-2213.965] (-2215.936) -- 0:03:19
311000 -- (-2215.491) (-2219.848) (-2227.145) [-2213.148] * (-2210.951) (-2220.766) (-2217.924) [-2209.688] -- 0:03:19
311500 -- (-2213.877) [-2207.057] (-2218.793) (-2208.711) * [-2221.606] (-2221.746) (-2205.652) (-2216.897) -- 0:03:18
312000 -- (-2225.140) (-2201.701) [-2212.889] (-2214.439) * [-2208.333] (-2220.586) (-2213.601) (-2208.680) -- 0:03:18
312500 -- (-2216.257) [-2203.958] (-2213.620) (-2212.000) * [-2207.241] (-2208.678) (-2218.931) (-2216.083) -- 0:03:18
313000 -- (-2214.210) (-2221.335) [-2214.712] (-2221.860) * [-2205.243] (-2212.961) (-2219.931) (-2217.746) -- 0:03:17
313500 -- (-2215.770) (-2219.981) (-2209.226) [-2204.925] * [-2205.028] (-2218.987) (-2218.021) (-2212.833) -- 0:03:17
314000 -- (-2217.046) (-2226.853) (-2233.978) [-2205.837] * (-2222.150) (-2216.330) (-2238.052) [-2206.755] -- 0:03:16
314500 -- (-2213.423) [-2213.897] (-2216.836) (-2205.163) * (-2210.984) [-2204.584] (-2213.141) (-2218.192) -- 0:03:16
315000 -- (-2214.061) [-2208.851] (-2217.411) (-2208.770) * (-2208.599) [-2206.477] (-2211.045) (-2213.460) -- 0:03:17
Average standard deviation of split frequencies: 0.008951
315500 -- (-2214.083) (-2214.843) (-2212.648) [-2210.352] * (-2220.599) (-2206.126) [-2211.363] (-2213.889) -- 0:03:17
316000 -- (-2214.102) [-2212.672] (-2224.214) (-2222.755) * [-2208.473] (-2205.144) (-2217.231) (-2202.579) -- 0:03:16
316500 -- (-2221.400) (-2213.255) (-2213.400) [-2209.287] * [-2211.401] (-2215.258) (-2213.510) (-2210.728) -- 0:03:16
317000 -- [-2209.809] (-2210.138) (-2216.224) (-2220.402) * [-2211.980] (-2218.484) (-2221.154) (-2201.682) -- 0:03:16
317500 -- [-2210.827] (-2214.025) (-2224.268) (-2220.438) * (-2215.996) (-2229.238) [-2208.667] (-2211.311) -- 0:03:15
318000 -- (-2209.701) (-2217.097) (-2228.053) [-2213.291] * (-2214.445) (-2220.356) (-2210.048) [-2212.524] -- 0:03:15
318500 -- [-2210.296] (-2211.634) (-2229.994) (-2220.439) * (-2220.502) [-2207.904] (-2215.698) (-2210.621) -- 0:03:14
319000 -- (-2207.160) (-2212.393) [-2220.802] (-2210.444) * (-2213.656) (-2222.329) (-2215.530) [-2205.782] -- 0:03:16
319500 -- (-2218.667) [-2206.149] (-2226.809) (-2210.686) * (-2223.414) (-2220.106) (-2214.917) [-2210.256] -- 0:03:15
320000 -- (-2210.296) (-2208.052) [-2228.348] (-2207.658) * (-2208.380) (-2216.083) (-2223.790) [-2208.981] -- 0:03:15
Average standard deviation of split frequencies: 0.010743
320500 -- (-2238.105) (-2220.758) [-2206.581] (-2208.680) * [-2208.723] (-2211.158) (-2227.978) (-2215.720) -- 0:03:15
321000 -- (-2215.039) [-2218.466] (-2212.217) (-2207.671) * [-2212.210] (-2220.500) (-2212.725) (-2218.206) -- 0:03:14
321500 -- (-2212.179) [-2213.147] (-2212.826) (-2223.246) * (-2211.862) (-2215.311) [-2216.233] (-2210.727) -- 0:03:14
322000 -- (-2203.959) (-2218.857) [-2207.993] (-2210.249) * (-2219.062) (-2216.892) [-2206.690] (-2212.630) -- 0:03:13
322500 -- [-2217.279] (-2214.576) (-2224.900) (-2212.752) * (-2216.460) [-2212.596] (-2217.313) (-2216.431) -- 0:03:13
323000 -- (-2213.779) [-2209.026] (-2211.303) (-2221.809) * [-2215.306] (-2213.027) (-2212.253) (-2206.762) -- 0:03:14
323500 -- (-2220.668) [-2211.917] (-2230.489) (-2209.498) * (-2218.699) [-2216.754] (-2227.470) (-2209.135) -- 0:03:14
324000 -- (-2225.145) (-2207.448) [-2222.627] (-2222.771) * (-2211.363) [-2212.373] (-2212.462) (-2211.677) -- 0:03:14
324500 -- (-2214.966) (-2218.158) [-2211.141] (-2209.350) * (-2209.906) (-2214.610) (-2217.340) [-2204.421] -- 0:03:13
325000 -- (-2210.979) [-2222.653] (-2214.458) (-2211.003) * (-2208.552) (-2210.708) (-2212.509) [-2209.720] -- 0:03:13
Average standard deviation of split frequencies: 0.010011
325500 -- [-2214.627] (-2212.187) (-2217.165) (-2216.033) * (-2211.773) (-2213.907) [-2221.552] (-2209.432) -- 0:03:12
326000 -- [-2209.751] (-2217.081) (-2213.250) (-2219.388) * [-2208.440] (-2217.762) (-2226.979) (-2214.436) -- 0:03:12
326500 -- [-2203.783] (-2219.990) (-2213.313) (-2210.113) * (-2207.384) (-2214.554) [-2208.688] (-2210.492) -- 0:03:11
327000 -- (-2207.664) [-2210.047] (-2213.474) (-2209.138) * (-2216.061) (-2207.343) (-2211.944) [-2219.850] -- 0:03:13
327500 -- [-2205.906] (-2211.635) (-2212.953) (-2211.455) * (-2218.153) (-2216.140) [-2215.381] (-2219.841) -- 0:03:13
328000 -- (-2215.180) (-2207.932) (-2214.257) [-2216.715] * (-2219.409) (-2208.849) [-2207.717] (-2218.230) -- 0:03:12
328500 -- (-2216.161) (-2208.150) (-2216.715) [-2211.021] * (-2218.271) (-2226.920) (-2209.362) [-2212.440] -- 0:03:12
329000 -- (-2209.318) (-2213.290) [-2211.551] (-2234.412) * (-2207.139) (-2228.515) (-2209.150) [-2207.443] -- 0:03:11
329500 -- (-2205.345) (-2214.611) (-2220.681) [-2213.652] * (-2216.250) (-2218.598) (-2212.239) [-2211.025] -- 0:03:11
330000 -- [-2207.187] (-2209.211) (-2215.723) (-2217.082) * (-2218.436) (-2215.219) [-2205.398] (-2215.004) -- 0:03:10
Average standard deviation of split frequencies: 0.009212
330500 -- (-2206.396) (-2206.734) (-2222.037) [-2206.563] * (-2217.365) (-2228.560) (-2208.678) [-2207.549] -- 0:03:10
331000 -- (-2208.995) [-2202.456] (-2208.604) (-2227.143) * (-2211.317) [-2215.154] (-2216.028) (-2213.717) -- 0:03:12
331500 -- [-2211.129] (-2211.852) (-2218.411) (-2211.370) * (-2220.257) (-2207.842) [-2216.576] (-2218.209) -- 0:03:11
332000 -- (-2220.743) [-2217.348] (-2211.990) (-2215.713) * [-2209.920] (-2229.902) (-2225.209) (-2218.257) -- 0:03:11
332500 -- [-2207.746] (-2211.372) (-2220.836) (-2219.863) * (-2223.448) [-2209.826] (-2207.713) (-2216.039) -- 0:03:10
333000 -- (-2214.248) (-2206.861) [-2218.879] (-2228.490) * (-2217.189) (-2210.403) (-2222.648) [-2201.422] -- 0:03:10
333500 -- (-2218.658) [-2217.262] (-2220.880) (-2230.837) * (-2223.771) [-2213.769] (-2215.399) (-2217.394) -- 0:03:09
334000 -- (-2218.127) (-2213.818) [-2210.587] (-2221.072) * (-2218.876) [-2215.312] (-2229.352) (-2210.427) -- 0:03:09
334500 -- (-2216.031) (-2222.121) [-2208.548] (-2218.895) * [-2209.413] (-2217.408) (-2214.525) (-2211.436) -- 0:03:09
335000 -- [-2216.330] (-2219.640) (-2217.435) (-2216.674) * (-2217.881) [-2210.321] (-2212.112) (-2215.325) -- 0:03:10
Average standard deviation of split frequencies: 0.008850
335500 -- (-2210.027) (-2207.290) (-2220.731) [-2214.303] * (-2210.596) [-2206.422] (-2205.489) (-2215.260) -- 0:03:10
336000 -- (-2222.444) [-2206.572] (-2225.538) (-2210.404) * (-2210.472) [-2211.313] (-2213.345) (-2212.337) -- 0:03:09
336500 -- (-2214.546) (-2213.385) (-2217.965) [-2208.655] * (-2213.411) (-2208.967) (-2202.644) [-2210.314] -- 0:03:09
337000 -- [-2208.390] (-2213.596) (-2216.616) (-2206.101) * (-2210.331) (-2212.158) [-2207.083] (-2211.010) -- 0:03:08
337500 -- (-2220.762) (-2214.210) (-2209.271) [-2202.457] * [-2213.801] (-2227.373) (-2220.201) (-2208.445) -- 0:03:08
338000 -- (-2241.794) [-2210.595] (-2211.034) (-2213.204) * [-2207.625] (-2218.599) (-2218.810) (-2209.794) -- 0:03:08
338500 -- [-2227.813] (-2217.465) (-2220.631) (-2210.343) * (-2217.142) [-2200.185] (-2217.826) (-2209.655) -- 0:03:07
339000 -- (-2229.358) (-2220.394) (-2212.367) [-2210.728] * (-2216.775) [-2206.862] (-2214.907) (-2218.541) -- 0:03:09
339500 -- (-2204.427) [-2212.601] (-2213.249) (-2218.651) * [-2209.693] (-2213.206) (-2213.138) (-2208.733) -- 0:03:08
340000 -- [-2214.258] (-2216.227) (-2219.246) (-2213.186) * (-2209.793) (-2210.392) [-2205.067] (-2213.217) -- 0:03:08
Average standard deviation of split frequencies: 0.008941
340500 -- (-2218.983) (-2215.923) (-2224.730) [-2214.024] * (-2218.889) (-2224.293) (-2217.219) [-2214.431] -- 0:03:07
341000 -- (-2210.571) [-2205.345] (-2218.708) (-2217.215) * (-2216.088) [-2211.383] (-2222.463) (-2209.667) -- 0:03:07
341500 -- (-2214.309) [-2207.577] (-2217.567) (-2212.890) * [-2213.119] (-2218.048) (-2206.640) (-2219.843) -- 0:03:07
342000 -- (-2219.238) (-2221.885) (-2222.031) [-2207.691] * [-2217.458] (-2210.362) (-2220.462) (-2229.011) -- 0:03:06
342500 -- (-2216.749) (-2217.593) (-2214.169) [-2207.864] * (-2211.092) [-2205.793] (-2215.248) (-2223.805) -- 0:03:06
343000 -- (-2220.362) [-2205.925] (-2224.308) (-2213.716) * (-2207.687) (-2211.068) [-2215.339] (-2216.514) -- 0:03:07
343500 -- (-2213.364) (-2213.126) (-2216.230) [-2214.190] * (-2214.352) [-2217.532] (-2212.545) (-2224.546) -- 0:03:07
344000 -- (-2213.927) (-2216.067) (-2211.501) [-2210.098] * (-2214.740) (-2215.080) (-2215.175) [-2209.714] -- 0:03:06
344500 -- (-2218.631) (-2212.673) (-2215.993) [-2208.817] * [-2209.597] (-2212.757) (-2223.148) (-2222.290) -- 0:03:06
345000 -- (-2219.701) (-2217.265) [-2211.125] (-2216.985) * (-2213.715) [-2205.981] (-2216.254) (-2206.950) -- 0:03:06
Average standard deviation of split frequencies: 0.009327
345500 -- [-2214.893] (-2214.733) (-2210.888) (-2215.666) * [-2205.966] (-2216.380) (-2226.672) (-2217.383) -- 0:03:05
346000 -- (-2223.541) (-2212.586) (-2216.017) [-2205.581] * (-2216.457) (-2217.425) (-2215.089) [-2207.715] -- 0:03:05
346500 -- (-2207.615) (-2209.270) [-2211.232] (-2209.556) * (-2224.125) (-2205.800) (-2223.284) [-2216.370] -- 0:03:04
347000 -- (-2220.453) (-2215.755) (-2221.800) [-2208.359] * (-2212.076) [-2205.953] (-2217.324) (-2217.108) -- 0:03:06
347500 -- (-2211.121) (-2211.694) [-2206.048] (-2213.956) * [-2218.737] (-2213.984) (-2218.915) (-2212.595) -- 0:03:05
348000 -- (-2215.393) (-2216.106) (-2209.252) [-2213.048] * (-2225.106) (-2223.323) (-2210.171) [-2214.800] -- 0:03:05
348500 -- (-2215.507) [-2213.278] (-2215.871) (-2227.504) * (-2218.769) (-2215.101) (-2221.715) [-2211.181] -- 0:03:05
349000 -- (-2216.766) (-2212.869) [-2210.260] (-2210.539) * (-2227.627) [-2215.471] (-2218.054) (-2212.513) -- 0:03:04
349500 -- (-2219.227) (-2220.965) [-2211.162] (-2219.869) * (-2218.199) (-2219.459) [-2208.439] (-2222.725) -- 0:03:04
350000 -- (-2215.809) (-2215.599) [-2212.589] (-2209.929) * (-2228.717) (-2220.897) (-2212.946) [-2210.713] -- 0:03:03
Average standard deviation of split frequencies: 0.009307
350500 -- (-2213.991) (-2218.090) [-2214.550] (-2211.337) * (-2214.566) [-2224.249] (-2222.765) (-2214.768) -- 0:03:05
351000 -- [-2242.039] (-2216.893) (-2209.199) (-2219.278) * [-2219.615] (-2208.206) (-2212.458) (-2215.998) -- 0:03:04
351500 -- (-2234.464) (-2211.862) [-2214.471] (-2208.076) * (-2211.505) (-2215.496) [-2213.251] (-2216.566) -- 0:03:04
352000 -- (-2229.888) (-2214.473) [-2208.976] (-2211.272) * (-2226.169) (-2211.463) (-2224.189) [-2206.995] -- 0:03:04
352500 -- (-2213.335) (-2212.736) (-2209.180) [-2209.047] * (-2223.376) [-2203.609] (-2212.028) (-2222.392) -- 0:03:03
353000 -- (-2223.359) (-2217.011) (-2214.050) [-2204.436] * (-2205.156) [-2206.758] (-2218.957) (-2218.430) -- 0:03:03
353500 -- (-2218.775) [-2206.967] (-2223.222) (-2206.129) * [-2212.244] (-2212.975) (-2211.859) (-2227.357) -- 0:03:02
354000 -- [-2223.867] (-2210.231) (-2221.382) (-2209.046) * (-2216.808) (-2214.970) [-2206.584] (-2219.092) -- 0:03:02
354500 -- (-2216.490) [-2214.896] (-2217.204) (-2213.247) * [-2216.164] (-2218.908) (-2211.217) (-2224.521) -- 0:03:02
355000 -- [-2207.874] (-2222.938) (-2209.918) (-2219.749) * (-2218.691) [-2220.819] (-2207.725) (-2220.310) -- 0:03:03
Average standard deviation of split frequencies: 0.009167
355500 -- (-2214.885) [-2204.015] (-2214.418) (-2219.772) * (-2213.005) (-2219.019) [-2213.314] (-2215.424) -- 0:03:03
356000 -- (-2211.979) (-2203.450) [-2210.258] (-2218.771) * [-2212.793] (-2221.674) (-2219.020) (-2212.018) -- 0:03:02
356500 -- (-2220.773) [-2208.251] (-2207.325) (-2234.438) * (-2209.035) (-2214.984) (-2212.272) [-2209.437] -- 0:03:02
357000 -- (-2206.801) [-2215.653] (-2211.054) (-2222.448) * (-2214.087) (-2207.389) (-2215.586) [-2207.529] -- 0:03:01
357500 -- (-2216.843) (-2224.186) [-2215.793] (-2218.991) * (-2228.478) (-2205.072) [-2209.170] (-2211.137) -- 0:03:01
358000 -- (-2221.617) (-2214.847) [-2214.270] (-2220.754) * (-2212.291) [-2219.685] (-2230.200) (-2219.473) -- 0:03:01
358500 -- (-2218.462) (-2214.793) [-2205.466] (-2216.160) * (-2230.560) (-2213.773) [-2212.862] (-2212.921) -- 0:03:00
359000 -- (-2224.851) [-2218.611] (-2205.876) (-2211.580) * (-2224.262) [-2207.716] (-2210.142) (-2205.531) -- 0:03:02
359500 -- (-2218.808) (-2217.009) [-2220.701] (-2218.913) * [-2210.108] (-2214.685) (-2218.196) (-2227.659) -- 0:03:01
360000 -- (-2218.709) (-2215.457) (-2214.405) [-2204.968] * (-2212.648) (-2223.624) (-2218.079) [-2215.623] -- 0:03:01
Average standard deviation of split frequencies: 0.009049
360500 -- (-2229.350) (-2223.683) (-2209.912) [-2211.702] * (-2209.610) (-2214.886) (-2215.903) [-2216.230] -- 0:03:00
361000 -- (-2223.074) (-2207.796) [-2216.738] (-2208.693) * (-2209.367) (-2208.179) (-2223.313) [-2212.574] -- 0:03:00
361500 -- (-2212.157) (-2210.762) [-2214.764] (-2209.585) * (-2211.121) [-2201.736] (-2218.337) (-2213.495) -- 0:03:00
362000 -- [-2213.072] (-2229.805) (-2214.688) (-2222.294) * (-2224.500) (-2211.920) (-2213.008) [-2218.610] -- 0:02:59
362500 -- (-2224.007) (-2218.745) (-2212.575) [-2215.403] * (-2215.407) [-2214.453] (-2211.730) (-2212.959) -- 0:02:59
363000 -- (-2214.270) (-2226.747) (-2220.492) [-2207.574] * (-2209.403) (-2215.460) [-2213.292] (-2204.922) -- 0:03:00
363500 -- (-2219.478) (-2213.680) (-2211.585) [-2213.706] * [-2211.107] (-2215.071) (-2211.076) (-2214.059) -- 0:03:00
364000 -- (-2220.227) (-2215.445) (-2219.886) [-2214.049] * (-2211.500) (-2215.583) [-2211.753] (-2209.262) -- 0:02:59
364500 -- (-2215.273) (-2207.357) (-2219.758) [-2212.328] * (-2210.784) [-2217.960] (-2217.982) (-2215.399) -- 0:02:59
365000 -- (-2221.820) (-2215.030) (-2215.298) [-2208.395] * [-2215.747] (-2218.058) (-2214.655) (-2214.809) -- 0:02:59
Average standard deviation of split frequencies: 0.008521
365500 -- [-2205.928] (-2224.785) (-2224.777) (-2217.450) * (-2214.773) [-2207.480] (-2213.162) (-2212.064) -- 0:02:58
366000 -- (-2213.373) (-2212.938) (-2222.070) [-2221.123] * (-2219.905) [-2218.682] (-2212.121) (-2217.919) -- 0:02:58
366500 -- (-2212.942) [-2213.288] (-2209.165) (-2215.644) * (-2220.195) [-2210.455] (-2212.222) (-2215.439) -- 0:02:58
367000 -- (-2215.974) (-2218.371) (-2216.982) [-2211.834] * (-2216.666) (-2216.474) [-2214.363] (-2210.555) -- 0:02:59
367500 -- (-2212.395) [-2210.863] (-2215.522) (-2208.615) * [-2215.219] (-2213.420) (-2212.130) (-2220.322) -- 0:02:58
368000 -- [-2204.006] (-2210.841) (-2209.935) (-2211.934) * [-2215.398] (-2217.466) (-2222.343) (-2212.856) -- 0:02:58
368500 -- (-2210.257) (-2223.975) (-2220.561) [-2208.379] * (-2211.882) (-2219.750) (-2226.183) [-2215.327] -- 0:02:58
369000 -- [-2210.812] (-2225.889) (-2216.612) (-2219.086) * [-2203.191] (-2207.263) (-2218.079) (-2211.766) -- 0:02:57
369500 -- (-2212.987) [-2207.315] (-2221.187) (-2216.054) * (-2220.527) (-2221.670) (-2219.215) [-2209.841] -- 0:02:57
370000 -- [-2207.115] (-2206.193) (-2213.869) (-2214.559) * (-2216.600) [-2207.623] (-2208.299) (-2223.792) -- 0:02:57
Average standard deviation of split frequencies: 0.009196
370500 -- (-2210.859) [-2206.413] (-2208.742) (-2218.281) * (-2224.897) [-2204.764] (-2210.116) (-2214.770) -- 0:02:56
371000 -- (-2214.363) (-2218.285) [-2205.290] (-2217.901) * (-2219.214) (-2210.571) [-2216.860] (-2225.846) -- 0:02:58
371500 -- (-2235.463) (-2221.315) [-2209.602] (-2210.269) * [-2216.648] (-2209.920) (-2221.816) (-2210.486) -- 0:02:57
372000 -- (-2228.369) (-2207.985) (-2215.265) [-2213.982] * (-2241.392) (-2212.761) (-2217.259) [-2216.697] -- 0:02:57
372500 -- (-2219.064) [-2205.675] (-2209.179) (-2211.212) * [-2212.700] (-2212.683) (-2219.947) (-2215.809) -- 0:02:56
373000 -- [-2213.449] (-2213.690) (-2223.651) (-2215.393) * (-2221.153) (-2210.188) [-2211.440] (-2216.044) -- 0:02:56
373500 -- (-2227.242) (-2218.244) [-2219.173] (-2217.916) * (-2217.787) (-2205.475) [-2211.281] (-2212.518) -- 0:02:56
374000 -- (-2214.844) [-2214.516] (-2217.822) (-2217.117) * [-2213.239] (-2209.340) (-2218.092) (-2226.677) -- 0:02:55
374500 -- (-2219.027) [-2213.467] (-2220.621) (-2215.387) * (-2223.668) (-2215.237) (-2208.463) [-2208.521] -- 0:02:55
375000 -- (-2208.296) [-2213.417] (-2210.221) (-2219.725) * (-2220.785) (-2211.186) [-2205.330] (-2222.421) -- 0:02:56
Average standard deviation of split frequencies: 0.010319
375500 -- (-2210.072) (-2216.109) [-2206.694] (-2207.878) * (-2231.838) (-2218.765) (-2207.914) [-2214.585] -- 0:02:56
376000 -- (-2220.791) [-2209.316] (-2205.719) (-2218.160) * [-2211.018] (-2225.400) (-2208.728) (-2232.516) -- 0:02:55
376500 -- [-2216.341] (-2219.746) (-2214.278) (-2216.950) * (-2224.211) (-2237.365) [-2217.491] (-2216.714) -- 0:02:55
377000 -- (-2220.443) [-2212.334] (-2207.237) (-2226.656) * [-2213.288] (-2224.128) (-2210.160) (-2211.199) -- 0:02:55
377500 -- (-2215.958) (-2213.963) (-2223.981) [-2217.415] * (-2219.241) (-2217.454) (-2214.775) [-2203.246] -- 0:02:54
378000 -- (-2210.190) (-2218.415) (-2222.852) [-2214.825] * (-2218.821) (-2207.149) (-2223.984) [-2210.965] -- 0:02:54
378500 -- (-2217.215) [-2208.082] (-2217.302) (-2219.750) * (-2213.646) (-2207.789) (-2211.415) [-2207.865] -- 0:02:54
379000 -- (-2210.915) (-2224.166) (-2214.127) [-2209.967] * (-2222.349) [-2204.752] (-2220.643) (-2214.612) -- 0:02:55
379500 -- (-2211.024) (-2214.233) (-2209.542) [-2208.575] * (-2226.806) (-2212.540) [-2210.256] (-2212.449) -- 0:02:54
380000 -- (-2216.097) (-2209.509) (-2221.243) [-2211.110] * [-2208.980] (-2216.045) (-2203.192) (-2206.309) -- 0:02:54
Average standard deviation of split frequencies: 0.010383
380500 -- [-2209.457] (-2217.707) (-2209.682) (-2219.128) * (-2219.050) (-2216.842) (-2216.302) [-2213.144] -- 0:02:54
381000 -- (-2208.038) (-2219.568) [-2203.227] (-2231.481) * (-2218.755) (-2212.044) [-2216.855] (-2209.386) -- 0:02:53
381500 -- [-2201.602] (-2207.560) (-2207.481) (-2217.780) * (-2214.261) (-2215.892) (-2213.309) [-2205.537] -- 0:02:53
382000 -- (-2213.563) (-2217.331) (-2212.801) [-2216.424] * (-2231.780) (-2213.688) (-2213.388) [-2206.630] -- 0:02:53
382500 -- (-2223.345) (-2209.809) (-2217.367) [-2214.048] * (-2216.930) [-2208.858] (-2216.770) (-2222.318) -- 0:02:52
383000 -- (-2226.392) [-2216.994] (-2207.362) (-2209.859) * [-2211.069] (-2212.674) (-2220.306) (-2203.868) -- 0:02:53
383500 -- [-2202.198] (-2214.107) (-2213.873) (-2206.841) * [-2213.561] (-2204.971) (-2226.822) (-2214.339) -- 0:02:53
384000 -- (-2208.819) (-2209.334) (-2206.334) [-2204.632] * [-2211.126] (-2209.474) (-2230.254) (-2217.778) -- 0:02:53
384500 -- (-2219.637) [-2206.070] (-2211.940) (-2216.136) * (-2219.355) (-2214.234) (-2224.051) [-2208.529] -- 0:02:52
385000 -- [-2212.014] (-2209.923) (-2213.045) (-2212.029) * (-2222.661) [-2214.310] (-2216.858) (-2205.274) -- 0:02:52
Average standard deviation of split frequencies: 0.009676
385500 -- (-2221.271) (-2204.553) [-2211.376] (-2215.802) * [-2214.653] (-2211.393) (-2202.945) (-2213.326) -- 0:02:52
386000 -- (-2216.861) (-2219.353) [-2209.533] (-2209.529) * (-2228.358) (-2214.998) [-2212.028] (-2206.581) -- 0:02:51
386500 -- (-2210.935) (-2219.344) (-2211.233) [-2207.208] * (-2221.656) (-2214.702) [-2206.313] (-2223.022) -- 0:02:51
387000 -- [-2211.815] (-2216.644) (-2214.719) (-2218.459) * (-2235.459) (-2216.378) [-2213.670] (-2210.417) -- 0:02:51
387500 -- (-2227.052) (-2208.249) (-2212.987) [-2219.478] * (-2224.281) [-2212.699] (-2214.865) (-2215.526) -- 0:02:52
388000 -- [-2207.743] (-2212.030) (-2231.040) (-2209.375) * (-2213.749) (-2222.571) (-2207.347) [-2216.826] -- 0:02:51
388500 -- (-2219.800) [-2212.848] (-2223.294) (-2219.953) * [-2222.336] (-2207.229) (-2209.843) (-2221.629) -- 0:02:51
389000 -- (-2210.580) (-2217.723) (-2210.284) [-2218.146] * (-2218.983) [-2209.294] (-2216.351) (-2214.751) -- 0:02:51
389500 -- [-2213.625] (-2205.170) (-2213.673) (-2204.531) * (-2212.789) (-2203.293) [-2211.434] (-2213.036) -- 0:02:50
390000 -- [-2210.619] (-2209.298) (-2211.494) (-2222.005) * (-2222.525) (-2205.932) [-2211.698] (-2214.404) -- 0:02:50
Average standard deviation of split frequencies: 0.010303
390500 -- [-2208.710] (-2215.210) (-2212.046) (-2219.847) * (-2226.595) [-2204.928] (-2214.586) (-2218.773) -- 0:02:50
391000 -- (-2217.598) [-2206.869] (-2217.453) (-2209.639) * [-2220.469] (-2215.322) (-2210.382) (-2222.367) -- 0:02:49
391500 -- [-2209.707] (-2210.800) (-2211.067) (-2215.174) * (-2220.300) (-2213.241) [-2220.840] (-2212.545) -- 0:02:50
392000 -- (-2208.886) [-2203.317] (-2217.069) (-2208.592) * (-2217.435) [-2212.655] (-2214.932) (-2219.417) -- 0:02:50
392500 -- [-2212.910] (-2227.737) (-2218.218) (-2210.720) * (-2215.817) (-2209.441) [-2216.702] (-2209.245) -- 0:02:50
393000 -- (-2227.636) [-2210.601] (-2223.874) (-2211.039) * (-2212.337) (-2210.914) [-2208.157] (-2228.220) -- 0:02:49
393500 -- [-2207.782] (-2212.562) (-2211.975) (-2214.485) * (-2215.965) (-2217.129) [-2204.014] (-2212.347) -- 0:02:49
394000 -- (-2217.889) [-2218.960] (-2214.061) (-2218.525) * (-2226.100) (-2220.529) [-2211.199] (-2209.801) -- 0:02:49
394500 -- [-2215.712] (-2211.501) (-2230.801) (-2199.664) * (-2221.221) (-2211.963) (-2209.111) [-2209.527] -- 0:02:48
395000 -- [-2214.079] (-2218.450) (-2214.831) (-2210.593) * (-2218.117) (-2208.936) (-2215.625) [-2209.125] -- 0:02:48
Average standard deviation of split frequencies: 0.009706
395500 -- (-2214.305) (-2210.084) [-2209.460] (-2219.846) * [-2215.055] (-2225.795) (-2219.168) (-2216.645) -- 0:02:49
396000 -- (-2229.872) (-2207.406) [-2206.731] (-2223.771) * (-2209.043) (-2210.849) (-2220.377) [-2210.441] -- 0:02:49
396500 -- [-2214.018] (-2211.730) (-2210.043) (-2217.410) * [-2208.952] (-2205.888) (-2215.742) (-2232.878) -- 0:02:48
397000 -- (-2215.685) (-2217.793) [-2213.779] (-2233.340) * (-2213.400) (-2220.341) (-2222.746) [-2210.025] -- 0:02:48
397500 -- (-2211.295) (-2213.116) (-2201.728) [-2211.572] * (-2212.250) (-2214.703) (-2214.764) [-2205.724] -- 0:02:48
398000 -- (-2216.768) [-2219.883] (-2213.200) (-2212.235) * [-2218.106] (-2203.598) (-2216.513) (-2214.039) -- 0:02:47
398500 -- (-2221.034) [-2213.582] (-2220.275) (-2216.035) * [-2210.456] (-2212.012) (-2213.661) (-2214.104) -- 0:02:47
399000 -- [-2204.079] (-2217.848) (-2213.084) (-2214.185) * (-2224.833) (-2223.768) (-2213.074) [-2216.878] -- 0:02:47
399500 -- (-2211.859) (-2218.595) [-2205.741] (-2214.472) * (-2218.177) (-2215.608) (-2210.800) [-2209.918] -- 0:02:48
400000 -- (-2211.473) (-2223.276) [-2204.114] (-2216.049) * (-2217.100) [-2207.877] (-2217.179) (-2206.974) -- 0:02:47
Average standard deviation of split frequencies: 0.010498
400500 -- (-2206.798) (-2224.323) [-2208.808] (-2218.952) * (-2230.091) (-2212.160) (-2219.247) [-2201.667] -- 0:02:47
401000 -- (-2211.617) (-2220.124) [-2215.959] (-2222.063) * [-2206.001] (-2214.792) (-2211.736) (-2213.441) -- 0:02:47
401500 -- [-2213.696] (-2212.369) (-2213.518) (-2222.341) * [-2204.499] (-2212.496) (-2210.153) (-2221.104) -- 0:02:46
402000 -- (-2219.997) (-2213.294) [-2214.200] (-2222.533) * (-2207.646) (-2210.685) [-2208.374] (-2226.223) -- 0:02:46
402500 -- (-2221.910) (-2214.686) (-2210.413) [-2213.320] * (-2212.585) (-2212.798) [-2217.050] (-2216.295) -- 0:02:46
403000 -- [-2221.150] (-2221.190) (-2211.722) (-2221.009) * (-2221.513) [-2206.856] (-2212.503) (-2213.781) -- 0:02:45
403500 -- (-2206.436) (-2214.330) [-2209.069] (-2211.735) * (-2230.592) [-2206.150] (-2210.534) (-2213.759) -- 0:02:47
404000 -- (-2217.644) [-2209.027] (-2220.331) (-2214.439) * [-2217.880] (-2224.367) (-2209.775) (-2211.116) -- 0:02:46
404500 -- (-2210.987) (-2216.191) [-2210.783] (-2203.052) * (-2221.453) [-2206.189] (-2213.834) (-2207.601) -- 0:02:46
405000 -- (-2216.883) (-2204.016) [-2208.791] (-2204.581) * (-2224.499) (-2207.988) (-2212.371) [-2214.290] -- 0:02:46
Average standard deviation of split frequencies: 0.011611
405500 -- (-2221.864) (-2212.216) [-2208.988] (-2215.839) * (-2233.573) (-2207.523) (-2222.426) [-2210.309] -- 0:02:45
406000 -- (-2216.855) (-2220.588) (-2214.652) [-2210.836] * (-2233.421) (-2211.024) (-2212.813) [-2217.639] -- 0:02:45
406500 -- [-2215.400] (-2225.880) (-2217.655) (-2212.838) * (-2231.073) [-2211.804] (-2224.358) (-2225.768) -- 0:02:44
407000 -- (-2211.809) (-2212.775) (-2210.749) [-2213.860] * (-2220.837) [-2209.751] (-2209.360) (-2217.371) -- 0:02:44
407500 -- (-2211.910) [-2210.325] (-2213.232) (-2213.141) * (-2227.323) (-2222.476) [-2214.211] (-2208.453) -- 0:02:45
408000 -- (-2207.651) (-2210.189) [-2217.926] (-2214.995) * (-2218.120) [-2214.653] (-2213.558) (-2220.225) -- 0:02:45
408500 -- (-2217.440) (-2220.344) (-2213.028) [-2215.338] * (-2219.082) [-2207.476] (-2210.005) (-2218.499) -- 0:02:45
409000 -- (-2231.108) (-2217.188) [-2211.900] (-2211.614) * (-2218.671) (-2220.077) [-2208.112] (-2223.506) -- 0:02:44
409500 -- (-2223.780) [-2210.849] (-2216.269) (-2220.712) * (-2215.888) [-2208.508] (-2216.005) (-2229.859) -- 0:02:44
410000 -- (-2222.276) (-2218.671) [-2216.854] (-2219.118) * (-2221.710) (-2211.695) (-2214.707) [-2207.159] -- 0:02:44
Average standard deviation of split frequencies: 0.011832
410500 -- [-2214.629] (-2215.797) (-2213.125) (-2210.962) * (-2212.501) (-2231.111) (-2216.689) [-2202.660] -- 0:02:43
411000 -- (-2213.478) [-2210.558] (-2219.538) (-2216.735) * (-2211.987) (-2219.914) [-2214.049] (-2207.349) -- 0:02:43
411500 -- (-2222.450) (-2218.386) (-2219.541) [-2209.960] * (-2218.338) (-2213.607) (-2216.739) [-2209.134] -- 0:02:44
412000 -- (-2217.098) (-2217.663) (-2219.311) [-2207.571] * (-2217.502) (-2217.133) (-2215.641) [-2213.946] -- 0:02:44
412500 -- [-2212.447] (-2214.708) (-2224.409) (-2234.540) * (-2209.253) [-2205.559] (-2216.516) (-2213.124) -- 0:02:43
413000 -- [-2212.119] (-2217.434) (-2208.392) (-2213.977) * (-2219.428) [-2201.966] (-2221.276) (-2211.438) -- 0:02:43
413500 -- [-2212.164] (-2212.708) (-2207.380) (-2209.692) * [-2219.228] (-2210.449) (-2221.116) (-2212.494) -- 0:02:43
414000 -- (-2219.103) [-2211.235] (-2215.226) (-2206.186) * (-2217.503) (-2207.359) [-2215.315] (-2219.021) -- 0:02:42
414500 -- (-2212.532) [-2210.646] (-2212.222) (-2211.861) * (-2223.330) (-2215.687) (-2209.913) [-2213.895] -- 0:02:42
415000 -- [-2209.913] (-2206.425) (-2216.331) (-2227.035) * (-2210.944) (-2210.558) (-2210.426) [-2205.736] -- 0:02:42
Average standard deviation of split frequencies: 0.011158
415500 -- (-2215.785) (-2210.946) (-2211.825) [-2208.440] * (-2214.312) (-2210.057) (-2221.803) [-2210.185] -- 0:02:43
416000 -- (-2206.354) (-2209.060) (-2224.927) [-2215.045] * (-2220.228) [-2219.208] (-2227.874) (-2214.104) -- 0:02:42
416500 -- (-2211.804) [-2202.525] (-2212.955) (-2222.071) * (-2214.238) (-2211.617) [-2221.033] (-2221.334) -- 0:02:42
417000 -- [-2220.779] (-2210.593) (-2207.780) (-2212.259) * [-2211.828] (-2212.079) (-2225.982) (-2216.902) -- 0:02:42
417500 -- (-2209.917) [-2220.402] (-2204.130) (-2209.482) * [-2211.137] (-2208.284) (-2222.582) (-2221.953) -- 0:02:41
418000 -- (-2208.656) (-2225.936) (-2211.280) [-2206.359] * [-2204.290] (-2212.607) (-2214.796) (-2216.524) -- 0:02:41
418500 -- (-2218.994) (-2215.980) [-2204.593] (-2228.129) * (-2220.887) (-2210.820) (-2210.870) [-2214.226] -- 0:02:41
419000 -- (-2215.832) (-2218.350) [-2210.887] (-2205.338) * (-2214.798) (-2214.821) (-2213.430) [-2207.746] -- 0:02:40
419500 -- (-2208.443) (-2213.403) [-2215.255] (-2214.600) * (-2212.353) [-2215.402] (-2221.921) (-2228.286) -- 0:02:41
420000 -- (-2219.206) [-2207.557] (-2210.195) (-2215.328) * [-2211.259] (-2216.083) (-2223.908) (-2224.857) -- 0:02:41
Average standard deviation of split frequencies: 0.011034
420500 -- (-2221.196) (-2215.524) [-2211.000] (-2219.748) * (-2211.593) (-2223.064) [-2210.737] (-2208.283) -- 0:02:41
421000 -- (-2203.251) (-2215.492) [-2205.514] (-2213.287) * (-2215.579) [-2208.284] (-2218.184) (-2210.089) -- 0:02:40
421500 -- (-2214.018) [-2205.008] (-2215.370) (-2222.389) * [-2205.233] (-2201.383) (-2222.554) (-2220.510) -- 0:02:40
422000 -- [-2206.704] (-2215.393) (-2217.401) (-2219.159) * (-2221.640) [-2213.183] (-2217.585) (-2217.790) -- 0:02:40
422500 -- (-2210.167) (-2223.040) (-2221.463) [-2208.288] * (-2221.589) (-2221.298) [-2218.705] (-2219.318) -- 0:02:39
423000 -- (-2220.271) (-2210.644) [-2218.682] (-2211.031) * (-2215.679) (-2221.466) [-2212.396] (-2216.566) -- 0:02:39
423500 -- (-2219.063) [-2204.682] (-2219.933) (-2222.156) * [-2210.861] (-2216.492) (-2216.730) (-2221.748) -- 0:02:40
424000 -- [-2204.049] (-2205.460) (-2207.388) (-2212.019) * (-2211.564) (-2216.065) (-2208.479) [-2219.080] -- 0:02:40
424500 -- (-2207.258) (-2210.868) (-2222.258) [-2208.975] * (-2223.723) (-2209.537) [-2207.666] (-2221.783) -- 0:02:39
425000 -- [-2215.171] (-2204.452) (-2216.243) (-2211.869) * (-2208.090) (-2227.768) [-2209.906] (-2222.614) -- 0:02:39
Average standard deviation of split frequencies: 0.010640
425500 -- [-2211.106] (-2210.243) (-2218.427) (-2220.248) * (-2221.589) (-2212.130) [-2214.934] (-2224.448) -- 0:02:39
426000 -- (-2217.861) (-2215.763) (-2211.553) [-2213.764] * (-2223.848) [-2213.021] (-2211.971) (-2222.238) -- 0:02:38
426500 -- (-2209.010) (-2207.026) (-2213.210) [-2203.507] * (-2218.115) (-2214.919) [-2210.986] (-2222.541) -- 0:02:38
427000 -- (-2217.166) (-2210.447) [-2208.925] (-2203.472) * (-2217.018) (-2215.409) [-2208.584] (-2212.460) -- 0:02:38
427500 -- (-2216.751) (-2211.954) (-2210.772) [-2212.398] * (-2210.677) (-2220.053) [-2207.722] (-2217.758) -- 0:02:39
428000 -- [-2215.877] (-2212.152) (-2214.224) (-2212.902) * (-2211.556) [-2207.845] (-2225.295) (-2217.982) -- 0:02:39
428500 -- (-2215.321) (-2213.755) [-2207.213] (-2223.945) * (-2213.205) (-2208.532) [-2221.590] (-2216.605) -- 0:02:38
429000 -- (-2218.650) (-2216.869) (-2204.939) [-2209.622] * (-2211.177) (-2210.491) (-2228.359) [-2218.663] -- 0:02:38
429500 -- [-2216.554] (-2211.513) (-2213.035) (-2228.131) * [-2207.694] (-2213.262) (-2216.297) (-2227.663) -- 0:02:38
430000 -- [-2210.206] (-2211.233) (-2215.077) (-2222.297) * (-2208.598) [-2210.849] (-2204.330) (-2221.554) -- 0:02:37
Average standard deviation of split frequencies: 0.011199
430500 -- (-2211.460) [-2210.308] (-2219.936) (-2223.137) * (-2213.108) (-2225.582) [-2211.837] (-2219.105) -- 0:02:37
431000 -- (-2219.759) (-2214.520) (-2208.134) [-2204.838] * [-2208.281] (-2221.664) (-2217.489) (-2215.827) -- 0:02:37
431500 -- (-2222.416) (-2225.367) (-2212.001) [-2214.294] * (-2218.657) (-2218.805) [-2208.219] (-2213.977) -- 0:02:38
432000 -- (-2211.867) (-2215.491) (-2209.645) [-2206.326] * (-2209.617) (-2214.793) [-2210.159] (-2215.423) -- 0:02:37
432500 -- [-2214.099] (-2211.761) (-2213.895) (-2215.831) * (-2210.593) (-2218.045) [-2213.453] (-2219.469) -- 0:02:37
433000 -- (-2222.501) [-2228.006] (-2213.008) (-2209.646) * (-2206.362) [-2214.468] (-2220.261) (-2214.282) -- 0:02:37
433500 -- (-2213.436) (-2224.871) [-2209.737] (-2211.775) * (-2211.953) (-2216.140) (-2209.165) [-2214.125] -- 0:02:36
434000 -- (-2227.552) (-2234.393) [-2215.554] (-2211.035) * (-2203.935) (-2215.241) [-2203.815] (-2216.319) -- 0:02:36
434500 -- (-2224.459) (-2222.461) (-2202.018) [-2211.738] * [-2218.178] (-2217.741) (-2210.259) (-2209.891) -- 0:02:36
435000 -- [-2218.513] (-2221.571) (-2215.216) (-2214.833) * (-2211.429) (-2226.110) (-2214.363) [-2215.343] -- 0:02:35
Average standard deviation of split frequencies: 0.011394
435500 -- (-2213.852) (-2213.194) [-2209.429] (-2216.338) * (-2222.688) (-2227.442) [-2211.841] (-2210.586) -- 0:02:36
436000 -- (-2218.155) (-2218.614) [-2208.253] (-2215.350) * (-2212.554) (-2223.704) [-2210.866] (-2212.050) -- 0:02:36
436500 -- (-2231.992) [-2210.314] (-2212.374) (-2229.784) * [-2213.297] (-2216.877) (-2210.440) (-2206.553) -- 0:02:36
437000 -- (-2208.880) [-2212.598] (-2218.207) (-2225.226) * (-2227.574) [-2210.130] (-2215.815) (-2217.951) -- 0:02:35
437500 -- (-2217.304) (-2212.749) [-2209.852] (-2212.274) * (-2221.119) (-2229.493) [-2208.148] (-2216.082) -- 0:02:35
438000 -- [-2219.152] (-2213.807) (-2218.485) (-2224.185) * (-2208.447) (-2212.100) [-2215.968] (-2206.621) -- 0:02:35
438500 -- (-2209.347) (-2213.658) (-2220.839) [-2216.182] * (-2216.913) [-2208.655] (-2213.890) (-2215.695) -- 0:02:34
439000 -- (-2222.536) [-2210.875] (-2203.297) (-2215.074) * (-2215.474) [-2215.545] (-2221.998) (-2212.008) -- 0:02:34
439500 -- (-2222.744) (-2221.289) [-2218.932] (-2213.289) * [-2212.614] (-2216.500) (-2212.013) (-2216.261) -- 0:02:35
440000 -- (-2220.716) (-2221.568) [-2208.431] (-2223.989) * (-2214.592) (-2206.161) [-2211.078] (-2217.249) -- 0:02:35
Average standard deviation of split frequencies: 0.011438
440500 -- (-2215.045) (-2215.929) (-2208.548) [-2213.301] * [-2212.290] (-2214.198) (-2223.934) (-2209.104) -- 0:02:34
441000 -- (-2213.820) (-2223.313) (-2213.316) [-2209.835] * (-2211.352) (-2219.531) (-2217.667) [-2209.591] -- 0:02:34
441500 -- (-2207.469) (-2225.521) [-2210.463] (-2221.055) * (-2222.607) (-2209.475) (-2204.491) [-2218.014] -- 0:02:34
442000 -- (-2213.038) [-2217.444] (-2213.846) (-2217.083) * (-2221.319) (-2214.537) (-2204.941) [-2209.500] -- 0:02:34
442500 -- (-2209.527) (-2213.036) [-2206.741] (-2216.873) * (-2222.278) (-2221.762) [-2210.870] (-2212.574) -- 0:02:33
443000 -- [-2206.961] (-2210.745) (-2211.593) (-2212.101) * [-2211.468] (-2217.253) (-2222.536) (-2211.662) -- 0:02:33
443500 -- (-2208.451) (-2213.144) [-2207.100] (-2213.628) * (-2214.833) (-2225.063) [-2218.990] (-2221.168) -- 0:02:34
444000 -- (-2220.508) (-2217.584) (-2211.478) [-2206.571] * [-2221.331] (-2230.213) (-2215.825) (-2219.846) -- 0:02:34
444500 -- (-2207.174) (-2206.043) [-2209.199] (-2219.837) * [-2212.929] (-2211.289) (-2214.783) (-2210.468) -- 0:02:33
445000 -- (-2212.625) [-2201.239] (-2208.009) (-2220.033) * (-2215.418) [-2212.057] (-2217.304) (-2211.847) -- 0:02:33
Average standard deviation of split frequencies: 0.012602
445500 -- (-2215.056) (-2214.693) [-2209.546] (-2211.425) * (-2214.473) (-2218.242) (-2219.453) [-2212.635] -- 0:02:33
446000 -- (-2213.635) [-2207.982] (-2222.301) (-2220.118) * [-2213.730] (-2231.958) (-2233.026) (-2224.672) -- 0:02:32
446500 -- [-2207.579] (-2208.411) (-2205.833) (-2229.658) * [-2207.617] (-2224.298) (-2212.181) (-2230.463) -- 0:02:32
447000 -- (-2204.395) [-2214.362] (-2210.142) (-2227.545) * [-2211.030] (-2229.277) (-2210.500) (-2214.985) -- 0:02:32
447500 -- (-2216.738) [-2214.250] (-2216.542) (-2218.893) * (-2211.877) [-2209.147] (-2224.784) (-2216.035) -- 0:02:33
448000 -- [-2212.065] (-2215.479) (-2208.537) (-2218.615) * [-2210.757] (-2203.431) (-2212.497) (-2212.450) -- 0:02:32
448500 -- (-2206.002) (-2217.417) (-2215.414) [-2220.858] * (-2214.468) [-2215.513] (-2212.477) (-2217.879) -- 0:02:32
449000 -- [-2215.291] (-2228.598) (-2214.437) (-2223.150) * (-2219.103) (-2219.644) [-2202.681] (-2209.881) -- 0:02:32
449500 -- (-2211.633) (-2225.338) [-2210.573] (-2242.872) * (-2216.064) (-2207.443) (-2219.694) [-2212.273] -- 0:02:31
450000 -- (-2206.575) (-2218.543) [-2211.511] (-2211.216) * [-2208.836] (-2212.614) (-2231.437) (-2220.051) -- 0:02:31
Average standard deviation of split frequencies: 0.013196
450500 -- (-2213.136) (-2208.802) (-2209.214) [-2212.130] * (-2216.819) (-2224.796) [-2209.986] (-2219.195) -- 0:02:31
451000 -- [-2215.691] (-2216.318) (-2208.029) (-2212.024) * [-2217.343] (-2208.677) (-2218.499) (-2231.667) -- 0:02:30
451500 -- [-2216.795] (-2214.342) (-2211.429) (-2217.295) * [-2205.325] (-2206.424) (-2215.244) (-2220.203) -- 0:02:31
452000 -- (-2206.140) [-2218.410] (-2217.314) (-2216.211) * (-2220.395) (-2213.496) (-2224.026) [-2211.884] -- 0:02:31
452500 -- [-2208.146] (-2204.642) (-2220.703) (-2236.649) * (-2214.319) (-2214.731) [-2206.845] (-2222.074) -- 0:02:31
453000 -- (-2229.053) (-2207.949) (-2215.380) [-2209.442] * (-2224.292) [-2204.992] (-2213.242) (-2211.578) -- 0:02:30
453500 -- (-2215.351) [-2207.155] (-2209.221) (-2214.441) * (-2210.198) [-2208.540] (-2219.151) (-2213.329) -- 0:02:30
454000 -- (-2210.262) (-2212.487) (-2215.117) [-2212.418] * [-2217.345] (-2220.843) (-2215.259) (-2205.581) -- 0:02:30
454500 -- (-2209.692) [-2211.078] (-2215.784) (-2214.091) * (-2217.200) [-2205.302] (-2223.365) (-2211.612) -- 0:02:30
455000 -- (-2216.314) [-2210.707] (-2219.085) (-2218.841) * (-2218.007) (-2211.468) (-2221.907) [-2213.942] -- 0:02:29
Average standard deviation of split frequencies: 0.013201
455500 -- (-2213.108) (-2215.053) [-2213.217] (-2219.694) * (-2211.739) [-2209.577] (-2213.195) (-2222.774) -- 0:02:30
456000 -- (-2211.838) (-2222.830) [-2205.719] (-2219.855) * (-2209.631) [-2210.446] (-2206.081) (-2204.431) -- 0:02:30
456500 -- (-2216.703) (-2208.082) [-2202.570] (-2219.036) * [-2209.796] (-2210.360) (-2202.833) (-2210.487) -- 0:02:30
457000 -- [-2211.794] (-2217.799) (-2221.298) (-2235.217) * [-2209.871] (-2211.196) (-2228.022) (-2207.962) -- 0:02:29
457500 -- (-2210.709) [-2212.075] (-2211.570) (-2220.085) * (-2217.290) (-2207.499) (-2224.865) [-2211.696] -- 0:02:29
458000 -- (-2208.323) (-2207.440) (-2209.881) [-2207.732] * (-2216.506) [-2210.020] (-2208.314) (-2207.553) -- 0:02:29
458500 -- [-2211.830] (-2209.515) (-2206.683) (-2210.997) * [-2218.401] (-2215.487) (-2220.021) (-2212.075) -- 0:02:28
459000 -- (-2216.339) (-2213.210) [-2211.028] (-2211.616) * (-2220.277) (-2208.190) (-2213.039) [-2214.449] -- 0:02:28
459500 -- (-2211.223) [-2217.936] (-2226.924) (-2210.658) * (-2218.713) (-2211.093) (-2211.425) [-2208.395] -- 0:02:29
460000 -- (-2218.586) (-2220.083) [-2211.987] (-2210.361) * (-2215.004) (-2211.891) [-2208.755] (-2206.096) -- 0:02:29
Average standard deviation of split frequencies: 0.012595
460500 -- (-2213.402) (-2222.951) [-2216.153] (-2212.720) * (-2226.860) [-2216.612] (-2213.159) (-2217.305) -- 0:02:28
461000 -- (-2215.041) (-2214.758) [-2207.248] (-2216.306) * (-2216.265) [-2211.122] (-2205.761) (-2216.182) -- 0:02:28
461500 -- [-2213.546] (-2216.811) (-2214.609) (-2226.276) * [-2210.019] (-2210.419) (-2213.738) (-2213.968) -- 0:02:28
462000 -- [-2210.466] (-2223.677) (-2208.738) (-2216.262) * [-2220.123] (-2211.328) (-2220.444) (-2219.068) -- 0:02:27
462500 -- (-2208.668) [-2218.214] (-2205.695) (-2227.233) * (-2215.099) (-2218.757) [-2208.807] (-2206.031) -- 0:02:27
463000 -- (-2215.440) (-2222.178) (-2214.915) [-2222.142] * (-2218.606) [-2210.449] (-2212.598) (-2210.590) -- 0:02:27
463500 -- (-2215.720) [-2217.072] (-2215.399) (-2215.740) * (-2223.172) [-2211.933] (-2221.597) (-2222.944) -- 0:02:28
464000 -- (-2219.437) [-2217.286] (-2207.992) (-2220.877) * [-2213.414] (-2212.542) (-2208.842) (-2225.125) -- 0:02:27
464500 -- (-2212.014) [-2206.514] (-2214.591) (-2225.681) * (-2211.255) (-2218.679) [-2210.107] (-2227.284) -- 0:02:27
465000 -- (-2236.593) [-2203.208] (-2216.475) (-2220.482) * (-2214.957) (-2223.860) (-2217.876) [-2215.666] -- 0:02:27
Average standard deviation of split frequencies: 0.012139
465500 -- (-2226.756) (-2208.904) (-2213.917) [-2211.666] * [-2212.547] (-2209.301) (-2211.317) (-2215.298) -- 0:02:26
466000 -- (-2211.743) [-2205.603] (-2228.599) (-2219.688) * (-2212.440) (-2213.934) [-2211.995] (-2212.606) -- 0:02:26
466500 -- (-2214.859) [-2209.922] (-2225.019) (-2213.415) * [-2210.507] (-2218.559) (-2215.016) (-2203.931) -- 0:02:26
467000 -- (-2222.092) [-2211.571] (-2214.381) (-2215.301) * (-2211.684) (-2211.617) [-2205.148] (-2210.853) -- 0:02:26
467500 -- [-2208.360] (-2206.488) (-2217.905) (-2241.396) * (-2220.503) [-2214.093] (-2221.337) (-2215.599) -- 0:02:26
468000 -- [-2199.786] (-2211.372) (-2215.645) (-2216.055) * (-2216.130) [-2216.429] (-2213.491) (-2221.017) -- 0:02:26
468500 -- (-2211.968) (-2212.796) (-2214.468) [-2217.779] * (-2211.330) (-2215.045) [-2209.343] (-2211.955) -- 0:02:26
469000 -- (-2215.628) [-2208.910] (-2212.690) (-2222.617) * (-2223.310) (-2212.920) [-2219.227] (-2223.420) -- 0:02:26
469500 -- [-2210.831] (-2214.075) (-2215.517) (-2215.847) * (-2214.353) [-2213.265] (-2219.847) (-2218.144) -- 0:02:25
470000 -- (-2217.016) (-2214.866) (-2211.339) [-2215.892] * (-2218.188) (-2208.480) [-2213.757] (-2222.112) -- 0:02:25
Average standard deviation of split frequencies: 0.012173
470500 -- (-2217.470) [-2210.415] (-2218.274) (-2210.979) * (-2212.854) [-2214.256] (-2212.667) (-2211.700) -- 0:02:25
471000 -- (-2227.251) [-2215.472] (-2216.112) (-2215.308) * [-2214.005] (-2204.846) (-2217.139) (-2226.554) -- 0:02:24
471500 -- (-2216.558) (-2213.259) [-2206.578] (-2212.195) * (-2210.189) [-2208.823] (-2226.326) (-2219.758) -- 0:02:24
472000 -- [-2210.895] (-2210.914) (-2220.727) (-2213.877) * (-2209.581) (-2212.550) (-2213.664) [-2208.884] -- 0:02:25
472500 -- [-2208.793] (-2222.435) (-2213.192) (-2219.375) * [-2202.377] (-2217.153) (-2209.723) (-2208.956) -- 0:02:25
473000 -- (-2224.733) (-2219.478) [-2215.490] (-2217.909) * (-2207.190) [-2210.599] (-2220.046) (-2217.556) -- 0:02:24
473500 -- (-2209.707) (-2231.439) (-2217.628) [-2209.239] * [-2212.787] (-2217.481) (-2228.370) (-2206.983) -- 0:02:24
474000 -- (-2213.083) (-2219.923) (-2215.348) [-2214.013] * (-2219.865) (-2220.717) (-2220.353) [-2215.625] -- 0:02:24
474500 -- (-2213.332) (-2218.441) [-2207.351] (-2210.513) * (-2209.450) [-2209.393] (-2218.913) (-2212.906) -- 0:02:23
475000 -- (-2215.407) [-2208.153] (-2202.474) (-2222.083) * [-2215.306] (-2219.625) (-2213.848) (-2208.977) -- 0:02:23
Average standard deviation of split frequencies: 0.012037
475500 -- [-2212.295] (-2202.738) (-2214.197) (-2211.955) * [-2215.399] (-2220.706) (-2206.272) (-2216.468) -- 0:02:23
476000 -- (-2209.943) (-2217.526) [-2215.359] (-2211.903) * (-2204.396) [-2211.809] (-2209.403) (-2224.479) -- 0:02:24
476500 -- (-2215.197) (-2215.527) [-2206.116] (-2213.593) * (-2219.111) (-2218.643) [-2205.504] (-2212.568) -- 0:02:23
477000 -- (-2218.069) (-2213.652) (-2205.323) [-2214.386] * (-2221.050) (-2217.537) [-2208.917] (-2214.101) -- 0:02:23
477500 -- [-2208.774] (-2217.024) (-2206.823) (-2210.542) * (-2210.654) (-2220.474) [-2215.131] (-2219.146) -- 0:02:23
478000 -- (-2222.068) [-2208.587] (-2209.973) (-2219.437) * (-2213.978) [-2212.431] (-2209.127) (-2221.025) -- 0:02:23
478500 -- (-2214.063) (-2209.618) (-2216.217) [-2220.333] * [-2212.919] (-2207.045) (-2213.005) (-2231.244) -- 0:02:22
479000 -- [-2205.401] (-2208.658) (-2213.874) (-2213.511) * (-2211.635) (-2207.120) (-2222.855) [-2221.202] -- 0:02:22
479500 -- (-2203.535) (-2218.340) (-2217.470) [-2205.945] * (-2217.305) (-2210.850) [-2209.171] (-2215.531) -- 0:02:22
480000 -- (-2228.384) (-2208.687) (-2216.166) [-2209.680] * (-2212.757) (-2222.688) [-2209.522] (-2214.670) -- 0:02:23
Average standard deviation of split frequencies: 0.012599
480500 -- (-2212.979) (-2209.403) (-2215.983) [-2208.338] * (-2221.499) (-2210.198) (-2215.117) [-2211.993] -- 0:02:22
481000 -- (-2216.171) (-2211.287) (-2226.100) [-2210.139] * (-2217.049) (-2212.509) (-2232.312) [-2206.437] -- 0:02:22
481500 -- (-2209.207) [-2214.209] (-2208.684) (-2217.237) * (-2216.976) [-2214.160] (-2212.538) (-2217.183) -- 0:02:22
482000 -- (-2227.422) (-2215.591) (-2214.731) [-2209.425] * [-2203.784] (-2219.581) (-2211.622) (-2212.081) -- 0:02:21
482500 -- [-2214.976] (-2215.280) (-2211.499) (-2215.876) * (-2218.530) (-2230.158) (-2206.692) [-2210.273] -- 0:02:21
483000 -- [-2207.745] (-2206.111) (-2210.618) (-2219.501) * (-2216.398) (-2209.221) [-2206.753] (-2218.832) -- 0:02:21
483500 -- (-2216.115) (-2207.970) [-2208.172] (-2220.242) * [-2207.815] (-2231.252) (-2209.001) (-2210.775) -- 0:02:22
484000 -- (-2219.013) [-2209.869] (-2209.848) (-2222.888) * (-2210.634) (-2217.939) (-2214.092) [-2209.564] -- 0:02:21
484500 -- [-2207.299] (-2216.480) (-2210.515) (-2220.634) * (-2206.880) (-2223.214) (-2209.871) [-2221.045] -- 0:02:21
485000 -- (-2215.584) (-2205.319) (-2211.171) [-2209.366] * (-2207.586) (-2219.425) (-2212.572) [-2211.187] -- 0:02:21
Average standard deviation of split frequencies: 0.012610
485500 -- (-2214.065) (-2220.264) [-2213.462] (-2204.036) * [-2204.383] (-2214.151) (-2225.806) (-2210.729) -- 0:02:20
486000 -- (-2215.231) (-2220.926) [-2215.943] (-2219.383) * [-2208.314] (-2223.858) (-2212.808) (-2206.934) -- 0:02:20
486500 -- (-2217.149) (-2217.408) (-2227.590) [-2204.973] * (-2213.881) (-2212.639) (-2209.073) [-2207.781] -- 0:02:20
487000 -- (-2218.575) (-2206.619) [-2214.403] (-2213.019) * (-2218.265) [-2218.187] (-2215.103) (-2214.944) -- 0:02:20
487500 -- (-2218.743) [-2223.916] (-2234.619) (-2207.465) * (-2209.587) (-2220.433) (-2215.515) [-2209.301] -- 0:02:20
488000 -- (-2221.628) (-2209.629) (-2226.014) [-2208.387] * (-2217.473) (-2219.502) [-2204.424] (-2213.795) -- 0:02:20
488500 -- (-2215.738) [-2216.436] (-2218.196) (-2207.519) * (-2219.356) (-2225.861) (-2216.585) [-2210.523] -- 0:02:20
489000 -- [-2218.776] (-2224.109) (-2219.936) (-2222.163) * (-2220.080) (-2215.466) [-2208.126] (-2206.358) -- 0:02:20
489500 -- (-2211.256) [-2218.764] (-2206.416) (-2222.440) * (-2213.674) (-2224.904) (-2222.765) [-2212.586] -- 0:02:19
490000 -- [-2210.804] (-2234.315) (-2203.406) (-2212.149) * (-2226.554) (-2218.533) (-2216.041) [-2205.838] -- 0:02:19
Average standard deviation of split frequencies: 0.012268
490500 -- (-2217.430) [-2216.299] (-2212.890) (-2215.144) * (-2224.524) (-2216.711) [-2208.144] (-2210.316) -- 0:02:19
491000 -- (-2220.642) (-2219.125) [-2204.858] (-2215.932) * (-2226.533) (-2218.750) [-2206.352] (-2214.717) -- 0:02:18
491500 -- (-2214.704) [-2211.745] (-2205.474) (-2219.574) * (-2212.220) (-2209.601) (-2227.564) [-2214.044] -- 0:02:18
492000 -- (-2208.216) [-2217.049] (-2228.690) (-2221.629) * (-2214.468) (-2216.113) (-2213.039) [-2219.510] -- 0:02:19
492500 -- (-2218.239) (-2217.273) [-2216.828] (-2224.948) * (-2213.584) (-2230.243) [-2210.736] (-2218.735) -- 0:02:19
493000 -- (-2223.752) (-2213.076) [-2204.304] (-2232.716) * (-2212.913) (-2211.354) [-2209.380] (-2221.416) -- 0:02:18
493500 -- [-2213.264] (-2207.193) (-2216.860) (-2220.648) * (-2215.746) [-2204.757] (-2224.126) (-2213.998) -- 0:02:18
494000 -- (-2217.833) (-2208.482) [-2215.208] (-2216.197) * (-2223.279) (-2212.232) [-2206.244] (-2212.520) -- 0:02:18
494500 -- (-2216.118) (-2215.193) (-2212.658) [-2214.361] * [-2214.377] (-2215.307) (-2219.804) (-2212.353) -- 0:02:18
495000 -- (-2224.696) [-2208.211] (-2216.367) (-2213.670) * [-2209.521] (-2209.691) (-2218.764) (-2218.912) -- 0:02:17
Average standard deviation of split frequencies: 0.011917
495500 -- (-2219.376) (-2212.356) [-2217.688] (-2213.228) * (-2206.721) [-2206.587] (-2225.582) (-2216.649) -- 0:02:18
496000 -- (-2208.705) (-2218.467) [-2209.172] (-2209.865) * (-2212.583) [-2210.766] (-2215.098) (-2220.215) -- 0:02:18
496500 -- (-2207.215) (-2207.869) (-2208.921) [-2209.351] * (-2208.705) (-2209.185) (-2211.733) [-2212.339] -- 0:02:17
497000 -- (-2215.857) (-2204.932) (-2215.201) [-2207.265] * (-2220.203) (-2213.087) (-2215.732) [-2210.217] -- 0:02:17
497500 -- (-2212.478) [-2214.124] (-2223.658) (-2221.874) * (-2208.264) (-2212.711) (-2205.930) [-2206.922] -- 0:02:17
498000 -- (-2208.788) [-2201.622] (-2222.506) (-2203.145) * [-2209.505] (-2212.734) (-2213.798) (-2211.785) -- 0:02:17
498500 -- [-2212.833] (-2208.984) (-2218.349) (-2205.081) * [-2209.832] (-2215.480) (-2207.108) (-2208.028) -- 0:02:16
499000 -- [-2211.788] (-2210.823) (-2220.367) (-2220.111) * (-2216.012) (-2219.201) (-2208.764) [-2206.932] -- 0:02:16
499500 -- (-2209.351) (-2214.089) [-2212.606] (-2218.066) * (-2209.865) (-2213.629) (-2205.386) [-2209.413] -- 0:02:17
500000 -- (-2216.559) [-2210.033] (-2224.109) (-2213.631) * (-2216.469) (-2210.850) (-2210.542) [-2216.064] -- 0:02:17
Average standard deviation of split frequencies: 0.010430
500500 -- (-2211.461) [-2211.942] (-2225.393) (-2217.612) * [-2215.107] (-2213.796) (-2219.685) (-2206.972) -- 0:02:16
501000 -- [-2204.544] (-2213.797) (-2212.455) (-2218.525) * (-2213.920) (-2216.158) (-2215.746) [-2212.979] -- 0:02:16
501500 -- (-2208.029) [-2204.626] (-2204.295) (-2213.349) * (-2215.074) (-2218.015) (-2210.088) [-2208.863] -- 0:02:16
502000 -- (-2220.465) (-2213.677) (-2211.617) [-2215.325] * (-2213.680) [-2205.062] (-2217.329) (-2214.907) -- 0:02:15
502500 -- (-2227.426) [-2211.319] (-2210.931) (-2208.946) * (-2209.971) (-2212.456) [-2215.792] (-2212.544) -- 0:02:15
503000 -- (-2219.770) (-2217.651) [-2210.348] (-2207.462) * [-2214.021] (-2214.744) (-2208.866) (-2217.508) -- 0:02:15
503500 -- (-2214.329) (-2211.143) [-2213.199] (-2214.334) * (-2210.995) [-2214.117] (-2221.912) (-2215.674) -- 0:02:16
504000 -- (-2210.767) (-2209.335) (-2214.735) [-2213.868] * (-2229.850) [-2206.624] (-2209.467) (-2228.748) -- 0:02:15
504500 -- (-2210.729) (-2222.483) [-2215.132] (-2212.511) * (-2227.602) (-2213.222) [-2210.359] (-2211.883) -- 0:02:15
505000 -- [-2204.711] (-2215.285) (-2218.497) (-2209.150) * (-2211.688) (-2211.219) [-2201.760] (-2216.434) -- 0:02:15
Average standard deviation of split frequencies: 0.010750
505500 -- (-2215.354) [-2213.410] (-2220.216) (-2216.755) * [-2207.698] (-2225.549) (-2220.715) (-2218.482) -- 0:02:14
506000 -- (-2209.896) (-2215.205) (-2218.483) [-2219.569] * (-2210.985) [-2218.331] (-2217.499) (-2217.652) -- 0:02:14
506500 -- [-2205.935] (-2211.522) (-2208.081) (-2215.383) * (-2203.498) (-2210.799) [-2214.112] (-2223.328) -- 0:02:14
507000 -- (-2221.953) [-2216.659] (-2204.920) (-2207.320) * [-2212.293] (-2218.638) (-2215.816) (-2221.530) -- 0:02:14
507500 -- [-2215.928] (-2219.426) (-2209.124) (-2215.878) * (-2205.488) [-2213.926] (-2211.853) (-2225.953) -- 0:02:14
508000 -- (-2229.295) (-2214.153) [-2216.186] (-2202.042) * (-2214.338) [-2209.261] (-2210.382) (-2219.780) -- 0:02:14
508500 -- (-2218.625) [-2209.615] (-2206.661) (-2221.299) * (-2213.240) (-2212.805) [-2206.495] (-2218.123) -- 0:02:14
509000 -- (-2211.421) (-2213.526) [-2211.066] (-2214.523) * (-2224.162) (-2215.817) [-2209.440] (-2223.660) -- 0:02:14
509500 -- (-2216.558) (-2219.432) [-2205.281] (-2215.714) * (-2212.097) (-2224.676) (-2216.739) [-2219.822] -- 0:02:13
510000 -- (-2209.862) [-2215.182] (-2210.984) (-2215.316) * (-2210.536) (-2217.603) [-2211.194] (-2212.834) -- 0:02:13
Average standard deviation of split frequencies: 0.010509
510500 -- [-2203.888] (-2217.920) (-2209.610) (-2207.775) * (-2214.151) (-2212.321) (-2218.096) [-2205.844] -- 0:02:13
511000 -- (-2205.586) (-2218.996) (-2206.561) [-2209.023] * (-2207.981) (-2223.455) (-2224.355) [-2206.844] -- 0:02:13
511500 -- (-2222.660) [-2222.751] (-2222.601) (-2209.735) * (-2208.258) (-2216.067) (-2222.119) [-2203.421] -- 0:02:13
512000 -- (-2210.979) (-2213.087) (-2215.424) [-2214.133] * (-2210.642) (-2213.802) (-2226.280) [-2205.597] -- 0:02:13
512500 -- (-2213.535) [-2208.474] (-2216.661) (-2208.027) * (-2216.828) (-2213.150) (-2219.847) [-2202.624] -- 0:02:13
513000 -- (-2221.147) (-2214.892) [-2205.201] (-2214.055) * (-2208.071) (-2210.150) [-2212.085] (-2211.708) -- 0:02:12
513500 -- [-2211.949] (-2215.441) (-2216.885) (-2207.815) * (-2229.964) (-2208.980) [-2214.305] (-2210.485) -- 0:02:12
514000 -- (-2209.135) (-2221.104) (-2214.167) [-2202.655] * (-2219.294) (-2213.331) [-2216.029] (-2216.712) -- 0:02:12
514500 -- (-2227.314) (-2220.124) [-2216.762] (-2217.692) * (-2219.079) (-2222.945) (-2208.620) [-2213.090] -- 0:02:12
515000 -- (-2216.638) (-2215.885) [-2210.696] (-2205.170) * (-2216.071) (-2210.667) (-2210.763) [-2219.408] -- 0:02:11
Average standard deviation of split frequencies: 0.010190
515500 -- (-2214.883) (-2213.442) [-2220.249] (-2210.336) * (-2215.339) (-2217.181) [-2212.646] (-2212.232) -- 0:02:12
516000 -- (-2211.684) (-2203.754) (-2221.316) [-2210.437] * (-2215.233) (-2216.110) (-2208.736) [-2212.518] -- 0:02:12
516500 -- [-2208.789] (-2225.019) (-2222.411) (-2214.667) * [-2207.811] (-2212.510) (-2217.287) (-2216.781) -- 0:02:11
517000 -- [-2209.313] (-2214.235) (-2219.864) (-2210.790) * [-2211.725] (-2210.042) (-2220.675) (-2221.127) -- 0:02:11
517500 -- (-2217.708) (-2220.183) [-2205.393] (-2215.429) * [-2209.875] (-2227.425) (-2224.348) (-2211.247) -- 0:02:11
518000 -- (-2213.439) (-2212.747) [-2211.838] (-2221.593) * (-2220.160) [-2212.201] (-2207.422) (-2213.544) -- 0:02:11
518500 -- (-2220.563) (-2210.192) (-2207.708) [-2212.591] * (-2222.165) (-2214.509) (-2228.986) [-2210.837] -- 0:02:10
519000 -- (-2216.585) [-2213.477] (-2211.198) (-2214.285) * (-2215.824) (-2212.722) (-2212.771) [-2209.953] -- 0:02:10
519500 -- (-2219.205) (-2211.107) [-2211.248] (-2236.279) * (-2218.772) (-2222.043) [-2218.671] (-2221.777) -- 0:02:11
520000 -- [-2214.276] (-2219.875) (-2211.169) (-2217.055) * (-2218.049) (-2216.846) [-2209.317] (-2212.935) -- 0:02:11
Average standard deviation of split frequencies: 0.010029
520500 -- (-2226.760) (-2219.020) (-2216.734) [-2210.870] * (-2219.079) (-2220.110) [-2213.075] (-2212.361) -- 0:02:10
521000 -- [-2220.064] (-2217.898) (-2217.790) (-2218.276) * (-2219.895) (-2213.389) [-2220.073] (-2221.365) -- 0:02:10
521500 -- (-2213.765) (-2209.133) (-2211.576) [-2208.811] * (-2212.312) [-2211.961] (-2219.268) (-2212.072) -- 0:02:10
522000 -- (-2213.141) (-2214.076) (-2215.867) [-2203.058] * (-2221.912) (-2214.771) [-2215.899] (-2206.381) -- 0:02:10
522500 -- [-2212.026] (-2219.062) (-2211.800) (-2217.752) * [-2213.636] (-2213.535) (-2215.719) (-2211.154) -- 0:02:09
523000 -- (-2218.090) [-2212.404] (-2213.146) (-2225.543) * (-2218.654) [-2211.932] (-2212.433) (-2214.905) -- 0:02:09
523500 -- [-2205.306] (-2214.129) (-2225.811) (-2219.997) * (-2211.693) (-2214.422) (-2207.902) [-2203.237] -- 0:02:10
524000 -- (-2220.110) [-2221.782] (-2216.974) (-2220.476) * (-2218.941) [-2213.758] (-2226.677) (-2207.336) -- 0:02:09
524500 -- (-2206.338) [-2211.796] (-2217.516) (-2223.370) * (-2213.897) [-2212.721] (-2216.517) (-2209.332) -- 0:02:09
525000 -- (-2221.915) (-2209.294) [-2206.843] (-2215.937) * [-2217.431] (-2215.290) (-2214.348) (-2215.198) -- 0:02:09
Average standard deviation of split frequencies: 0.009996
525500 -- (-2216.755) [-2212.407] (-2214.647) (-2212.516) * (-2207.425) [-2213.480] (-2219.147) (-2208.322) -- 0:02:09
526000 -- (-2211.105) [-2206.887] (-2214.511) (-2232.019) * (-2206.702) (-2219.735) [-2213.607] (-2219.835) -- 0:02:08
526500 -- (-2222.626) (-2216.004) [-2211.920] (-2206.822) * [-2209.920] (-2214.951) (-2207.386) (-2218.306) -- 0:02:08
527000 -- [-2214.329] (-2219.003) (-2217.540) (-2210.133) * (-2207.042) (-2217.185) [-2215.828] (-2223.678) -- 0:02:08
527500 -- (-2226.507) [-2207.819] (-2216.577) (-2207.835) * [-2211.655] (-2215.277) (-2225.199) (-2214.141) -- 0:02:08
528000 -- (-2211.456) (-2213.528) (-2227.018) [-2203.883] * (-2226.341) (-2216.499) [-2211.974] (-2216.322) -- 0:02:08
528500 -- [-2210.324] (-2208.150) (-2230.864) (-2230.743) * (-2217.309) (-2219.253) (-2211.885) [-2220.992] -- 0:02:08
529000 -- (-2219.295) (-2208.494) [-2219.101] (-2215.844) * (-2219.939) (-2221.823) [-2206.381] (-2206.601) -- 0:02:08
529500 -- (-2203.261) (-2215.643) (-2225.211) [-2201.701] * (-2219.560) (-2215.239) [-2202.568] (-2215.780) -- 0:02:07
530000 -- [-2213.873] (-2208.186) (-2217.177) (-2213.185) * (-2216.542) (-2211.028) (-2209.172) [-2211.476] -- 0:02:07
Average standard deviation of split frequencies: 0.008952
530500 -- [-2212.386] (-2219.310) (-2220.470) (-2212.815) * (-2211.653) (-2220.389) [-2212.364] (-2222.022) -- 0:02:07
531000 -- (-2215.461) (-2216.676) [-2214.293] (-2217.558) * (-2213.575) (-2222.492) [-2202.162] (-2222.119) -- 0:02:07
531500 -- (-2219.890) (-2211.673) (-2221.462) [-2214.051] * (-2211.993) (-2220.190) [-2202.905] (-2215.483) -- 0:02:07
532000 -- (-2220.128) (-2213.812) (-2220.168) [-2210.965] * (-2219.481) (-2208.427) (-2206.435) [-2211.796] -- 0:02:07
532500 -- (-2208.663) (-2228.032) [-2211.693] (-2209.117) * [-2211.180] (-2215.511) (-2214.293) (-2206.864) -- 0:02:07
533000 -- (-2208.266) [-2217.318] (-2215.082) (-2204.204) * (-2229.203) [-2212.039] (-2209.443) (-2215.189) -- 0:02:07
533500 -- (-2217.325) (-2217.012) [-2208.331] (-2211.864) * (-2226.022) (-2211.923) (-2211.353) [-2211.801] -- 0:02:06
534000 -- (-2212.054) (-2230.981) [-2210.000] (-2208.820) * (-2220.465) [-2214.348] (-2210.217) (-2214.887) -- 0:02:06
534500 -- [-2215.833] (-2216.240) (-2216.064) (-2210.055) * (-2214.435) (-2214.272) [-2207.597] (-2218.827) -- 0:02:06
535000 -- (-2216.384) (-2211.713) [-2207.874] (-2215.107) * (-2206.903) (-2207.652) [-2209.613] (-2210.891) -- 0:02:06
Average standard deviation of split frequencies: 0.007915
535500 -- (-2216.503) (-2211.034) (-2216.866) [-2212.810] * (-2219.286) (-2211.212) [-2210.716] (-2212.970) -- 0:02:06
536000 -- (-2215.062) (-2210.722) (-2209.143) [-2212.117] * (-2214.201) (-2230.134) (-2225.811) [-2214.297] -- 0:02:06
536500 -- (-2226.225) [-2220.578] (-2216.415) (-2212.906) * (-2207.388) (-2222.147) (-2212.892) [-2230.583] -- 0:02:06
537000 -- (-2227.120) [-2205.653] (-2212.142) (-2221.064) * (-2214.696) (-2230.515) (-2218.317) [-2205.397] -- 0:02:05
537500 -- (-2214.348) (-2225.858) (-2222.914) [-2213.216] * [-2227.452] (-2223.350) (-2224.501) (-2212.126) -- 0:02:05
538000 -- (-2209.849) (-2216.265) [-2202.234] (-2215.439) * [-2217.047] (-2217.775) (-2218.538) (-2209.979) -- 0:02:05
538500 -- [-2223.929] (-2221.726) (-2222.156) (-2228.247) * [-2216.245] (-2213.845) (-2211.933) (-2214.172) -- 0:02:05
539000 -- (-2214.313) [-2213.612] (-2212.115) (-2214.984) * (-2218.593) (-2219.497) (-2220.056) [-2207.548] -- 0:02:04
539500 -- (-2218.404) [-2212.381] (-2213.649) (-2214.853) * (-2207.832) (-2203.935) [-2226.319] (-2217.120) -- 0:02:05
540000 -- (-2217.693) [-2210.615] (-2215.556) (-2216.998) * (-2227.523) (-2221.971) (-2225.767) [-2210.614] -- 0:02:05
Average standard deviation of split frequencies: 0.008451
540500 -- (-2221.676) (-2210.388) (-2213.682) [-2213.122] * [-2211.406] (-2220.307) (-2207.024) (-2209.536) -- 0:02:04
541000 -- (-2214.598) (-2223.465) (-2213.111) [-2210.579] * (-2213.181) [-2212.529] (-2228.548) (-2219.785) -- 0:02:04
541500 -- (-2213.039) (-2222.461) [-2212.570] (-2211.244) * (-2218.298) (-2211.345) [-2206.662] (-2217.390) -- 0:02:04
542000 -- (-2212.966) [-2209.936] (-2213.531) (-2217.362) * (-2205.389) (-2208.120) (-2223.434) [-2208.932] -- 0:02:04
542500 -- (-2211.377) [-2203.644] (-2221.378) (-2214.329) * [-2217.699] (-2220.418) (-2215.894) (-2219.619) -- 0:02:03
543000 -- (-2208.455) (-2206.576) (-2230.740) [-2208.958] * (-2213.910) (-2216.203) [-2213.195] (-2213.876) -- 0:02:03
543500 -- [-2209.942] (-2211.424) (-2221.875) (-2219.539) * (-2212.435) [-2210.412] (-2216.527) (-2215.311) -- 0:02:03
544000 -- (-2219.522) (-2224.541) [-2212.362] (-2212.835) * (-2211.258) (-2208.998) (-2212.850) [-2205.953] -- 0:02:04
544500 -- (-2210.541) [-2213.161] (-2215.994) (-2220.450) * [-2210.849] (-2206.997) (-2204.335) (-2218.456) -- 0:02:03
545000 -- [-2216.192] (-2213.493) (-2211.179) (-2221.708) * (-2209.279) [-2208.418] (-2213.765) (-2224.735) -- 0:02:03
Average standard deviation of split frequencies: 0.008368
545500 -- (-2218.549) [-2212.560] (-2212.035) (-2221.961) * (-2211.651) (-2217.191) (-2218.324) [-2210.024] -- 0:02:03
546000 -- (-2211.578) (-2232.063) [-2213.430] (-2217.431) * (-2216.405) (-2211.669) (-2224.710) [-2208.335] -- 0:02:03
546500 -- (-2213.378) [-2208.351] (-2212.701) (-2224.235) * [-2210.401] (-2218.365) (-2216.510) (-2227.173) -- 0:02:02
547000 -- (-2212.531) [-2207.320] (-2231.479) (-2219.848) * [-2207.639] (-2218.664) (-2223.915) (-2208.055) -- 0:02:02
547500 -- [-2209.318] (-2211.559) (-2215.456) (-2211.653) * (-2204.435) (-2210.637) [-2212.899] (-2213.173) -- 0:02:02
548000 -- (-2211.600) (-2213.434) (-2224.655) [-2204.834] * (-2232.382) [-2212.196] (-2221.906) (-2218.169) -- 0:02:02
548500 -- [-2213.732] (-2211.819) (-2212.560) (-2204.465) * (-2212.702) (-2217.653) (-2219.084) [-2216.823] -- 0:02:02
549000 -- (-2227.219) (-2215.610) (-2211.270) [-2204.781] * (-2228.919) (-2219.364) (-2212.629) [-2220.308] -- 0:02:02
549500 -- (-2212.631) (-2221.109) [-2210.806] (-2220.560) * [-2210.074] (-2214.047) (-2212.930) (-2209.587) -- 0:02:02
550000 -- [-2210.671] (-2207.778) (-2220.490) (-2223.369) * [-2212.478] (-2228.109) (-2211.798) (-2205.277) -- 0:02:01
Average standard deviation of split frequencies: 0.008231
550500 -- [-2209.893] (-2216.587) (-2208.500) (-2216.129) * [-2211.851] (-2211.216) (-2215.487) (-2219.981) -- 0:02:01
551000 -- (-2211.007) (-2214.417) [-2212.032] (-2230.521) * (-2214.323) (-2221.858) [-2213.152] (-2211.442) -- 0:02:01
551500 -- [-2215.012] (-2213.492) (-2211.312) (-2210.652) * (-2210.409) (-2210.743) (-2213.688) [-2202.683] -- 0:02:01
552000 -- (-2227.495) (-2208.099) (-2215.746) [-2207.612] * [-2208.875] (-2209.425) (-2228.061) (-2218.554) -- 0:02:01
552500 -- [-2209.417] (-2211.627) (-2215.906) (-2214.145) * (-2213.692) (-2217.932) (-2215.340) [-2210.892] -- 0:02:01
553000 -- (-2210.713) [-2210.378] (-2215.759) (-2217.909) * [-2212.632] (-2219.992) (-2222.566) (-2216.457) -- 0:02:01
553500 -- (-2224.432) [-2209.920] (-2209.344) (-2212.944) * (-2212.360) (-2211.737) (-2237.561) [-2217.193] -- 0:02:01
554000 -- (-2220.655) (-2215.814) [-2219.354] (-2209.382) * [-2209.196] (-2215.706) (-2225.932) (-2212.712) -- 0:02:00
554500 -- (-2220.505) [-2215.318] (-2217.680) (-2218.593) * (-2205.004) (-2211.388) (-2215.394) [-2207.949] -- 0:02:00
555000 -- (-2214.556) [-2203.899] (-2207.745) (-2235.143) * (-2219.614) (-2207.978) (-2215.916) [-2208.916] -- 0:02:00
Average standard deviation of split frequencies: 0.007500
555500 -- (-2209.386) [-2211.425] (-2205.179) (-2218.560) * (-2211.746) (-2210.639) [-2205.818] (-2217.705) -- 0:02:00
556000 -- (-2219.319) [-2217.190] (-2215.892) (-2222.275) * [-2211.724] (-2211.641) (-2220.854) (-2220.342) -- 0:02:00
556500 -- (-2210.228) (-2205.127) [-2214.422] (-2225.928) * (-2215.342) (-2224.474) [-2206.215] (-2218.725) -- 0:02:00
557000 -- (-2217.377) [-2214.703] (-2224.236) (-2218.608) * (-2223.625) (-2213.407) [-2207.505] (-2219.243) -- 0:02:00
557500 -- (-2215.250) (-2217.299) [-2209.633] (-2221.426) * (-2212.381) [-2212.995] (-2213.648) (-2212.292) -- 0:01:59
558000 -- (-2205.831) [-2219.215] (-2212.202) (-2212.940) * [-2218.754] (-2211.416) (-2217.640) (-2221.246) -- 0:01:59
558500 -- (-2214.391) (-2217.034) [-2209.692] (-2225.479) * (-2210.762) (-2215.307) [-2210.835] (-2205.440) -- 0:01:59
559000 -- (-2204.243) (-2213.689) [-2205.662] (-2223.777) * (-2216.910) (-2209.811) [-2218.092] (-2227.964) -- 0:01:59
559500 -- (-2214.011) (-2226.349) [-2215.431] (-2220.705) * (-2211.972) (-2214.884) (-2222.876) [-2213.749] -- 0:01:58
560000 -- (-2205.404) (-2217.598) (-2207.470) [-2218.126] * (-2214.001) (-2223.618) (-2219.524) [-2211.490] -- 0:01:59
Average standard deviation of split frequencies: 0.007308
560500 -- (-2205.734) [-2213.508] (-2224.070) (-2217.123) * (-2209.566) (-2215.143) [-2218.168] (-2215.234) -- 0:01:59
561000 -- (-2212.798) (-2230.478) [-2217.440] (-2216.673) * (-2217.545) [-2211.411] (-2213.159) (-2211.132) -- 0:01:58
561500 -- [-2216.297] (-2225.618) (-2221.790) (-2208.997) * (-2214.299) (-2218.216) (-2219.322) [-2204.655] -- 0:01:58
562000 -- (-2220.720) (-2212.013) [-2211.882] (-2207.244) * [-2206.795] (-2219.435) (-2215.963) (-2213.372) -- 0:01:58
562500 -- [-2210.509] (-2210.716) (-2214.111) (-2212.435) * (-2208.905) [-2207.919] (-2221.869) (-2214.649) -- 0:01:58
563000 -- (-2213.720) (-2217.582) [-2208.048] (-2217.148) * (-2213.771) (-2212.972) (-2206.801) [-2210.344] -- 0:01:57
563500 -- (-2214.099) (-2213.580) (-2218.115) [-2221.064] * (-2211.849) [-2214.174] (-2214.618) (-2230.370) -- 0:01:57
564000 -- (-2205.590) (-2223.691) (-2214.364) [-2210.073] * [-2216.133] (-2208.438) (-2222.306) (-2224.562) -- 0:01:58
564500 -- [-2210.133] (-2209.107) (-2225.885) (-2218.037) * (-2216.290) (-2207.693) (-2214.631) [-2208.677] -- 0:01:58
565000 -- (-2213.113) [-2215.265] (-2219.211) (-2215.650) * (-2206.926) (-2221.317) (-2213.729) [-2210.899] -- 0:01:57
Average standard deviation of split frequencies: 0.007560
565500 -- (-2210.179) (-2220.633) (-2214.336) [-2212.439] * (-2212.865) (-2221.502) [-2209.358] (-2223.619) -- 0:01:57
566000 -- [-2211.079] (-2212.975) (-2218.484) (-2213.542) * (-2214.383) (-2216.918) (-2212.062) [-2217.420] -- 0:01:57
566500 -- (-2207.934) [-2206.482] (-2234.082) (-2221.682) * (-2214.238) [-2213.160] (-2215.166) (-2215.309) -- 0:01:57
567000 -- (-2212.686) (-2213.546) (-2223.659) [-2219.160] * (-2215.993) (-2220.070) [-2214.012] (-2220.692) -- 0:01:56
567500 -- [-2206.302] (-2214.980) (-2206.024) (-2216.359) * (-2216.936) (-2215.004) [-2213.056] (-2222.957) -- 0:01:56
568000 -- (-2211.108) (-2211.915) [-2202.866] (-2227.044) * (-2215.660) (-2210.729) (-2207.943) [-2217.650] -- 0:01:57
568500 -- [-2209.804] (-2209.734) (-2209.764) (-2226.302) * (-2217.297) (-2227.052) (-2207.894) [-2217.883] -- 0:01:56
569000 -- (-2208.298) (-2206.342) [-2211.906] (-2212.693) * (-2215.259) [-2207.263] (-2214.705) (-2216.677) -- 0:01:56
569500 -- [-2208.226] (-2216.207) (-2212.034) (-2211.392) * (-2215.809) (-2212.532) [-2212.080] (-2222.843) -- 0:01:56
570000 -- (-2214.196) (-2221.845) [-2209.871] (-2220.405) * (-2209.711) [-2213.849] (-2204.529) (-2211.560) -- 0:01:56
Average standard deviation of split frequencies: 0.007625
570500 -- [-2210.395] (-2208.838) (-2213.732) (-2222.396) * (-2216.258) [-2213.436] (-2211.543) (-2215.107) -- 0:01:55
571000 -- [-2205.597] (-2219.676) (-2215.966) (-2216.449) * [-2216.479] (-2206.780) (-2226.419) (-2209.999) -- 0:01:55
571500 -- [-2218.156] (-2217.802) (-2211.499) (-2224.421) * (-2214.699) (-2213.523) [-2208.664] (-2212.657) -- 0:01:55
572000 -- (-2212.608) [-2215.755] (-2217.226) (-2215.803) * [-2210.685] (-2211.742) (-2211.531) (-2206.097) -- 0:01:55
572500 -- (-2207.296) [-2206.032] (-2210.059) (-2231.250) * (-2210.495) (-2219.660) (-2230.141) [-2204.433] -- 0:01:55
573000 -- (-2206.635) (-2206.393) [-2213.862] (-2221.610) * [-2207.323] (-2218.100) (-2209.259) (-2220.078) -- 0:01:55
573500 -- (-2215.030) (-2221.806) (-2211.532) [-2208.454] * (-2217.019) (-2212.026) [-2208.280] (-2221.426) -- 0:01:55
574000 -- (-2209.064) (-2204.719) (-2213.433) [-2210.862] * (-2228.663) (-2214.143) [-2201.965] (-2218.626) -- 0:01:55
574500 -- (-2221.416) [-2209.904] (-2208.931) (-2209.139) * (-2217.893) (-2215.103) [-2211.111] (-2222.764) -- 0:01:54
575000 -- [-2208.927] (-2219.936) (-2221.249) (-2226.023) * [-2217.701] (-2235.043) (-2215.767) (-2212.018) -- 0:01:54
Average standard deviation of split frequencies: 0.006673
575500 -- (-2209.925) (-2222.879) [-2218.528] (-2235.376) * (-2211.335) (-2220.735) (-2206.521) [-2208.935] -- 0:01:54
576000 -- (-2218.355) [-2215.691] (-2207.141) (-2207.088) * (-2224.256) (-2210.392) (-2206.307) [-2212.743] -- 0:01:54
576500 -- (-2224.443) [-2211.116] (-2206.546) (-2210.111) * (-2212.616) (-2208.455) [-2210.182] (-2208.991) -- 0:01:54
577000 -- [-2217.047] (-2205.415) (-2211.795) (-2209.145) * (-2216.660) (-2209.527) [-2213.564] (-2216.619) -- 0:01:54
577500 -- (-2213.816) [-2206.135] (-2214.246) (-2214.370) * [-2216.726] (-2209.464) (-2207.075) (-2208.808) -- 0:01:54
578000 -- [-2214.435] (-2211.715) (-2219.283) (-2207.798) * (-2208.024) (-2217.368) [-2210.207] (-2217.901) -- 0:01:53
578500 -- (-2220.243) (-2219.079) [-2216.066] (-2219.600) * [-2208.307] (-2207.559) (-2207.270) (-2210.413) -- 0:01:53
579000 -- (-2212.020) (-2219.722) [-2217.632] (-2218.750) * (-2214.807) (-2214.427) [-2204.814] (-2218.728) -- 0:01:53
579500 -- [-2214.997] (-2212.608) (-2216.618) (-2224.584) * (-2212.552) (-2206.387) (-2213.867) [-2207.122] -- 0:01:53
580000 -- (-2216.703) [-2207.672] (-2222.011) (-2215.954) * (-2210.102) (-2213.315) (-2220.651) [-2211.994] -- 0:01:53
Average standard deviation of split frequencies: 0.006682
580500 -- (-2205.874) (-2212.735) (-2217.428) [-2210.218] * (-2218.585) [-2210.712] (-2211.845) (-2223.427) -- 0:01:53
581000 -- [-2210.544] (-2222.186) (-2221.237) (-2224.568) * [-2207.141] (-2216.444) (-2225.727) (-2212.849) -- 0:01:53
581500 -- (-2225.889) (-2218.348) (-2209.210) [-2217.414] * (-2222.282) (-2208.021) (-2218.472) [-2212.358] -- 0:01:52
582000 -- [-2213.945] (-2222.548) (-2216.273) (-2238.236) * (-2213.369) [-2207.194] (-2218.937) (-2209.265) -- 0:01:52
582500 -- [-2210.892] (-2211.334) (-2218.923) (-2229.218) * [-2207.457] (-2206.297) (-2208.174) (-2218.610) -- 0:01:52
583000 -- (-2209.087) [-2210.851] (-2216.916) (-2228.357) * (-2215.434) (-2222.193) [-2207.859] (-2212.040) -- 0:01:52
583500 -- (-2210.897) (-2213.956) [-2206.435] (-2219.498) * (-2209.019) (-2208.414) (-2223.867) [-2205.198] -- 0:01:52
584000 -- (-2205.862) (-2222.561) (-2220.166) [-2220.742] * (-2219.174) [-2209.927] (-2223.120) (-2213.235) -- 0:01:52
584500 -- [-2217.675] (-2212.280) (-2222.798) (-2229.177) * [-2214.025] (-2209.778) (-2215.241) (-2212.589) -- 0:01:52
585000 -- (-2211.666) (-2218.594) [-2212.900] (-2221.105) * (-2223.029) [-2209.235] (-2211.904) (-2229.727) -- 0:01:52
Average standard deviation of split frequencies: 0.007488
585500 -- [-2212.185] (-2219.072) (-2218.909) (-2216.749) * (-2219.240) (-2211.119) (-2209.178) [-2205.635] -- 0:01:51
586000 -- (-2214.573) (-2207.203) (-2208.286) [-2219.282] * (-2213.188) (-2217.031) [-2207.256] (-2213.458) -- 0:01:51
586500 -- [-2224.623] (-2212.360) (-2212.560) (-2221.001) * (-2223.954) (-2226.859) (-2217.437) [-2213.869] -- 0:01:51
587000 -- [-2208.832] (-2217.368) (-2226.017) (-2218.045) * (-2214.584) (-2219.187) (-2208.179) [-2208.004] -- 0:01:51
587500 -- [-2209.073] (-2212.275) (-2217.233) (-2224.891) * (-2212.969) [-2213.629] (-2207.085) (-2215.994) -- 0:01:50
588000 -- [-2209.839] (-2208.747) (-2226.034) (-2222.621) * (-2206.734) (-2211.999) [-2211.635] (-2213.953) -- 0:01:51
588500 -- (-2214.338) [-2212.694] (-2234.151) (-2216.965) * [-2216.189] (-2219.254) (-2221.382) (-2217.429) -- 0:01:51
589000 -- (-2213.100) [-2207.865] (-2218.614) (-2218.368) * (-2208.403) (-2211.239) (-2211.595) [-2219.067] -- 0:01:50
589500 -- (-2221.087) (-2209.592) (-2217.256) [-2210.996] * (-2226.656) (-2209.040) (-2207.460) [-2213.008] -- 0:01:50
590000 -- [-2214.167] (-2212.586) (-2210.965) (-2204.230) * (-2216.659) (-2211.668) [-2207.048] (-2213.748) -- 0:01:50
Average standard deviation of split frequencies: 0.007613
590500 -- (-2208.550) (-2218.630) (-2217.562) [-2218.860] * (-2221.383) (-2221.135) [-2209.687] (-2216.064) -- 0:01:50
591000 -- (-2214.937) [-2224.089] (-2229.622) (-2217.162) * (-2223.398) [-2215.166] (-2212.551) (-2227.412) -- 0:01:50
591500 -- (-2207.003) [-2220.612] (-2218.085) (-2216.052) * (-2207.075) (-2221.628) (-2213.538) [-2210.938] -- 0:01:49
592000 -- (-2219.701) (-2219.600) (-2225.641) [-2211.303] * [-2217.872] (-2215.384) (-2206.989) (-2214.448) -- 0:01:50
592500 -- (-2218.285) [-2213.207] (-2220.428) (-2209.280) * (-2215.653) (-2216.627) [-2209.508] (-2213.931) -- 0:01:50
593000 -- [-2207.053] (-2219.572) (-2209.865) (-2217.508) * [-2208.232] (-2222.010) (-2212.183) (-2218.251) -- 0:01:49
593500 -- [-2212.340] (-2205.689) (-2203.600) (-2212.245) * (-2217.360) [-2211.565] (-2217.397) (-2213.613) -- 0:01:49
594000 -- (-2213.396) (-2207.836) [-2221.796] (-2225.813) * [-2210.040] (-2222.557) (-2222.290) (-2208.174) -- 0:01:49
594500 -- (-2218.445) [-2209.026] (-2210.496) (-2212.161) * [-2204.904] (-2213.071) (-2226.262) (-2215.101) -- 0:01:49
595000 -- (-2214.531) [-2202.789] (-2209.763) (-2212.961) * (-2203.693) [-2202.947] (-2237.348) (-2213.954) -- 0:01:48
Average standard deviation of split frequencies: 0.007605
595500 -- (-2210.378) (-2228.589) (-2216.235) [-2211.753] * (-2202.695) [-2213.682] (-2238.830) (-2215.349) -- 0:01:48
596000 -- [-2207.989] (-2216.339) (-2221.469) (-2216.206) * (-2218.184) (-2212.632) (-2221.207) [-2214.555] -- 0:01:49
596500 -- (-2209.029) (-2216.131) (-2222.160) [-2209.941] * [-2205.826] (-2210.652) (-2220.319) (-2214.136) -- 0:01:48
597000 -- [-2210.934] (-2208.618) (-2216.596) (-2210.653) * (-2218.043) [-2208.284] (-2228.618) (-2209.681) -- 0:01:48
597500 -- (-2211.475) (-2219.430) (-2217.111) [-2209.414] * (-2219.051) (-2203.340) (-2229.400) [-2216.052] -- 0:01:48
598000 -- (-2205.846) (-2225.597) [-2215.848] (-2208.038) * [-2206.057] (-2204.750) (-2225.491) (-2220.974) -- 0:01:48
598500 -- [-2210.711] (-2217.957) (-2222.229) (-2211.793) * [-2215.991] (-2214.210) (-2223.715) (-2223.686) -- 0:01:48
599000 -- (-2217.567) [-2219.602] (-2225.233) (-2214.754) * (-2213.138) [-2210.755] (-2223.578) (-2208.687) -- 0:01:47
599500 -- [-2219.943] (-2224.627) (-2223.221) (-2206.257) * (-2205.672) (-2220.828) [-2223.150] (-2218.262) -- 0:01:47
600000 -- (-2228.664) [-2211.444] (-2212.278) (-2225.058) * (-2207.611) (-2217.662) (-2226.043) [-2210.711] -- 0:01:48
Average standard deviation of split frequencies: 0.007365
600500 -- [-2211.190] (-2220.916) (-2225.456) (-2215.759) * (-2210.879) (-2218.268) [-2212.936] (-2215.703) -- 0:01:47
601000 -- [-2206.996] (-2219.166) (-2213.421) (-2212.226) * [-2209.903] (-2216.168) (-2207.081) (-2220.541) -- 0:01:47
601500 -- [-2201.565] (-2216.441) (-2225.658) (-2221.068) * [-2211.691] (-2221.923) (-2220.144) (-2209.282) -- 0:01:47
602000 -- (-2211.296) [-2210.652] (-2226.282) (-2215.928) * (-2208.518) (-2234.200) (-2219.666) [-2199.999] -- 0:01:47
602500 -- [-2208.564] (-2211.054) (-2217.843) (-2219.788) * [-2216.126] (-2217.062) (-2214.683) (-2206.996) -- 0:01:46
603000 -- (-2218.404) [-2211.926] (-2220.783) (-2216.118) * [-2210.135] (-2224.379) (-2209.451) (-2208.788) -- 0:01:46
603500 -- (-2208.847) [-2208.382] (-2213.977) (-2222.780) * [-2205.218] (-2214.325) (-2216.957) (-2215.642) -- 0:01:46
604000 -- [-2211.889] (-2210.425) (-2217.914) (-2219.499) * (-2206.931) (-2217.731) (-2219.359) [-2213.849] -- 0:01:46
604500 -- (-2208.528) [-2210.823] (-2218.036) (-2223.814) * [-2210.548] (-2219.957) (-2216.976) (-2217.048) -- 0:01:46
605000 -- (-2205.992) (-2219.222) (-2216.182) [-2207.859] * [-2215.649] (-2216.174) (-2211.246) (-2213.565) -- 0:01:46
Average standard deviation of split frequencies: 0.007719
605500 -- (-2219.415) [-2212.310] (-2223.539) (-2221.623) * (-2227.352) (-2218.430) [-2208.142] (-2227.047) -- 0:01:46
606000 -- (-2205.917) [-2209.386] (-2214.867) (-2230.382) * (-2224.971) (-2213.454) [-2209.351] (-2217.466) -- 0:01:45
606500 -- (-2221.875) [-2208.174] (-2222.014) (-2221.617) * (-2211.747) [-2210.223] (-2218.191) (-2218.037) -- 0:01:45
607000 -- (-2207.549) (-2215.384) (-2223.870) [-2214.721] * [-2208.627] (-2210.516) (-2220.859) (-2210.639) -- 0:01:45
607500 -- (-2218.597) (-2207.755) [-2212.544] (-2217.678) * (-2203.689) (-2215.812) (-2206.817) [-2202.849] -- 0:01:45
608000 -- (-2225.898) (-2208.894) (-2222.230) [-2211.061] * (-2214.443) (-2222.772) (-2209.902) [-2210.120] -- 0:01:45
608500 -- (-2221.618) (-2207.206) (-2225.229) [-2210.529] * (-2216.917) (-2213.469) [-2204.078] (-2207.042) -- 0:01:45
609000 -- (-2222.883) [-2205.963] (-2212.488) (-2212.272) * (-2220.805) [-2211.015] (-2206.656) (-2221.214) -- 0:01:45
609500 -- (-2215.143) [-2212.042] (-2222.036) (-2221.295) * (-2232.892) [-2208.916] (-2224.346) (-2216.911) -- 0:01:45
610000 -- [-2206.070] (-2202.238) (-2212.277) (-2212.368) * (-2209.726) (-2214.607) (-2223.547) [-2209.544] -- 0:01:44
Average standard deviation of split frequencies: 0.007720
610500 -- (-2221.075) (-2212.285) [-2212.093] (-2212.702) * (-2211.978) [-2218.093] (-2223.777) (-2208.437) -- 0:01:44
611000 -- [-2216.825] (-2209.730) (-2208.208) (-2213.025) * (-2214.266) [-2204.828] (-2212.781) (-2216.419) -- 0:01:44
611500 -- (-2222.140) (-2217.601) [-2210.368] (-2219.751) * (-2217.777) (-2215.399) [-2215.594] (-2207.101) -- 0:01:44
612000 -- (-2222.660) (-2207.566) [-2217.872] (-2224.415) * (-2213.469) (-2214.298) [-2210.359] (-2210.524) -- 0:01:44
612500 -- (-2211.578) [-2213.440] (-2216.326) (-2214.564) * (-2202.909) (-2213.293) [-2207.240] (-2206.736) -- 0:01:44
613000 -- [-2223.782] (-2210.666) (-2218.034) (-2218.725) * (-2225.165) [-2205.949] (-2219.992) (-2220.714) -- 0:01:44
613500 -- (-2209.922) (-2224.063) [-2211.952] (-2218.213) * (-2209.364) (-2212.145) (-2212.088) [-2214.376] -- 0:01:43
614000 -- [-2214.160] (-2210.169) (-2215.957) (-2210.563) * (-2212.725) (-2220.096) (-2217.186) [-2209.923] -- 0:01:43
614500 -- (-2208.421) [-2212.392] (-2210.519) (-2209.057) * (-2220.491) [-2214.630] (-2218.079) (-2211.188) -- 0:01:43
615000 -- (-2212.253) (-2213.828) [-2213.455] (-2217.750) * (-2217.629) (-2203.008) [-2207.832] (-2206.486) -- 0:01:43
Average standard deviation of split frequencies: 0.007594
615500 -- [-2212.192] (-2207.975) (-2206.852) (-2211.969) * [-2209.573] (-2216.842) (-2219.595) (-2214.549) -- 0:01:43
616000 -- (-2220.450) (-2210.184) (-2218.363) [-2219.231] * (-2211.839) [-2206.589] (-2209.373) (-2208.397) -- 0:01:42
616500 -- (-2211.886) (-2215.921) (-2214.604) [-2207.951] * [-2223.465] (-2212.371) (-2218.589) (-2217.845) -- 0:01:43
617000 -- (-2211.473) (-2209.758) [-2211.026] (-2203.201) * (-2229.872) [-2207.830] (-2222.911) (-2220.301) -- 0:01:43
617500 -- [-2207.200] (-2217.741) (-2214.254) (-2216.678) * [-2215.717] (-2219.985) (-2221.305) (-2218.462) -- 0:01:42
618000 -- (-2205.558) [-2211.440] (-2221.345) (-2224.083) * (-2227.006) (-2219.862) [-2217.778] (-2212.480) -- 0:01:42
618500 -- [-2207.542] (-2212.900) (-2217.778) (-2207.323) * (-2212.668) (-2214.036) [-2214.948] (-2215.247) -- 0:01:42
619000 -- (-2218.583) [-2207.107] (-2222.362) (-2213.438) * [-2205.514] (-2216.132) (-2220.501) (-2219.269) -- 0:01:42
619500 -- (-2204.009) [-2207.922] (-2231.323) (-2217.771) * [-2212.892] (-2208.824) (-2216.374) (-2219.112) -- 0:01:41
620000 -- [-2208.304] (-2213.060) (-2225.619) (-2224.250) * (-2224.016) (-2215.648) (-2213.590) [-2215.839] -- 0:01:41
Average standard deviation of split frequencies: 0.007887
620500 -- (-2209.839) [-2213.177] (-2228.185) (-2223.519) * (-2214.158) (-2214.002) [-2220.927] (-2212.281) -- 0:01:42
621000 -- [-2202.391] (-2211.166) (-2218.470) (-2224.401) * (-2219.874) [-2211.624] (-2219.384) (-2214.396) -- 0:01:41
621500 -- [-2215.187] (-2215.221) (-2218.538) (-2218.995) * [-2210.143] (-2219.882) (-2225.723) (-2221.146) -- 0:01:41
622000 -- (-2210.555) (-2210.160) (-2216.428) [-2206.860] * (-2216.974) (-2227.161) (-2218.486) [-2215.293] -- 0:01:41
622500 -- (-2211.498) (-2226.357) (-2217.569) [-2213.589] * [-2209.403] (-2227.252) (-2210.593) (-2208.338) -- 0:01:41
623000 -- (-2213.698) (-2223.735) [-2210.061] (-2210.629) * (-2214.796) (-2220.760) (-2217.196) [-2214.955] -- 0:01:41
623500 -- (-2207.869) (-2216.266) (-2220.172) [-2211.791] * [-2205.555] (-2212.434) (-2217.288) (-2221.235) -- 0:01:40
624000 -- (-2222.867) [-2206.864] (-2207.004) (-2213.635) * (-2207.006) (-2217.510) [-2215.345] (-2214.947) -- 0:01:41
624500 -- [-2218.960] (-2215.954) (-2222.449) (-2212.229) * (-2217.279) (-2225.020) (-2217.620) [-2211.766] -- 0:01:41
625000 -- (-2220.260) (-2216.965) (-2213.115) [-2207.975] * [-2213.334] (-2227.182) (-2208.758) (-2219.724) -- 0:01:40
Average standard deviation of split frequencies: 0.007994
625500 -- [-2213.281] (-2208.930) (-2218.464) (-2204.633) * (-2213.507) (-2214.817) [-2212.591] (-2213.694) -- 0:01:40
626000 -- (-2213.092) (-2211.484) [-2220.000] (-2223.794) * (-2218.100) (-2216.237) [-2208.910] (-2222.470) -- 0:01:40
626500 -- (-2217.818) [-2218.008] (-2211.917) (-2222.078) * (-2217.378) (-2212.769) [-2209.693] (-2208.695) -- 0:01:40
627000 -- (-2220.697) [-2213.407] (-2209.138) (-2219.709) * (-2209.102) (-2213.461) (-2209.791) [-2216.125] -- 0:01:39
627500 -- [-2215.042] (-2212.741) (-2220.842) (-2227.342) * (-2217.893) (-2208.346) (-2216.324) [-2217.619] -- 0:01:39
628000 -- (-2216.579) (-2215.491) [-2207.192] (-2224.268) * (-2229.832) (-2210.871) (-2213.745) [-2207.958] -- 0:01:40
628500 -- (-2211.637) (-2220.902) (-2211.996) [-2214.369] * (-2214.471) [-2216.608] (-2215.121) (-2212.446) -- 0:01:39
629000 -- (-2214.641) [-2205.915] (-2211.399) (-2218.697) * [-2215.696] (-2208.737) (-2228.503) (-2218.613) -- 0:01:39
629500 -- (-2214.072) (-2215.368) (-2217.800) [-2207.458] * (-2220.898) (-2220.689) (-2225.860) [-2205.093] -- 0:01:39
630000 -- (-2224.184) [-2211.165] (-2209.235) (-2220.897) * (-2216.083) [-2206.388] (-2219.729) (-2220.980) -- 0:01:39
Average standard deviation of split frequencies: 0.008337
630500 -- [-2210.104] (-2207.129) (-2210.227) (-2211.050) * (-2215.296) [-2211.397] (-2222.476) (-2218.832) -- 0:01:39
631000 -- [-2206.709] (-2215.822) (-2213.028) (-2213.360) * [-2214.830] (-2211.268) (-2219.787) (-2219.897) -- 0:01:38
631500 -- [-2209.980] (-2207.479) (-2234.660) (-2222.483) * (-2227.896) (-2204.763) [-2206.804] (-2204.095) -- 0:01:38
632000 -- (-2213.895) (-2219.946) [-2203.654] (-2215.190) * (-2215.644) (-2217.779) [-2207.098] (-2210.713) -- 0:01:38
632500 -- (-2213.327) (-2209.584) (-2218.303) [-2210.691] * [-2202.296] (-2215.239) (-2214.771) (-2230.320) -- 0:01:38
633000 -- (-2221.313) [-2219.473] (-2212.776) (-2210.384) * (-2210.731) (-2215.081) (-2217.360) [-2217.338] -- 0:01:38
633500 -- [-2205.680] (-2221.513) (-2225.359) (-2214.480) * (-2218.789) (-2211.726) [-2201.813] (-2217.477) -- 0:01:38
634000 -- (-2215.294) (-2215.368) (-2209.240) [-2210.574] * (-2219.269) (-2223.605) [-2207.189] (-2211.695) -- 0:01:38
634500 -- (-2215.286) (-2212.579) (-2212.001) [-2208.063] * (-2212.916) (-2228.986) (-2207.907) [-2220.762] -- 0:01:37
635000 -- (-2218.209) (-2214.857) (-2214.551) [-2214.417] * (-2214.913) (-2223.208) [-2214.671] (-2213.025) -- 0:01:37
Average standard deviation of split frequencies: 0.008609
635500 -- (-2221.122) (-2212.966) (-2214.493) [-2217.293] * [-2220.672] (-2218.170) (-2225.127) (-2209.937) -- 0:01:37
636000 -- [-2213.814] (-2217.834) (-2211.519) (-2207.113) * (-2218.124) (-2210.661) [-2208.698] (-2222.636) -- 0:01:37
636500 -- [-2216.883] (-2222.555) (-2210.986) (-2208.447) * (-2217.572) (-2212.130) (-2221.888) [-2208.748] -- 0:01:37
637000 -- (-2218.939) [-2208.016] (-2213.143) (-2206.427) * (-2207.165) (-2220.504) (-2217.435) [-2216.450] -- 0:01:37
637500 -- (-2221.225) (-2218.108) [-2217.117] (-2218.660) * (-2222.770) [-2208.561] (-2221.509) (-2218.352) -- 0:01:37
638000 -- (-2211.951) [-2209.274] (-2216.928) (-2217.874) * (-2207.773) (-2208.823) [-2210.975] (-2216.400) -- 0:01:37
638500 -- (-2215.356) (-2222.400) [-2210.795] (-2220.469) * (-2219.623) (-2215.856) (-2215.899) [-2232.051] -- 0:01:36
639000 -- (-2226.280) (-2211.195) [-2220.042] (-2219.551) * (-2215.013) (-2223.931) (-2212.088) [-2208.975] -- 0:01:36
639500 -- (-2207.926) (-2219.435) (-2213.793) [-2219.168] * [-2215.293] (-2229.100) (-2209.328) (-2218.776) -- 0:01:36
640000 -- (-2221.078) [-2209.453] (-2208.876) (-2215.314) * (-2214.340) (-2220.722) (-2224.798) [-2208.607] -- 0:01:36
Average standard deviation of split frequencies: 0.008773
640500 -- (-2217.298) (-2207.155) (-2220.412) [-2210.419] * (-2214.325) (-2217.699) (-2214.962) [-2212.654] -- 0:01:36
641000 -- (-2213.223) (-2216.621) (-2208.705) [-2214.711] * [-2207.060] (-2217.011) (-2206.223) (-2214.523) -- 0:01:36
641500 -- (-2219.955) (-2226.238) (-2204.538) [-2212.341] * [-2217.814] (-2212.229) (-2211.538) (-2225.055) -- 0:01:36
642000 -- (-2217.730) [-2207.008] (-2213.730) (-2206.260) * (-2213.933) [-2207.313] (-2203.488) (-2210.868) -- 0:01:35
642500 -- (-2209.023) (-2206.057) (-2215.102) [-2212.374] * (-2218.850) [-2204.182] (-2207.927) (-2214.898) -- 0:01:35
643000 -- [-2211.498] (-2211.841) (-2218.342) (-2207.582) * (-2209.614) [-2205.401] (-2219.645) (-2211.055) -- 0:01:35
643500 -- (-2205.998) [-2215.049] (-2217.012) (-2209.631) * (-2218.456) [-2215.021] (-2210.922) (-2221.387) -- 0:01:35
644000 -- [-2212.091] (-2208.076) (-2209.099) (-2219.411) * [-2206.874] (-2217.162) (-2210.673) (-2211.076) -- 0:01:35
644500 -- (-2210.421) [-2208.755] (-2209.015) (-2215.070) * (-2225.962) [-2209.543] (-2210.368) (-2223.210) -- 0:01:35
645000 -- (-2220.058) (-2213.284) [-2212.572] (-2213.096) * (-2218.519) [-2213.149] (-2227.088) (-2210.427) -- 0:01:35
Average standard deviation of split frequencies: 0.008532
645500 -- [-2205.944] (-2214.226) (-2212.297) (-2219.734) * [-2212.183] (-2214.412) (-2217.148) (-2213.807) -- 0:01:35
646000 -- (-2212.921) (-2215.240) (-2216.901) [-2217.419] * (-2208.575) (-2217.506) (-2217.074) [-2209.546] -- 0:01:34
646500 -- (-2214.368) [-2210.145] (-2210.093) (-2219.037) * (-2205.331) (-2211.947) [-2217.351] (-2209.015) -- 0:01:34
647000 -- (-2219.764) (-2210.055) (-2207.676) [-2216.238] * (-2215.818) (-2224.588) (-2211.522) [-2219.483] -- 0:01:34
647500 -- [-2217.627] (-2215.757) (-2209.258) (-2226.269) * [-2212.383] (-2215.779) (-2209.436) (-2216.573) -- 0:01:34
648000 -- (-2209.690) (-2225.184) (-2208.288) [-2210.498] * (-2207.278) [-2210.313] (-2215.465) (-2209.686) -- 0:01:34
648500 -- (-2216.880) [-2208.346] (-2212.878) (-2211.458) * [-2207.265] (-2212.098) (-2209.968) (-2218.618) -- 0:01:34
649000 -- (-2218.907) (-2217.493) [-2208.034] (-2208.161) * (-2210.396) [-2211.044] (-2217.488) (-2219.398) -- 0:01:34
649500 -- (-2203.615) (-2218.406) [-2205.346] (-2215.642) * [-2210.299] (-2222.788) (-2214.024) (-2218.964) -- 0:01:33
650000 -- [-2207.242] (-2208.240) (-2212.398) (-2205.319) * (-2216.491) [-2206.783] (-2216.000) (-2214.412) -- 0:01:33
Average standard deviation of split frequencies: 0.008582
650500 -- (-2224.633) (-2211.412) (-2221.511) [-2211.991] * [-2215.019] (-2221.572) (-2212.871) (-2211.409) -- 0:01:33
651000 -- (-2208.253) (-2210.371) (-2217.761) [-2218.560] * (-2223.047) [-2210.995] (-2208.273) (-2218.233) -- 0:01:33
651500 -- [-2217.244] (-2211.961) (-2216.559) (-2213.083) * (-2212.643) (-2214.580) [-2211.038] (-2218.290) -- 0:01:33
652000 -- (-2216.555) (-2209.605) (-2231.802) [-2209.415] * (-2221.974) (-2209.791) (-2212.128) [-2212.088] -- 0:01:33
652500 -- (-2211.589) (-2222.207) [-2206.371] (-2224.877) * (-2213.886) (-2209.530) [-2209.405] (-2208.851) -- 0:01:33
653000 -- (-2225.966) [-2219.780] (-2220.188) (-2208.084) * [-2208.010] (-2211.800) (-2216.608) (-2207.448) -- 0:01:32
653500 -- (-2219.755) (-2224.253) (-2216.593) [-2209.782] * (-2208.882) (-2212.250) (-2214.639) [-2216.232] -- 0:01:32
654000 -- (-2211.172) (-2215.723) [-2209.246] (-2210.591) * (-2213.930) (-2211.732) [-2214.303] (-2212.980) -- 0:01:32
654500 -- (-2218.422) [-2212.914] (-2219.116) (-2209.633) * (-2213.746) [-2206.581] (-2212.816) (-2216.082) -- 0:01:32
655000 -- (-2208.573) (-2200.689) (-2226.033) [-2209.677] * (-2214.534) [-2216.941] (-2210.167) (-2207.889) -- 0:01:32
Average standard deviation of split frequencies: 0.008457
655500 -- [-2213.030] (-2214.781) (-2217.595) (-2208.897) * (-2221.697) (-2212.914) (-2222.336) [-2208.914] -- 0:01:31
656000 -- (-2216.276) [-2213.407] (-2228.766) (-2215.837) * (-2220.365) (-2219.954) (-2220.948) [-2224.628] -- 0:01:32
656500 -- [-2205.502] (-2213.302) (-2216.880) (-2214.364) * (-2219.116) [-2212.474] (-2213.130) (-2213.370) -- 0:01:32
657000 -- (-2206.814) (-2205.160) (-2218.822) [-2219.396] * (-2227.114) (-2211.099) [-2211.979] (-2215.997) -- 0:01:31
657500 -- (-2217.188) (-2228.403) (-2214.172) [-2214.160] * (-2215.801) [-2207.243] (-2217.660) (-2214.635) -- 0:01:31
658000 -- [-2202.470] (-2217.728) (-2220.016) (-2216.441) * (-2221.585) (-2223.561) [-2213.671] (-2207.811) -- 0:01:31
658500 -- (-2220.544) (-2212.518) [-2203.420] (-2217.463) * (-2216.407) (-2215.059) (-2220.541) [-2209.987] -- 0:01:31
659000 -- (-2208.362) (-2209.176) (-2212.882) [-2215.432] * [-2208.487] (-2215.982) (-2213.981) (-2221.942) -- 0:01:31
659500 -- (-2210.695) (-2213.328) (-2218.385) [-2201.866] * (-2215.968) (-2208.853) [-2205.993] (-2221.343) -- 0:01:30
660000 -- [-2211.952] (-2220.802) (-2211.227) (-2220.755) * (-2222.086) (-2217.653) [-2206.850] (-2220.562) -- 0:01:31
Average standard deviation of split frequencies: 0.008233
660500 -- (-2219.660) [-2229.043] (-2208.508) (-2213.937) * (-2224.083) [-2217.426] (-2214.021) (-2218.552) -- 0:01:30
661000 -- (-2200.707) (-2212.143) [-2206.931] (-2211.704) * (-2214.671) (-2210.840) [-2205.574] (-2221.335) -- 0:01:30
661500 -- [-2220.311] (-2210.618) (-2207.901) (-2224.410) * (-2214.604) (-2223.928) [-2213.889] (-2222.819) -- 0:01:30
662000 -- (-2214.228) [-2212.099] (-2208.189) (-2215.052) * (-2208.826) (-2206.984) [-2205.287] (-2211.964) -- 0:01:30
662500 -- (-2223.507) [-2209.704] (-2215.849) (-2216.532) * (-2218.333) [-2217.275] (-2219.526) (-2226.993) -- 0:01:30
663000 -- [-2215.169] (-2210.482) (-2204.690) (-2218.023) * (-2217.822) (-2214.373) (-2217.978) [-2208.369] -- 0:01:29
663500 -- (-2211.809) [-2219.905] (-2214.469) (-2209.412) * (-2222.042) [-2214.682] (-2216.606) (-2216.122) -- 0:01:29
664000 -- (-2225.087) (-2219.464) (-2221.642) [-2211.950] * (-2215.883) (-2221.104) [-2214.043] (-2213.566) -- 0:01:29
664500 -- (-2207.816) [-2209.850] (-2222.981) (-2219.332) * (-2221.457) [-2215.823] (-2212.091) (-2216.902) -- 0:01:29
665000 -- (-2208.242) (-2216.658) [-2207.630] (-2213.803) * (-2213.935) [-2216.237] (-2227.945) (-2222.800) -- 0:01:29
Average standard deviation of split frequencies: 0.008330
665500 -- (-2215.436) (-2210.143) [-2204.630] (-2210.012) * (-2211.944) [-2208.744] (-2206.069) (-2216.634) -- 0:01:29
666000 -- [-2206.786] (-2228.012) (-2215.084) (-2211.035) * (-2211.285) (-2214.850) [-2210.254] (-2215.673) -- 0:01:29
666500 -- (-2210.901) (-2227.778) (-2220.647) [-2208.497] * (-2212.484) [-2213.335] (-2210.633) (-2214.496) -- 0:01:29
667000 -- (-2215.425) (-2225.400) (-2223.299) [-2206.183] * (-2218.066) (-2218.915) [-2213.437] (-2216.915) -- 0:01:28
667500 -- [-2207.053] (-2205.818) (-2222.375) (-2220.669) * (-2225.414) (-2208.195) (-2213.211) [-2218.244] -- 0:01:28
668000 -- (-2220.382) (-2217.034) [-2216.384] (-2210.281) * (-2208.517) [-2222.393] (-2228.744) (-2208.738) -- 0:01:28
668500 -- (-2209.294) (-2218.571) [-2207.113] (-2227.590) * (-2213.332) (-2210.998) [-2214.172] (-2212.158) -- 0:01:28
669000 -- (-2211.164) [-2211.883] (-2206.976) (-2208.533) * (-2213.918) (-2230.768) [-2217.428] (-2218.611) -- 0:01:28
669500 -- [-2217.955] (-2206.170) (-2206.026) (-2213.766) * (-2210.999) [-2216.105] (-2218.568) (-2224.134) -- 0:01:28
670000 -- (-2223.282) (-2215.682) [-2208.403] (-2213.948) * [-2215.385] (-2211.882) (-2219.143) (-2213.864) -- 0:01:28
Average standard deviation of split frequencies: 0.008651
670500 -- (-2210.748) (-2219.746) [-2207.912] (-2208.632) * (-2210.759) (-2221.372) [-2215.616] (-2212.590) -- 0:01:27
671000 -- (-2216.356) (-2205.111) [-2211.043] (-2213.075) * (-2213.811) (-2220.758) (-2213.630) [-2209.821] -- 0:01:27
671500 -- (-2228.622) [-2207.920] (-2213.754) (-2209.347) * (-2211.094) (-2219.053) (-2218.521) [-2208.011] -- 0:01:27
672000 -- (-2223.310) (-2213.697) (-2207.707) [-2221.667] * (-2214.403) (-2222.474) [-2218.002] (-2224.057) -- 0:01:27
672500 -- (-2215.978) (-2220.252) [-2211.267] (-2202.500) * (-2210.372) (-2211.784) [-2213.167] (-2218.304) -- 0:01:27
673000 -- (-2217.762) (-2209.833) [-2213.730] (-2217.477) * [-2214.173] (-2214.018) (-2213.693) (-2212.091) -- 0:01:27
673500 -- (-2217.080) [-2208.432] (-2216.413) (-2217.911) * (-2213.678) (-2212.709) (-2222.828) [-2216.049] -- 0:01:27
674000 -- (-2219.338) [-2208.533] (-2224.511) (-2205.519) * (-2210.959) (-2216.983) [-2207.753] (-2222.310) -- 0:01:27
674500 -- (-2214.109) (-2213.967) (-2224.407) [-2204.088] * (-2214.138) (-2217.513) [-2215.255] (-2214.272) -- 0:01:26
675000 -- (-2233.851) (-2210.218) (-2214.569) [-2204.448] * (-2215.676) [-2207.892] (-2216.190) (-2220.306) -- 0:01:26
Average standard deviation of split frequencies: 0.008690
675500 -- (-2205.489) [-2210.248] (-2225.019) (-2213.310) * (-2220.561) [-2213.849] (-2213.561) (-2213.748) -- 0:01:26
676000 -- (-2210.981) (-2209.155) (-2202.880) [-2211.707] * [-2213.659] (-2216.613) (-2211.709) (-2206.843) -- 0:01:26
676500 -- [-2219.781] (-2215.905) (-2218.988) (-2216.030) * (-2215.342) (-2213.028) [-2215.999] (-2229.353) -- 0:01:26
677000 -- (-2221.276) (-2208.583) [-2215.193] (-2217.446) * (-2217.334) (-2212.152) (-2210.370) [-2209.329] -- 0:01:26
677500 -- (-2220.095) (-2217.061) [-2214.938] (-2215.553) * [-2209.980] (-2211.955) (-2215.286) (-2212.134) -- 0:01:26
678000 -- (-2213.468) [-2220.866] (-2219.300) (-2210.698) * (-2211.203) [-2211.132] (-2210.581) (-2207.628) -- 0:01:25
678500 -- (-2212.699) (-2218.738) (-2218.464) [-2211.273] * [-2210.641] (-2229.396) (-2216.342) (-2211.388) -- 0:01:25
679000 -- [-2218.822] (-2214.731) (-2209.060) (-2217.706) * (-2218.625) (-2225.784) [-2205.932] (-2215.694) -- 0:01:25
679500 -- [-2221.461] (-2214.790) (-2212.681) (-2226.171) * [-2211.556] (-2212.392) (-2215.585) (-2219.862) -- 0:01:25
680000 -- [-2216.971] (-2215.839) (-2204.830) (-2220.210) * (-2220.914) [-2214.869] (-2211.229) (-2209.101) -- 0:01:25
Average standard deviation of split frequencies: 0.008684
680500 -- (-2213.223) (-2231.208) [-2216.262] (-2205.483) * (-2211.180) (-2215.004) (-2223.192) [-2219.312] -- 0:01:25
681000 -- [-2209.294] (-2216.397) (-2223.331) (-2219.943) * (-2208.081) (-2215.607) (-2215.465) [-2215.054] -- 0:01:25
681500 -- (-2214.863) (-2211.239) (-2219.531) [-2207.600] * (-2217.113) [-2234.429] (-2214.630) (-2225.555) -- 0:01:25
682000 -- [-2212.066] (-2217.565) (-2219.646) (-2215.925) * [-2213.724] (-2224.883) (-2213.418) (-2221.008) -- 0:01:24
682500 -- (-2212.260) (-2225.899) (-2216.698) [-2218.398] * (-2229.618) [-2211.490] (-2219.679) (-2213.516) -- 0:01:24
683000 -- (-2228.366) (-2211.249) [-2206.942] (-2213.182) * (-2213.837) (-2213.081) (-2229.282) [-2211.181] -- 0:01:24
683500 -- (-2216.437) [-2209.879] (-2221.431) (-2212.117) * (-2207.700) (-2229.588) (-2225.951) [-2211.672] -- 0:01:24
684000 -- (-2228.956) (-2208.073) [-2203.225] (-2214.824) * [-2205.096] (-2209.936) (-2217.855) (-2214.854) -- 0:01:24
684500 -- (-2209.943) (-2206.636) [-2203.769] (-2210.284) * (-2216.807) [-2215.173] (-2220.655) (-2207.913) -- 0:01:24
685000 -- [-2212.459] (-2209.964) (-2215.706) (-2216.814) * [-2212.360] (-2230.496) (-2227.541) (-2215.143) -- 0:01:24
Average standard deviation of split frequencies: 0.008352
685500 -- (-2209.693) (-2219.019) [-2207.597] (-2220.192) * [-2209.488] (-2208.104) (-2213.858) (-2209.731) -- 0:01:23
686000 -- (-2209.533) [-2210.909] (-2215.392) (-2219.159) * [-2211.040] (-2217.356) (-2218.134) (-2209.996) -- 0:01:23
686500 -- [-2209.533] (-2212.087) (-2208.901) (-2215.505) * (-2209.383) (-2208.891) (-2208.722) [-2217.035] -- 0:01:23
687000 -- (-2214.771) (-2208.477) [-2203.893] (-2223.924) * [-2215.579] (-2209.939) (-2222.045) (-2213.864) -- 0:01:23
687500 -- (-2218.557) (-2203.163) (-2212.885) [-2207.315] * (-2209.053) (-2213.610) (-2212.353) [-2210.614] -- 0:01:23
688000 -- (-2218.104) (-2219.570) (-2204.846) [-2217.938] * (-2223.788) (-2213.833) [-2211.529] (-2221.259) -- 0:01:22
688500 -- (-2210.387) (-2215.293) [-2207.717] (-2228.580) * (-2214.200) (-2215.173) [-2207.938] (-2222.547) -- 0:01:23
689000 -- [-2212.993] (-2217.133) (-2209.751) (-2220.937) * (-2223.870) (-2217.336) [-2210.862] (-2212.026) -- 0:01:23
689500 -- (-2210.649) (-2220.761) [-2213.842] (-2222.869) * [-2209.782] (-2210.444) (-2217.469) (-2213.708) -- 0:01:22
690000 -- (-2205.536) [-2209.136] (-2215.521) (-2218.200) * (-2206.640) (-2221.938) [-2209.284] (-2214.410) -- 0:01:22
Average standard deviation of split frequencies: 0.008138
690500 -- [-2214.278] (-2212.897) (-2206.737) (-2215.424) * [-2207.897] (-2213.913) (-2212.952) (-2209.907) -- 0:01:22
691000 -- (-2212.660) [-2214.592] (-2215.036) (-2225.001) * [-2205.305] (-2223.798) (-2217.818) (-2213.791) -- 0:01:22
691500 -- [-2207.731] (-2218.487) (-2213.188) (-2216.070) * [-2206.876] (-2225.496) (-2222.884) (-2221.049) -- 0:01:22
692000 -- [-2211.337] (-2210.764) (-2211.421) (-2220.726) * (-2216.773) (-2212.908) [-2211.125] (-2214.420) -- 0:01:21
692500 -- (-2214.736) (-2213.600) (-2215.932) [-2211.589] * (-2216.101) (-2217.068) [-2211.043] (-2208.621) -- 0:01:22
693000 -- (-2215.570) (-2223.912) (-2219.966) [-2221.382] * [-2210.146] (-2215.252) (-2219.309) (-2228.233) -- 0:01:21
693500 -- [-2219.506] (-2220.978) (-2208.507) (-2217.391) * [-2217.900] (-2224.559) (-2218.468) (-2215.158) -- 0:01:21
694000 -- [-2210.651] (-2224.075) (-2211.284) (-2221.623) * [-2223.452] (-2222.157) (-2216.853) (-2219.780) -- 0:01:21
694500 -- (-2210.800) [-2215.707] (-2216.578) (-2219.408) * (-2215.809) (-2222.670) [-2214.150] (-2210.039) -- 0:01:21
695000 -- (-2223.483) (-2210.246) (-2212.130) [-2213.749] * (-2214.860) (-2215.145) [-2211.312] (-2213.592) -- 0:01:21
Average standard deviation of split frequencies: 0.008701
695500 -- (-2221.795) [-2204.885] (-2213.939) (-2211.174) * (-2219.765) (-2214.860) [-2214.077] (-2220.226) -- 0:01:20
696000 -- (-2214.863) (-2211.544) (-2211.255) [-2210.143] * (-2211.817) (-2219.173) (-2208.640) [-2208.321] -- 0:01:20
696500 -- [-2204.422] (-2214.580) (-2216.407) (-2218.275) * (-2213.574) (-2212.635) (-2225.982) [-2209.854] -- 0:01:21
697000 -- [-2212.371] (-2210.527) (-2213.950) (-2209.871) * [-2208.208] (-2214.834) (-2210.826) (-2226.463) -- 0:01:20
697500 -- [-2217.423] (-2232.174) (-2216.239) (-2215.072) * (-2210.084) (-2219.247) [-2212.005] (-2220.813) -- 0:01:20
698000 -- [-2213.667] (-2215.155) (-2224.710) (-2211.161) * (-2215.217) [-2218.239] (-2222.559) (-2219.503) -- 0:01:20
698500 -- (-2215.938) [-2215.635] (-2218.026) (-2204.172) * [-2211.593] (-2210.717) (-2218.919) (-2211.307) -- 0:01:20
699000 -- [-2209.033] (-2215.304) (-2230.239) (-2216.246) * (-2207.646) [-2217.910] (-2227.861) (-2233.018) -- 0:01:20
699500 -- (-2212.452) (-2214.530) [-2217.963] (-2210.336) * [-2205.618] (-2206.037) (-2232.247) (-2220.445) -- 0:01:19
700000 -- (-2216.570) (-2215.124) (-2217.566) [-2211.966] * (-2212.832) (-2209.055) (-2238.467) [-2213.398] -- 0:01:19
Average standard deviation of split frequencies: 0.008074
700500 -- (-2204.199) [-2211.565] (-2224.210) (-2213.856) * [-2211.609] (-2217.349) (-2219.483) (-2213.751) -- 0:01:19
701000 -- [-2216.182] (-2216.153) (-2221.134) (-2209.137) * (-2223.763) (-2205.331) (-2222.761) [-2212.929] -- 0:01:19
701500 -- (-2215.423) (-2224.232) [-2216.535] (-2208.974) * (-2207.947) (-2210.288) (-2223.319) [-2207.678] -- 0:01:19
702000 -- (-2214.295) (-2219.274) (-2214.954) [-2208.975] * [-2213.141] (-2215.226) (-2221.289) (-2208.851) -- 0:01:19
702500 -- (-2229.028) (-2218.018) (-2214.168) [-2206.239] * [-2213.034] (-2210.282) (-2226.577) (-2213.073) -- 0:01:19
703000 -- (-2216.905) [-2220.707] (-2223.912) (-2214.622) * (-2209.558) (-2218.405) [-2208.652] (-2218.199) -- 0:01:19
703500 -- (-2210.041) (-2220.648) (-2224.378) [-2213.442] * (-2207.516) (-2219.602) [-2208.997] (-2224.346) -- 0:01:18
704000 -- (-2207.636) (-2214.490) (-2219.599) [-2230.357] * [-2220.350] (-2216.990) (-2226.704) (-2218.766) -- 0:01:18
704500 -- (-2213.284) (-2220.072) [-2204.129] (-2226.278) * (-2206.712) (-2212.472) (-2218.733) [-2209.708] -- 0:01:18
705000 -- (-2226.575) (-2216.204) (-2217.940) [-2206.638] * [-2226.071] (-2211.267) (-2221.666) (-2218.470) -- 0:01:18
Average standard deviation of split frequencies: 0.007345
705500 -- (-2221.298) (-2220.560) (-2209.609) [-2213.864] * [-2208.808] (-2217.025) (-2215.084) (-2219.558) -- 0:01:18
706000 -- (-2224.854) (-2210.046) (-2222.400) [-2209.970] * (-2220.791) (-2219.338) (-2209.315) [-2214.255] -- 0:01:18
706500 -- (-2214.323) [-2206.146] (-2215.971) (-2221.805) * [-2209.576] (-2207.578) (-2208.078) (-2203.682) -- 0:01:18
707000 -- (-2207.904) (-2213.424) [-2209.634] (-2227.516) * (-2208.624) (-2212.031) [-2215.769] (-2209.362) -- 0:01:17
707500 -- (-2220.152) [-2216.584] (-2220.209) (-2215.994) * (-2208.439) (-2215.858) (-2204.616) [-2213.979] -- 0:01:17
708000 -- (-2221.170) [-2213.966] (-2222.537) (-2217.133) * (-2209.615) (-2217.234) (-2212.095) [-2214.849] -- 0:01:17
708500 -- (-2209.645) (-2210.848) (-2208.999) [-2207.208] * (-2214.861) [-2226.584] (-2211.202) (-2220.421) -- 0:01:17
709000 -- (-2217.209) [-2218.626] (-2219.794) (-2211.141) * (-2218.033) (-2238.894) [-2207.381] (-2204.706) -- 0:01:17
709500 -- (-2210.646) (-2220.311) (-2207.979) [-2217.421] * (-2221.562) [-2213.074] (-2218.213) (-2223.341) -- 0:01:17
710000 -- (-2211.192) (-2215.404) (-2206.879) [-2207.284] * [-2214.377] (-2219.497) (-2215.222) (-2207.116) -- 0:01:17
Average standard deviation of split frequencies: 0.007144
710500 -- (-2212.819) (-2217.609) (-2208.911) [-2210.168] * [-2208.604] (-2218.413) (-2218.679) (-2214.864) -- 0:01:17
711000 -- (-2222.745) (-2217.465) (-2216.332) [-2210.437] * [-2210.941] (-2219.794) (-2215.025) (-2225.483) -- 0:01:16
711500 -- (-2220.847) (-2217.114) [-2213.173] (-2218.460) * [-2211.840] (-2213.601) (-2221.152) (-2214.309) -- 0:01:16
712000 -- (-2217.882) [-2207.132] (-2212.299) (-2218.902) * [-2209.970] (-2221.768) (-2219.657) (-2216.211) -- 0:01:16
712500 -- [-2217.265] (-2209.615) (-2216.573) (-2208.610) * (-2213.162) (-2222.716) [-2205.926] (-2217.394) -- 0:01:16
713000 -- (-2223.718) [-2207.047] (-2219.517) (-2215.234) * (-2224.362) [-2210.229] (-2207.225) (-2208.748) -- 0:01:16
713500 -- (-2224.661) [-2208.873] (-2210.821) (-2214.001) * (-2234.894) (-2218.482) (-2211.166) [-2209.464] -- 0:01:16
714000 -- (-2211.728) (-2206.362) [-2211.335] (-2218.888) * (-2223.558) (-2208.082) [-2211.568] (-2219.404) -- 0:01:16
714500 -- (-2221.601) (-2209.703) (-2211.585) [-2213.780] * (-2220.171) (-2216.296) [-2208.040] (-2208.569) -- 0:01:15
715000 -- (-2214.426) (-2208.095) [-2209.269] (-2222.351) * (-2220.713) [-2219.416] (-2211.293) (-2209.816) -- 0:01:15
Average standard deviation of split frequencies: 0.006938
715500 -- (-2211.990) (-2212.190) [-2217.590] (-2236.474) * (-2222.436) [-2211.997] (-2212.595) (-2213.337) -- 0:01:15
716000 -- [-2216.949] (-2206.970) (-2217.547) (-2229.497) * (-2212.344) (-2215.136) [-2212.582] (-2224.716) -- 0:01:15
716500 -- [-2209.434] (-2209.783) (-2216.442) (-2227.793) * [-2213.496] (-2210.129) (-2218.047) (-2224.380) -- 0:01:15
717000 -- (-2210.269) [-2211.104] (-2219.019) (-2223.413) * (-2221.906) (-2224.993) [-2210.374] (-2224.897) -- 0:01:15
717500 -- [-2207.618] (-2205.320) (-2211.931) (-2224.067) * (-2219.130) (-2209.862) [-2203.767] (-2209.586) -- 0:01:15
718000 -- (-2210.271) (-2211.981) (-2224.190) [-2210.505] * (-2217.932) [-2207.301] (-2207.057) (-2215.219) -- 0:01:15
718500 -- [-2213.036] (-2216.409) (-2216.455) (-2216.778) * (-2205.410) [-2214.400] (-2212.211) (-2217.246) -- 0:01:14
719000 -- (-2217.645) [-2218.018] (-2231.672) (-2216.784) * [-2206.445] (-2210.724) (-2207.867) (-2211.221) -- 0:01:14
719500 -- [-2213.578] (-2212.238) (-2214.694) (-2212.922) * [-2210.737] (-2215.739) (-2214.274) (-2225.683) -- 0:01:14
720000 -- (-2219.650) [-2205.343] (-2212.601) (-2207.149) * [-2211.708] (-2208.644) (-2213.614) (-2226.368) -- 0:01:14
Average standard deviation of split frequencies: 0.006491
720500 -- (-2207.451) [-2213.323] (-2214.952) (-2210.544) * [-2219.213] (-2216.996) (-2214.737) (-2219.070) -- 0:01:14
721000 -- (-2219.968) (-2210.547) (-2210.837) [-2213.553] * [-2210.385] (-2207.366) (-2204.196) (-2222.275) -- 0:01:14
721500 -- (-2212.481) (-2222.544) (-2212.544) [-2211.497] * (-2212.194) (-2211.638) (-2209.275) [-2203.555] -- 0:01:14
722000 -- (-2208.980) (-2220.074) (-2213.308) [-2212.794] * (-2234.993) (-2210.734) [-2211.853] (-2211.544) -- 0:01:13
722500 -- (-2212.413) [-2209.054] (-2206.403) (-2216.213) * (-2217.660) (-2206.937) (-2216.384) [-2209.498] -- 0:01:13
723000 -- (-2222.756) (-2212.139) (-2201.398) [-2213.149] * (-2207.349) (-2211.757) (-2229.242) [-2214.902] -- 0:01:13
723500 -- (-2224.578) (-2218.938) [-2205.630] (-2210.374) * (-2214.120) (-2219.474) (-2230.309) [-2206.310] -- 0:01:13
724000 -- (-2217.016) (-2217.236) [-2205.772] (-2218.963) * [-2211.539] (-2215.794) (-2228.101) (-2217.948) -- 0:01:13
724500 -- [-2209.424] (-2218.070) (-2214.257) (-2214.624) * (-2215.055) [-2210.209] (-2222.677) (-2209.924) -- 0:01:13
725000 -- (-2214.696) (-2216.061) (-2214.732) [-2210.034] * (-2210.312) (-2211.114) [-2212.663] (-2219.695) -- 0:01:13
Average standard deviation of split frequencies: 0.006144
725500 -- (-2216.989) (-2211.653) [-2214.449] (-2230.318) * (-2223.092) (-2224.557) (-2221.938) [-2208.539] -- 0:01:13
726000 -- (-2225.293) (-2217.390) [-2211.676] (-2214.887) * (-2228.306) [-2214.850] (-2225.957) (-2207.945) -- 0:01:12
726500 -- [-2221.465] (-2208.329) (-2207.686) (-2212.630) * [-2212.259] (-2229.030) (-2223.725) (-2211.849) -- 0:01:12
727000 -- [-2210.800] (-2223.475) (-2217.243) (-2218.691) * (-2214.826) [-2217.048] (-2222.363) (-2206.241) -- 0:01:12
727500 -- (-2218.599) [-2219.418] (-2214.885) (-2209.652) * (-2219.421) [-2215.241] (-2213.677) (-2213.693) -- 0:01:12
728000 -- (-2214.555) (-2231.319) [-2207.527] (-2214.413) * [-2205.808] (-2222.901) (-2218.284) (-2208.301) -- 0:01:12
728500 -- [-2214.425] (-2221.357) (-2215.632) (-2219.605) * (-2214.627) [-2212.077] (-2210.895) (-2219.219) -- 0:01:12
729000 -- (-2211.777) (-2217.234) (-2221.263) [-2215.388] * (-2215.049) (-2215.645) (-2219.156) [-2213.556] -- 0:01:12
729500 -- [-2216.140] (-2209.188) (-2230.046) (-2221.826) * (-2217.149) (-2218.184) (-2217.444) [-2211.470] -- 0:01:11
730000 -- (-2208.566) (-2218.116) (-2210.830) [-2211.650] * [-2213.705] (-2228.726) (-2224.563) (-2224.275) -- 0:01:11
Average standard deviation of split frequencies: 0.006352
730500 -- (-2213.639) (-2230.696) [-2212.703] (-2213.605) * (-2216.486) (-2216.848) [-2214.396] (-2210.560) -- 0:01:11
731000 -- (-2232.993) (-2213.810) [-2210.568] (-2219.663) * (-2222.818) (-2216.413) (-2203.158) [-2209.365] -- 0:01:11
731500 -- (-2217.634) (-2208.233) [-2209.610] (-2217.981) * (-2214.646) (-2221.639) (-2210.027) [-2208.300] -- 0:01:11
732000 -- [-2204.344] (-2219.888) (-2231.198) (-2218.639) * (-2225.031) (-2220.687) (-2210.848) [-2207.945] -- 0:01:11
732500 -- (-2219.595) (-2215.207) (-2223.293) [-2206.775] * (-2222.857) (-2210.185) (-2220.543) [-2212.093] -- 0:01:11
733000 -- [-2214.298] (-2210.802) (-2215.597) (-2210.824) * (-2218.858) [-2211.628] (-2213.067) (-2205.563) -- 0:01:11
733500 -- (-2218.138) (-2216.749) [-2212.298] (-2207.453) * [-2211.501] (-2213.083) (-2225.558) (-2205.343) -- 0:01:10
734000 -- (-2223.911) (-2220.111) (-2207.443) [-2208.830] * (-2209.951) (-2206.501) (-2217.159) [-2209.096] -- 0:01:10
734500 -- (-2224.404) (-2208.427) [-2205.176] (-2207.523) * [-2205.886] (-2218.821) (-2229.386) (-2211.007) -- 0:01:10
735000 -- (-2217.201) (-2217.989) (-2222.525) [-2212.032] * (-2212.399) (-2212.001) (-2214.841) [-2223.323] -- 0:01:10
Average standard deviation of split frequencies: 0.006011
735500 -- (-2218.798) [-2214.192] (-2216.189) (-2214.053) * (-2210.987) [-2211.838] (-2221.384) (-2213.909) -- 0:01:10
736000 -- (-2232.136) [-2209.746] (-2213.853) (-2215.682) * [-2210.015] (-2218.409) (-2210.868) (-2214.544) -- 0:01:09
736500 -- (-2223.670) (-2213.235) [-2213.109] (-2220.915) * (-2221.092) [-2214.387] (-2215.421) (-2210.656) -- 0:01:10
737000 -- (-2210.554) [-2208.309] (-2209.726) (-2215.090) * (-2222.310) (-2209.337) [-2216.935] (-2220.501) -- 0:01:09
737500 -- [-2215.177] (-2205.503) (-2208.959) (-2226.001) * (-2205.949) (-2215.198) (-2216.698) [-2210.035] -- 0:01:09
738000 -- (-2216.621) (-2214.123) [-2215.038] (-2233.201) * (-2215.892) (-2215.775) (-2212.843) [-2212.162] -- 0:01:09
738500 -- (-2210.159) [-2211.048] (-2205.494) (-2238.927) * (-2213.887) (-2209.620) (-2214.823) [-2207.957] -- 0:01:09
739000 -- [-2205.148] (-2213.342) (-2222.405) (-2212.300) * (-2217.799) (-2217.341) [-2210.066] (-2204.949) -- 0:01:09
739500 -- (-2207.744) [-2216.050] (-2208.056) (-2209.882) * (-2209.399) [-2212.467] (-2208.042) (-2213.351) -- 0:01:09
740000 -- (-2211.308) (-2219.895) [-2210.702] (-2214.875) * [-2219.559] (-2218.645) (-2206.293) (-2210.980) -- 0:01:08
Average standard deviation of split frequencies: 0.006169
740500 -- [-2216.687] (-2213.731) (-2212.953) (-2211.012) * (-2212.807) (-2211.207) (-2215.730) [-2212.643] -- 0:01:09
741000 -- (-2224.346) (-2221.863) (-2218.290) [-2205.843] * (-2211.860) (-2207.346) (-2217.833) [-2210.912] -- 0:01:08
741500 -- (-2219.501) [-2211.706] (-2218.423) (-2201.747) * (-2205.331) (-2202.928) (-2206.830) [-2211.963] -- 0:01:08
742000 -- (-2211.978) (-2214.237) [-2218.356] (-2211.951) * [-2215.905] (-2211.926) (-2232.938) (-2213.777) -- 0:01:08
742500 -- (-2209.622) (-2211.116) [-2208.460] (-2214.128) * (-2217.256) (-2207.650) (-2227.382) [-2217.150] -- 0:01:08
743000 -- [-2210.784] (-2222.128) (-2210.305) (-2204.793) * [-2217.601] (-2221.384) (-2213.754) (-2207.882) -- 0:01:08
743500 -- (-2216.683) (-2218.267) (-2212.231) [-2209.904] * [-2206.075] (-2214.946) (-2215.379) (-2212.574) -- 0:01:07
744000 -- (-2220.314) (-2217.980) [-2205.161] (-2219.109) * (-2224.333) (-2223.922) (-2213.182) [-2215.986] -- 0:01:07
744500 -- (-2219.261) (-2229.785) [-2211.467] (-2221.412) * [-2210.350] (-2219.174) (-2212.124) (-2219.388) -- 0:01:07
745000 -- [-2208.396] (-2207.765) (-2213.493) (-2210.496) * (-2205.011) (-2222.071) (-2214.895) [-2213.773] -- 0:01:07
Average standard deviation of split frequencies: 0.005930
745500 -- (-2209.131) (-2225.841) [-2204.563] (-2208.486) * (-2217.782) (-2212.991) (-2205.054) [-2206.599] -- 0:01:07
746000 -- [-2209.319] (-2214.515) (-2223.105) (-2211.334) * (-2220.292) (-2215.939) (-2222.436) [-2213.652] -- 0:01:07
746500 -- (-2207.372) (-2206.871) (-2220.123) [-2208.974] * [-2219.171] (-2215.559) (-2220.364) (-2208.627) -- 0:01:07
747000 -- (-2224.668) (-2216.671) (-2209.702) [-2203.938] * (-2210.548) [-2212.360] (-2209.233) (-2222.064) -- 0:01:07
747500 -- (-2214.905) [-2212.566] (-2213.179) (-2205.867) * (-2209.501) (-2209.978) (-2211.826) [-2204.851] -- 0:01:06
748000 -- [-2216.280] (-2206.346) (-2222.610) (-2210.077) * (-2222.842) (-2211.375) [-2209.387] (-2213.430) -- 0:01:06
748500 -- (-2212.929) (-2218.866) [-2226.526] (-2219.583) * (-2224.989) (-2210.194) [-2217.547] (-2214.933) -- 0:01:06
749000 -- [-2211.574] (-2211.283) (-2214.412) (-2231.415) * (-2217.042) [-2205.826] (-2217.608) (-2215.013) -- 0:01:06
749500 -- (-2225.859) (-2213.506) (-2215.352) [-2208.489] * (-2217.557) (-2232.415) [-2224.824] (-2221.622) -- 0:01:06
750000 -- (-2218.117) [-2205.031] (-2217.518) (-2219.993) * [-2216.456] (-2218.143) (-2218.609) (-2217.447) -- 0:01:06
Average standard deviation of split frequencies: 0.006135
750500 -- (-2221.201) (-2215.386) (-2222.296) [-2224.982] * (-2218.881) [-2207.694] (-2216.292) (-2218.530) -- 0:01:06
751000 -- [-2222.051] (-2214.409) (-2219.774) (-2213.197) * (-2226.330) (-2207.758) (-2220.979) [-2207.583] -- 0:01:05
751500 -- (-2209.908) (-2209.868) (-2207.631) [-2207.997] * (-2216.221) [-2211.189] (-2217.579) (-2212.374) -- 0:01:05
752000 -- (-2216.729) [-2205.362] (-2210.977) (-2213.201) * [-2207.937] (-2210.927) (-2213.349) (-2214.891) -- 0:01:05
752500 -- (-2227.543) (-2212.885) (-2223.884) [-2216.856] * [-2211.095] (-2226.871) (-2215.623) (-2219.250) -- 0:01:05
753000 -- [-2212.924] (-2204.682) (-2222.635) (-2213.573) * (-2209.979) [-2215.555] (-2220.673) (-2215.624) -- 0:01:05
753500 -- [-2208.899] (-2218.399) (-2216.480) (-2219.824) * (-2213.607) (-2218.877) (-2216.028) [-2217.567] -- 0:01:05
754000 -- (-2218.590) (-2212.813) (-2219.388) [-2208.512] * (-2208.995) [-2203.597] (-2213.188) (-2210.637) -- 0:01:05
754500 -- (-2221.165) (-2217.306) [-2208.369] (-2223.064) * [-2212.134] (-2220.761) (-2213.672) (-2209.173) -- 0:01:05
755000 -- [-2214.824] (-2217.206) (-2209.059) (-2224.821) * (-2206.655) [-2206.474] (-2228.468) (-2214.631) -- 0:01:04
Average standard deviation of split frequencies: 0.006475
755500 -- (-2213.859) (-2218.596) (-2212.248) [-2205.460] * [-2210.592] (-2212.951) (-2221.513) (-2209.685) -- 0:01:04
756000 -- (-2210.026) (-2224.699) [-2211.751] (-2209.832) * (-2214.844) (-2214.983) [-2209.762] (-2223.136) -- 0:01:04
756500 -- (-2219.223) (-2229.494) [-2212.441] (-2215.267) * (-2219.379) [-2208.024] (-2209.951) (-2218.698) -- 0:01:04
757000 -- [-2211.045] (-2223.380) (-2215.788) (-2208.858) * [-2208.374] (-2228.365) (-2218.088) (-2208.190) -- 0:01:04
757500 -- (-2206.426) (-2215.797) (-2214.042) [-2210.300] * [-2210.805] (-2214.464) (-2230.735) (-2215.302) -- 0:01:04
758000 -- [-2206.479] (-2216.171) (-2218.859) (-2215.910) * [-2210.815] (-2213.449) (-2222.959) (-2215.104) -- 0:01:04
758500 -- (-2210.119) [-2212.813] (-2209.316) (-2213.361) * (-2212.609) [-2208.747] (-2217.052) (-2219.765) -- 0:01:03
759000 -- (-2211.345) [-2214.272] (-2215.715) (-2205.374) * (-2215.592) (-2218.081) (-2220.016) [-2217.598] -- 0:01:03
759500 -- (-2205.079) (-2220.565) (-2221.587) [-2219.786] * [-2209.534] (-2217.771) (-2209.574) (-2218.770) -- 0:01:03
760000 -- (-2211.550) (-2213.830) [-2214.169] (-2224.569) * (-2217.054) [-2208.214] (-2212.469) (-2213.475) -- 0:01:03
Average standard deviation of split frequencies: 0.005864
760500 -- (-2214.311) [-2216.608] (-2222.477) (-2217.965) * (-2215.418) (-2207.412) [-2211.091] (-2230.423) -- 0:01:03
761000 -- (-2217.282) (-2218.276) [-2203.478] (-2232.865) * (-2213.096) [-2206.086] (-2205.407) (-2225.911) -- 0:01:03
761500 -- (-2211.381) (-2211.794) [-2208.237] (-2217.032) * (-2219.763) (-2222.812) (-2215.073) [-2211.949] -- 0:01:03
762000 -- (-2226.018) [-2211.110] (-2209.010) (-2223.326) * [-2217.159] (-2225.376) (-2210.913) (-2214.681) -- 0:01:03
762500 -- [-2214.961] (-2212.839) (-2213.294) (-2217.436) * (-2214.849) (-2224.249) [-2221.051] (-2211.601) -- 0:01:02
763000 -- [-2214.977] (-2209.348) (-2209.513) (-2218.466) * (-2211.511) [-2211.931] (-2215.163) (-2215.864) -- 0:01:02
763500 -- (-2224.447) [-2211.099] (-2212.393) (-2217.869) * (-2218.113) (-2214.778) (-2222.057) [-2213.198] -- 0:01:02
764000 -- [-2208.010] (-2209.888) (-2211.397) (-2216.040) * [-2215.867] (-2219.412) (-2217.970) (-2220.191) -- 0:01:02
764500 -- (-2216.319) [-2221.339] (-2202.658) (-2222.780) * (-2224.160) (-2211.325) (-2211.278) [-2212.882] -- 0:01:02
765000 -- (-2217.475) (-2219.130) [-2209.534] (-2213.825) * (-2220.245) (-2212.162) (-2211.841) [-2208.863] -- 0:01:02
Average standard deviation of split frequencies: 0.005633
765500 -- (-2211.582) (-2212.908) [-2205.563] (-2214.978) * [-2208.149] (-2223.443) (-2229.567) (-2205.841) -- 0:01:02
766000 -- (-2221.820) (-2216.871) [-2205.072] (-2214.855) * (-2216.288) (-2214.017) (-2212.903) [-2208.230] -- 0:01:02
766500 -- [-2205.127] (-2216.939) (-2218.269) (-2209.805) * (-2208.329) [-2210.453] (-2217.122) (-2221.628) -- 0:01:01
767000 -- [-2205.471] (-2221.301) (-2219.552) (-2208.412) * (-2222.939) [-2207.069] (-2210.177) (-2214.120) -- 0:01:01
767500 -- (-2214.144) (-2216.460) [-2208.714] (-2210.183) * (-2217.844) (-2218.126) [-2209.917] (-2209.553) -- 0:01:01
768000 -- (-2211.525) [-2209.595] (-2209.326) (-2209.240) * [-2211.447] (-2211.182) (-2213.359) (-2207.702) -- 0:01:01
768500 -- [-2209.296] (-2205.542) (-2213.116) (-2221.421) * (-2220.941) (-2211.028) (-2208.102) [-2212.926] -- 0:01:01
769000 -- (-2213.013) [-2202.736] (-2213.997) (-2213.299) * (-2218.080) (-2220.317) [-2210.273] (-2211.813) -- 0:01:01
769500 -- [-2209.682] (-2206.134) (-2213.371) (-2217.978) * (-2220.100) (-2208.281) (-2212.604) [-2206.623] -- 0:01:01
770000 -- [-2210.777] (-2216.240) (-2208.878) (-2214.533) * (-2227.711) (-2216.225) (-2214.646) [-2202.870] -- 0:01:00
Average standard deviation of split frequencies: 0.005740
770500 -- (-2208.457) [-2214.348] (-2231.211) (-2208.887) * (-2212.713) (-2227.953) (-2221.819) [-2206.333] -- 0:01:00
771000 -- [-2208.635] (-2218.462) (-2216.206) (-2221.142) * (-2226.728) (-2215.388) (-2216.542) [-2214.136] -- 0:01:00
771500 -- (-2212.278) (-2218.752) (-2215.792) [-2214.345] * (-2213.603) (-2225.006) (-2216.631) [-2207.733] -- 0:01:00
772000 -- (-2212.556) (-2210.593) [-2210.760] (-2213.776) * (-2221.133) (-2208.064) [-2206.837] (-2219.761) -- 0:01:00
772500 -- [-2208.701] (-2212.173) (-2226.971) (-2216.745) * (-2212.381) (-2213.692) [-2209.223] (-2219.278) -- 0:01:00
773000 -- [-2214.414] (-2209.822) (-2224.029) (-2209.477) * (-2220.984) (-2216.491) [-2207.142] (-2211.206) -- 0:01:00
773500 -- [-2220.506] (-2211.381) (-2213.434) (-2216.136) * (-2209.378) [-2215.166] (-2211.919) (-2206.877) -- 0:01:00
774000 -- (-2217.295) (-2212.279) (-2200.331) [-2212.568] * (-2209.433) (-2208.943) [-2213.673] (-2218.600) -- 0:00:59
774500 -- (-2215.363) (-2221.846) (-2226.127) [-2203.121] * (-2215.096) [-2211.089] (-2206.676) (-2211.943) -- 0:00:59
775000 -- (-2214.898) (-2217.730) (-2222.406) [-2210.405] * (-2214.100) [-2214.354] (-2215.064) (-2207.520) -- 0:00:59
Average standard deviation of split frequencies: 0.005374
775500 -- [-2210.867] (-2224.470) (-2212.442) (-2218.816) * (-2211.422) (-2218.766) (-2215.451) [-2209.821] -- 0:00:59
776000 -- (-2216.937) (-2224.148) [-2212.862] (-2227.542) * [-2213.379] (-2212.157) (-2216.791) (-2210.915) -- 0:00:59
776500 -- [-2212.373] (-2207.479) (-2220.554) (-2214.385) * (-2226.521) (-2217.055) (-2222.514) [-2209.824] -- 0:00:59
777000 -- (-2227.273) [-2210.092] (-2216.199) (-2214.318) * (-2228.558) (-2219.311) [-2213.716] (-2220.325) -- 0:00:59
777500 -- (-2210.728) [-2208.126] (-2217.493) (-2213.398) * (-2212.228) (-2214.963) (-2212.374) [-2219.593] -- 0:00:58
778000 -- (-2213.249) (-2210.833) (-2218.440) [-2207.979] * (-2217.799) [-2213.533] (-2218.390) (-2220.656) -- 0:00:58
778500 -- (-2207.427) [-2214.463] (-2206.734) (-2220.566) * (-2215.134) [-2208.483] (-2221.666) (-2217.885) -- 0:00:58
779000 -- [-2221.384] (-2213.238) (-2215.352) (-2214.395) * [-2207.341] (-2217.720) (-2205.237) (-2229.366) -- 0:00:58
779500 -- [-2201.638] (-2215.755) (-2216.146) (-2226.626) * (-2217.666) [-2211.035] (-2217.285) (-2221.744) -- 0:00:58
780000 -- (-2210.038) (-2216.024) (-2220.981) [-2211.046] * (-2208.261) [-2203.577] (-2215.640) (-2218.433) -- 0:00:58
Average standard deviation of split frequencies: 0.004784
780500 -- (-2216.176) (-2208.936) [-2204.666] (-2223.621) * [-2208.915] (-2212.211) (-2227.230) (-2211.442) -- 0:00:57
781000 -- [-2212.797] (-2214.074) (-2211.397) (-2213.076) * (-2211.986) (-2206.731) (-2220.039) [-2206.352] -- 0:00:58
781500 -- (-2219.605) (-2218.951) [-2209.259] (-2213.157) * (-2208.079) (-2208.242) [-2209.813] (-2217.543) -- 0:00:57
782000 -- (-2212.932) (-2212.782) [-2213.793] (-2217.130) * [-2204.797] (-2215.792) (-2213.582) (-2209.930) -- 0:00:57
782500 -- [-2216.468] (-2219.578) (-2211.419) (-2217.890) * [-2220.251] (-2231.657) (-2211.092) (-2214.718) -- 0:00:57
783000 -- (-2212.961) (-2222.761) (-2218.443) [-2215.745] * [-2214.182] (-2224.116) (-2216.533) (-2219.938) -- 0:00:57
783500 -- (-2219.719) (-2213.095) (-2211.832) [-2213.377] * (-2217.490) (-2218.190) [-2210.396] (-2215.552) -- 0:00:57
784000 -- (-2209.551) (-2206.933) (-2211.453) [-2202.931] * (-2209.455) (-2215.780) [-2210.597] (-2224.132) -- 0:00:57
784500 -- (-2208.361) (-2219.070) (-2221.937) [-2210.228] * [-2207.335] (-2225.200) (-2206.346) (-2212.058) -- 0:00:56
785000 -- (-2214.993) (-2203.562) [-2216.514] (-2219.851) * [-2208.220] (-2215.471) (-2209.895) (-2215.948) -- 0:00:56
Average standard deviation of split frequencies: 0.005029
785500 -- [-2214.282] (-2204.609) (-2213.786) (-2226.937) * (-2214.254) [-2203.863] (-2212.432) (-2214.661) -- 0:00:56
786000 -- (-2220.309) (-2219.385) (-2220.763) [-2204.626] * (-2213.256) [-2210.614] (-2224.246) (-2215.792) -- 0:00:56
786500 -- [-2206.311] (-2234.476) (-2217.918) (-2211.963) * [-2210.403] (-2215.913) (-2217.573) (-2218.217) -- 0:00:56
787000 -- (-2211.067) (-2221.055) (-2208.233) [-2214.724] * [-2211.366] (-2222.137) (-2220.203) (-2215.782) -- 0:00:56
787500 -- (-2223.409) (-2212.665) [-2208.989] (-2221.333) * (-2211.665) (-2223.468) [-2219.387] (-2214.138) -- 0:00:56
788000 -- (-2217.339) (-2221.555) [-2215.172] (-2219.745) * (-2227.926) (-2210.243) [-2220.553] (-2209.976) -- 0:00:55
788500 -- [-2215.836] (-2220.086) (-2217.823) (-2211.241) * (-2216.304) [-2216.997] (-2225.748) (-2208.351) -- 0:00:55
789000 -- (-2206.635) [-2211.985] (-2208.825) (-2215.021) * [-2211.961] (-2213.843) (-2220.879) (-2212.183) -- 0:00:55
789500 -- (-2206.906) (-2218.102) [-2210.321] (-2211.870) * (-2211.454) [-2204.111] (-2215.267) (-2215.930) -- 0:00:55
790000 -- (-2207.621) [-2213.335] (-2216.859) (-2228.927) * (-2217.379) [-2210.647] (-2211.108) (-2220.837) -- 0:00:55
Average standard deviation of split frequencies: 0.005091
790500 -- (-2206.246) (-2208.364) [-2209.090] (-2220.570) * (-2221.980) (-2221.323) [-2209.004] (-2221.373) -- 0:00:55
791000 -- (-2211.051) [-2210.974] (-2215.495) (-2216.668) * (-2217.179) (-2219.338) [-2212.963] (-2220.657) -- 0:00:55
791500 -- (-2211.043) (-2213.196) (-2207.849) [-2213.420] * [-2205.084] (-2213.644) (-2227.864) (-2214.431) -- 0:00:55
792000 -- (-2216.765) (-2222.210) (-2224.247) [-2214.920] * (-2212.480) (-2214.179) (-2214.442) [-2218.574] -- 0:00:54
792500 -- [-2211.417] (-2227.741) (-2227.776) (-2208.179) * (-2204.333) (-2217.242) [-2208.831] (-2219.716) -- 0:00:54
793000 -- (-2221.250) [-2221.936] (-2221.123) (-2216.354) * (-2213.300) (-2212.034) (-2213.970) [-2213.877] -- 0:00:54
793500 -- (-2226.567) [-2220.781] (-2216.044) (-2224.202) * (-2216.788) [-2208.071] (-2233.888) (-2211.493) -- 0:00:54
794000 -- (-2223.085) (-2219.545) (-2213.596) [-2210.086] * (-2213.126) [-2209.821] (-2230.466) (-2201.327) -- 0:00:54
794500 -- [-2214.097] (-2220.639) (-2212.899) (-2211.895) * (-2219.680) [-2209.995] (-2227.011) (-2209.869) -- 0:00:54
795000 -- (-2214.672) [-2219.343] (-2216.971) (-2223.418) * (-2207.750) [-2213.452] (-2224.258) (-2214.616) -- 0:00:54
Average standard deviation of split frequencies: 0.004874
795500 -- (-2209.305) [-2208.249] (-2220.020) (-2223.651) * (-2218.920) [-2206.811] (-2221.562) (-2217.990) -- 0:00:53
796000 -- (-2213.382) [-2222.890] (-2213.839) (-2212.718) * [-2204.506] (-2212.716) (-2226.263) (-2221.239) -- 0:00:53
796500 -- (-2215.459) [-2208.183] (-2210.337) (-2216.940) * (-2213.900) (-2210.792) (-2226.989) [-2210.230] -- 0:00:53
797000 -- [-2211.258] (-2204.994) (-2209.722) (-2214.303) * (-2209.644) [-2216.764] (-2219.263) (-2214.696) -- 0:00:53
797500 -- (-2223.608) (-2212.968) (-2215.080) [-2208.346] * (-2213.061) (-2212.764) [-2214.697] (-2219.441) -- 0:00:53
798000 -- (-2228.856) (-2214.108) (-2214.511) [-2203.902] * (-2210.174) (-2222.622) [-2202.516] (-2212.126) -- 0:00:53
798500 -- (-2220.107) [-2213.970] (-2219.485) (-2208.381) * (-2224.028) (-2213.792) (-2210.234) [-2221.789] -- 0:00:53
799000 -- (-2227.709) (-2211.043) (-2215.479) [-2216.919] * (-2217.248) (-2214.400) (-2204.721) [-2207.501] -- 0:00:53
799500 -- (-2224.807) [-2211.184] (-2214.109) (-2208.821) * (-2204.778) [-2211.777] (-2206.696) (-2219.172) -- 0:00:52
800000 -- (-2209.128) [-2206.569] (-2211.236) (-2213.726) * (-2212.326) (-2221.880) (-2204.449) [-2211.787] -- 0:00:52
Average standard deviation of split frequencies: 0.004755
800500 -- (-2214.738) (-2218.110) (-2216.835) [-2208.462] * (-2225.555) [-2210.441] (-2211.721) (-2208.259) -- 0:00:52
801000 -- (-2219.346) (-2213.647) (-2227.781) [-2210.930] * [-2215.638] (-2222.726) (-2217.449) (-2214.843) -- 0:00:52
801500 -- (-2216.595) (-2213.874) [-2209.803] (-2217.339) * (-2227.717) (-2209.651) [-2211.414] (-2211.171) -- 0:00:52
802000 -- (-2215.699) (-2213.549) [-2209.002] (-2204.204) * (-2228.064) [-2208.580] (-2221.349) (-2210.378) -- 0:00:52
802500 -- (-2207.475) [-2209.222] (-2205.115) (-2215.202) * (-2213.383) (-2221.486) [-2206.525] (-2213.539) -- 0:00:52
803000 -- [-2210.838] (-2223.836) (-2206.359) (-2214.616) * (-2217.963) (-2207.869) [-2209.041] (-2216.881) -- 0:00:52
803500 -- (-2211.491) (-2205.217) (-2215.420) [-2211.040] * (-2213.235) (-2214.419) (-2223.969) [-2204.466] -- 0:00:51
804000 -- (-2215.531) (-2211.616) [-2210.139] (-2219.899) * (-2210.956) (-2221.151) [-2210.593] (-2215.775) -- 0:00:51
804500 -- (-2209.942) (-2209.578) (-2209.441) [-2206.603] * (-2219.336) (-2219.429) (-2214.999) [-2217.416] -- 0:00:51
805000 -- (-2204.890) (-2209.397) (-2214.083) [-2214.701] * (-2220.060) (-2222.153) (-2209.988) [-2209.132] -- 0:00:51
Average standard deviation of split frequencies: 0.004589
805500 -- (-2220.220) (-2221.776) [-2207.017] (-2209.810) * (-2207.593) [-2211.841] (-2215.880) (-2210.408) -- 0:00:51
806000 -- [-2205.982] (-2213.861) (-2204.928) (-2207.470) * [-2211.575] (-2224.968) (-2211.568) (-2209.579) -- 0:00:51
806500 -- (-2209.531) (-2208.514) (-2209.379) [-2206.785] * [-2211.208] (-2220.256) (-2211.144) (-2221.024) -- 0:00:51
807000 -- (-2219.073) (-2213.472) (-2215.692) [-2210.372] * [-2208.101] (-2217.997) (-2218.193) (-2218.849) -- 0:00:50
807500 -- (-2206.513) (-2215.661) [-2208.062] (-2219.984) * (-2210.499) (-2218.618) (-2212.232) [-2214.017] -- 0:00:50
808000 -- (-2216.660) (-2213.389) (-2204.020) [-2210.827] * (-2219.948) (-2216.914) (-2212.451) [-2215.642] -- 0:00:50
808500 -- (-2213.345) (-2232.702) [-2206.512] (-2219.886) * (-2215.997) (-2228.848) [-2219.376] (-2223.168) -- 0:00:50
809000 -- (-2218.199) (-2225.129) [-2205.346] (-2217.335) * (-2219.347) (-2212.482) [-2208.060] (-2222.877) -- 0:00:50
809500 -- (-2214.556) (-2214.608) [-2218.098] (-2224.284) * (-2219.235) [-2203.139] (-2211.868) (-2219.710) -- 0:00:50
810000 -- (-2216.514) (-2214.804) (-2220.689) [-2213.847] * (-2214.759) [-2204.951] (-2216.936) (-2220.067) -- 0:00:50
Average standard deviation of split frequencies: 0.004607
810500 -- [-2206.424] (-2223.143) (-2214.372) (-2217.799) * [-2214.493] (-2212.820) (-2218.469) (-2210.621) -- 0:00:50
811000 -- [-2215.793] (-2215.829) (-2218.422) (-2208.963) * [-2209.571] (-2214.991) (-2221.069) (-2220.930) -- 0:00:49
811500 -- [-2214.841] (-2215.520) (-2220.847) (-2208.585) * [-2203.389] (-2223.205) (-2211.475) (-2223.279) -- 0:00:49
812000 -- [-2209.213] (-2211.086) (-2216.497) (-2209.118) * [-2205.647] (-2225.755) (-2211.378) (-2213.604) -- 0:00:49
812500 -- [-2211.420] (-2210.744) (-2222.904) (-2220.574) * (-2217.222) (-2215.985) [-2215.722] (-2227.491) -- 0:00:49
813000 -- (-2216.698) (-2225.995) [-2215.544] (-2206.449) * (-2214.747) (-2213.358) [-2205.273] (-2219.048) -- 0:00:49
813500 -- (-2220.598) [-2213.507] (-2221.075) (-2216.439) * (-2223.170) [-2221.330] (-2220.797) (-2215.925) -- 0:00:49
814000 -- (-2222.783) (-2206.055) (-2215.677) [-2203.606] * (-2224.278) (-2220.775) (-2216.588) [-2212.174] -- 0:00:49
814500 -- (-2208.444) [-2208.030] (-2221.189) (-2206.212) * (-2214.175) (-2218.467) [-2215.946] (-2230.958) -- 0:00:48
815000 -- (-2228.185) (-2227.613) (-2214.820) [-2209.114] * (-2216.433) [-2213.646] (-2208.619) (-2221.538) -- 0:00:48
Average standard deviation of split frequencies: 0.004844
815500 -- (-2210.236) [-2210.099] (-2229.098) (-2223.929) * [-2215.123] (-2211.370) (-2217.342) (-2218.844) -- 0:00:48
816000 -- (-2214.378) (-2212.102) (-2207.840) [-2209.507] * (-2216.590) (-2210.373) [-2210.475] (-2213.119) -- 0:00:48
816500 -- (-2214.493) [-2203.956] (-2211.186) (-2209.920) * (-2217.750) [-2211.853] (-2224.129) (-2210.823) -- 0:00:48
817000 -- [-2214.351] (-2214.516) (-2215.154) (-2209.749) * (-2216.274) (-2222.631) [-2208.915] (-2213.706) -- 0:00:48
817500 -- (-2216.851) [-2209.673] (-2210.328) (-2216.534) * (-2221.853) (-2216.493) (-2217.653) [-2214.956] -- 0:00:48
818000 -- (-2213.612) (-2209.976) [-2211.880] (-2219.066) * [-2217.669] (-2218.343) (-2211.620) (-2218.110) -- 0:00:48
818500 -- (-2214.585) [-2207.931] (-2204.923) (-2225.900) * (-2226.567) (-2218.738) (-2224.039) [-2215.294] -- 0:00:47
819000 -- [-2213.349] (-2212.736) (-2209.890) (-2217.130) * [-2205.889] (-2229.225) (-2220.554) (-2211.812) -- 0:00:47
819500 -- (-2227.242) (-2216.797) (-2213.929) [-2211.857] * (-2210.846) (-2217.787) (-2210.122) [-2208.836] -- 0:00:47
820000 -- (-2214.492) (-2218.770) [-2215.242] (-2220.669) * (-2222.712) [-2208.082] (-2214.134) (-2210.912) -- 0:00:47
Average standard deviation of split frequencies: 0.005391
820500 -- (-2216.065) [-2209.936] (-2215.135) (-2222.597) * (-2212.348) [-2209.970] (-2214.924) (-2214.274) -- 0:00:47
821000 -- (-2213.097) (-2208.875) (-2229.123) [-2216.223] * (-2222.764) (-2209.046) [-2215.569] (-2219.495) -- 0:00:47
821500 -- (-2222.589) [-2214.084] (-2222.676) (-2211.962) * (-2216.382) [-2208.885] (-2210.112) (-2212.065) -- 0:00:47
822000 -- (-2215.642) (-2207.349) [-2210.546] (-2223.052) * (-2212.258) (-2215.735) [-2210.811] (-2215.504) -- 0:00:46
822500 -- (-2228.158) (-2215.164) [-2204.888] (-2216.304) * (-2208.211) (-2216.279) [-2210.274] (-2223.331) -- 0:00:46
823000 -- (-2236.984) (-2210.139) [-2208.199] (-2219.266) * [-2210.736] (-2213.314) (-2225.645) (-2206.530) -- 0:00:46
823500 -- [-2220.908] (-2211.812) (-2211.703) (-2212.845) * [-2212.486] (-2209.459) (-2213.423) (-2209.046) -- 0:00:46
824000 -- (-2216.846) (-2213.252) [-2204.136] (-2223.861) * [-2214.180] (-2217.384) (-2219.337) (-2210.184) -- 0:00:46
824500 -- (-2219.419) [-2204.752] (-2221.536) (-2230.121) * (-2217.174) (-2214.990) (-2215.263) [-2208.887] -- 0:00:46
825000 -- (-2218.836) (-2213.275) [-2220.999] (-2221.880) * (-2225.494) [-2212.069] (-2225.659) (-2206.779) -- 0:00:46
Average standard deviation of split frequencies: 0.005400
825500 -- (-2221.998) [-2206.337] (-2213.879) (-2220.833) * (-2215.761) (-2208.706) (-2210.274) [-2204.509] -- 0:00:46
826000 -- (-2215.941) (-2210.932) [-2208.758] (-2209.476) * (-2214.581) [-2214.579] (-2212.547) (-2205.170) -- 0:00:45
826500 -- (-2213.468) [-2211.735] (-2217.305) (-2211.659) * (-2207.890) (-2210.871) [-2213.099] (-2221.843) -- 0:00:45
827000 -- (-2208.261) (-2212.443) [-2222.144] (-2221.996) * (-2213.540) (-2221.397) (-2211.513) [-2214.043] -- 0:00:45
827500 -- (-2211.518) (-2225.184) (-2210.451) [-2212.947] * [-2208.266] (-2215.247) (-2218.755) (-2210.264) -- 0:00:45
828000 -- [-2216.516] (-2226.436) (-2205.097) (-2224.175) * [-2212.393] (-2217.469) (-2217.866) (-2214.386) -- 0:00:45
828500 -- (-2233.212) (-2222.692) [-2209.738] (-2213.230) * [-2203.871] (-2217.351) (-2225.073) (-2213.988) -- 0:00:45
829000 -- [-2214.676] (-2209.761) (-2231.678) (-2227.822) * (-2205.216) [-2205.813] (-2214.660) (-2233.872) -- 0:00:45
829500 -- (-2224.547) [-2211.616] (-2217.029) (-2218.702) * (-2209.010) (-2216.148) [-2214.895] (-2216.996) -- 0:00:45
830000 -- [-2216.005] (-2228.095) (-2229.312) (-2221.128) * (-2214.788) [-2209.892] (-2209.242) (-2207.666) -- 0:00:44
Average standard deviation of split frequencies: 0.005108
830500 -- (-2228.194) (-2221.609) (-2210.051) [-2209.695] * (-2219.550) (-2209.151) (-2220.533) [-2208.859] -- 0:00:44
831000 -- (-2212.535) (-2222.230) [-2207.283] (-2217.582) * (-2219.034) [-2215.413] (-2225.702) (-2209.065) -- 0:00:44
831500 -- (-2214.934) [-2203.871] (-2211.710) (-2223.685) * (-2210.333) (-2211.938) [-2213.874] (-2231.200) -- 0:00:44
832000 -- [-2210.968] (-2205.476) (-2212.713) (-2234.535) * [-2217.896] (-2220.529) (-2224.676) (-2213.748) -- 0:00:44
832500 -- (-2209.558) [-2213.760] (-2217.241) (-2222.615) * [-2218.488] (-2216.349) (-2226.472) (-2211.056) -- 0:00:44
833000 -- (-2224.337) (-2220.566) [-2203.415] (-2214.467) * (-2209.883) [-2217.645] (-2217.559) (-2211.973) -- 0:00:44
833500 -- (-2210.775) (-2215.615) [-2209.748] (-2221.163) * (-2226.254) (-2214.587) (-2217.973) [-2206.854] -- 0:00:43
834000 -- (-2212.398) [-2211.157] (-2226.145) (-2219.106) * (-2211.351) (-2213.946) (-2221.682) [-2207.653] -- 0:00:43
834500 -- (-2218.771) (-2216.295) [-2210.013] (-2208.183) * [-2213.182] (-2217.169) (-2219.305) (-2218.135) -- 0:00:43
835000 -- (-2216.941) (-2228.004) (-2219.784) [-2211.221] * [-2206.543] (-2210.641) (-2213.818) (-2216.366) -- 0:00:43
Average standard deviation of split frequencies: 0.005118
835500 -- (-2223.511) (-2220.543) [-2214.945] (-2214.466) * (-2222.623) [-2219.967] (-2211.376) (-2215.371) -- 0:00:43
836000 -- [-2216.218] (-2220.344) (-2213.033) (-2217.209) * (-2224.084) (-2223.799) (-2209.716) [-2208.332] -- 0:00:43
836500 -- (-2219.989) (-2208.921) [-2217.863] (-2218.948) * [-2225.541] (-2209.118) (-2207.902) (-2218.312) -- 0:00:43
837000 -- (-2222.190) (-2211.712) [-2218.907] (-2221.335) * (-2223.018) (-2220.014) (-2226.813) [-2213.411] -- 0:00:43
837500 -- (-2220.383) [-2203.517] (-2217.707) (-2217.525) * [-2212.746] (-2208.285) (-2219.299) (-2224.653) -- 0:00:42
838000 -- [-2217.314] (-2209.276) (-2236.271) (-2205.535) * [-2214.879] (-2210.401) (-2211.412) (-2215.207) -- 0:00:42
838500 -- (-2222.837) (-2204.524) [-2215.473] (-2222.074) * [-2214.060] (-2207.832) (-2220.046) (-2210.609) -- 0:00:42
839000 -- [-2210.327] (-2218.451) (-2227.776) (-2214.518) * (-2208.122) [-2209.672] (-2219.679) (-2220.603) -- 0:00:42
839500 -- (-2208.801) [-2210.078] (-2222.077) (-2215.051) * (-2223.920) [-2207.140] (-2215.964) (-2212.522) -- 0:00:42
840000 -- [-2206.430] (-2215.319) (-2213.766) (-2226.323) * (-2217.122) [-2210.299] (-2222.493) (-2208.007) -- 0:00:42
Average standard deviation of split frequencies: 0.005176
840500 -- (-2212.949) (-2223.862) [-2210.602] (-2217.008) * (-2223.088) [-2208.514] (-2210.063) (-2215.854) -- 0:00:41
841000 -- [-2212.541] (-2208.561) (-2223.171) (-2210.211) * (-2216.807) (-2208.025) (-2212.993) [-2216.523] -- 0:00:41
841500 -- (-2225.794) (-2213.036) (-2209.729) [-2205.700] * (-2219.910) (-2215.822) [-2211.201] (-2208.502) -- 0:00:41
842000 -- (-2220.099) (-2217.556) [-2201.950] (-2219.670) * (-2213.983) (-2218.440) [-2227.629] (-2216.395) -- 0:00:41
842500 -- (-2204.530) (-2214.498) (-2220.135) [-2216.573] * (-2226.706) [-2216.974] (-2211.104) (-2216.133) -- 0:00:41
843000 -- (-2225.984) (-2211.493) (-2217.438) [-2211.240] * (-2228.769) (-2208.117) [-2215.009] (-2214.954) -- 0:00:41
843500 -- (-2214.757) [-2208.873] (-2221.531) (-2216.440) * (-2210.949) [-2208.088] (-2217.015) (-2219.110) -- 0:00:41
844000 -- [-2215.012] (-2220.241) (-2216.704) (-2218.078) * (-2208.559) (-2213.694) [-2210.321] (-2210.569) -- 0:00:41
844500 -- (-2215.921) (-2215.406) (-2235.550) [-2209.959] * (-2223.469) [-2217.506] (-2214.597) (-2221.985) -- 0:00:40
845000 -- (-2217.253) [-2208.287] (-2217.840) (-2225.121) * (-2217.853) [-2206.205] (-2216.849) (-2220.809) -- 0:00:40
Average standard deviation of split frequencies: 0.004972
845500 -- (-2217.493) [-2211.797] (-2214.193) (-2222.688) * (-2216.987) [-2204.257] (-2210.573) (-2230.549) -- 0:00:40
846000 -- (-2214.747) [-2207.604] (-2217.944) (-2223.474) * (-2208.601) (-2215.824) (-2216.660) [-2216.740] -- 0:00:40
846500 -- (-2209.607) (-2214.284) [-2214.407] (-2211.479) * (-2208.626) [-2212.070] (-2217.717) (-2220.219) -- 0:00:40
847000 -- (-2208.629) (-2228.581) (-2213.717) [-2203.639] * (-2212.095) (-2217.719) [-2221.557] (-2217.808) -- 0:00:40
847500 -- (-2216.745) (-2217.697) (-2216.480) [-2210.032] * (-2215.050) (-2213.418) (-2216.473) [-2217.422] -- 0:00:40
848000 -- (-2215.501) [-2217.752] (-2211.530) (-2225.690) * (-2212.575) (-2217.416) [-2206.318] (-2211.269) -- 0:00:39
848500 -- [-2206.279] (-2216.075) (-2215.959) (-2207.796) * [-2208.622] (-2220.309) (-2212.619) (-2213.069) -- 0:00:39
849000 -- (-2209.693) (-2206.657) (-2211.160) [-2206.682] * [-2209.297] (-2205.150) (-2222.220) (-2221.175) -- 0:00:39
849500 -- (-2224.747) (-2211.966) [-2209.331] (-2215.236) * (-2214.630) [-2209.355] (-2221.932) (-2236.210) -- 0:00:39
850000 -- (-2210.280) (-2221.414) [-2214.791] (-2212.702) * [-2207.483] (-2231.734) (-2216.997) (-2229.020) -- 0:00:39
Average standard deviation of split frequencies: 0.004817
850500 -- (-2229.692) (-2209.760) (-2223.514) [-2220.273] * (-2204.585) [-2214.353] (-2214.738) (-2234.081) -- 0:00:39
851000 -- (-2218.110) (-2210.434) [-2211.191] (-2215.364) * [-2207.768] (-2212.164) (-2210.503) (-2224.184) -- 0:00:39
851500 -- [-2207.853] (-2220.330) (-2217.552) (-2216.790) * [-2208.936] (-2224.884) (-2219.082) (-2210.504) -- 0:00:39
852000 -- (-2214.208) [-2209.342] (-2217.518) (-2221.509) * [-2210.978] (-2220.202) (-2229.711) (-2209.858) -- 0:00:38
852500 -- (-2216.204) (-2217.437) [-2211.200] (-2231.425) * (-2214.852) [-2225.071] (-2219.348) (-2214.500) -- 0:00:38
853000 -- (-2208.294) [-2204.424] (-2211.110) (-2211.892) * (-2211.502) (-2218.041) [-2209.924] (-2215.085) -- 0:00:38
853500 -- (-2211.026) (-2208.410) [-2211.966] (-2218.280) * [-2207.111] (-2206.269) (-2213.572) (-2219.109) -- 0:00:38
854000 -- (-2214.199) (-2208.004) (-2211.468) [-2212.405] * (-2220.192) (-2211.019) [-2212.492] (-2207.772) -- 0:00:38
854500 -- (-2210.805) (-2208.007) (-2211.954) [-2216.160] * (-2219.220) (-2220.003) (-2219.325) [-2212.071] -- 0:00:38
855000 -- (-2211.195) (-2213.828) (-2211.511) [-2206.543] * [-2211.682] (-2208.049) (-2212.351) (-2214.757) -- 0:00:38
Average standard deviation of split frequencies: 0.004956
855500 -- [-2220.316] (-2214.212) (-2216.148) (-2208.692) * (-2211.439) [-2207.768] (-2214.661) (-2216.526) -- 0:00:38
856000 -- (-2206.703) (-2209.522) [-2207.502] (-2209.696) * [-2215.312] (-2208.381) (-2215.973) (-2224.867) -- 0:00:37
856500 -- [-2211.548] (-2209.021) (-2210.000) (-2213.841) * (-2224.067) (-2215.179) [-2210.294] (-2211.390) -- 0:00:37
857000 -- (-2210.585) [-2211.166] (-2213.537) (-2215.438) * (-2218.117) (-2215.350) (-2210.531) [-2204.025] -- 0:00:37
857500 -- (-2223.817) [-2217.307] (-2223.738) (-2226.494) * (-2218.089) (-2214.269) (-2207.045) [-2211.047] -- 0:00:37
858000 -- (-2215.219) [-2217.514] (-2232.062) (-2220.231) * [-2211.058] (-2222.999) (-2214.703) (-2221.135) -- 0:00:37
858500 -- [-2207.357] (-2212.324) (-2232.814) (-2221.928) * (-2220.139) (-2215.605) [-2205.676] (-2215.342) -- 0:00:37
859000 -- (-2213.331) [-2215.538] (-2207.478) (-2222.635) * (-2216.676) [-2209.604] (-2208.873) (-2217.864) -- 0:00:37
859500 -- (-2210.483) (-2213.105) [-2212.202] (-2209.926) * (-2215.105) (-2218.898) (-2222.102) [-2211.921] -- 0:00:36
860000 -- (-2222.459) (-2211.356) (-2211.324) [-2211.920] * (-2213.189) (-2216.395) [-2206.728] (-2209.632) -- 0:00:36
Average standard deviation of split frequencies: 0.005646
860500 -- (-2227.612) (-2215.723) [-2207.884] (-2205.875) * (-2223.525) (-2218.257) [-2199.637] (-2204.423) -- 0:00:36
861000 -- (-2213.956) (-2222.954) (-2222.341) [-2204.283] * (-2212.852) (-2225.494) (-2216.464) [-2217.210] -- 0:00:36
861500 -- (-2214.852) (-2219.814) [-2213.090] (-2209.523) * (-2226.475) (-2222.053) [-2217.909] (-2210.620) -- 0:00:36
862000 -- (-2216.178) [-2209.979] (-2213.691) (-2216.951) * (-2212.298) (-2231.772) [-2211.558] (-2213.206) -- 0:00:36
862500 -- (-2213.045) [-2211.691] (-2222.318) (-2216.625) * (-2213.530) (-2225.250) (-2211.533) [-2221.669] -- 0:00:36
863000 -- [-2216.068] (-2219.869) (-2216.660) (-2214.005) * (-2210.755) (-2230.634) [-2211.075] (-2223.828) -- 0:00:36
863500 -- [-2210.246] (-2207.655) (-2217.147) (-2219.204) * (-2213.830) (-2230.087) (-2221.532) [-2207.748] -- 0:00:35
864000 -- (-2211.151) (-2216.178) [-2214.110] (-2213.801) * [-2217.110] (-2220.813) (-2223.481) (-2208.248) -- 0:00:35
864500 -- (-2207.507) (-2210.844) (-2215.174) [-2210.556] * (-2212.885) (-2211.080) [-2205.563] (-2210.665) -- 0:00:35
865000 -- [-2204.873] (-2221.458) (-2212.558) (-2207.915) * [-2212.841] (-2224.604) (-2211.476) (-2208.654) -- 0:00:35
Average standard deviation of split frequencies: 0.005778
865500 -- (-2219.467) (-2221.874) (-2221.734) [-2222.662] * (-2213.276) [-2222.527] (-2208.365) (-2219.081) -- 0:00:35
866000 -- (-2219.043) (-2214.829) (-2215.287) [-2212.639] * (-2214.469) (-2217.675) [-2210.954] (-2216.505) -- 0:00:35
866500 -- (-2212.917) (-2213.373) (-2227.090) [-2206.443] * (-2214.078) [-2211.749] (-2213.126) (-2225.175) -- 0:00:35
867000 -- (-2221.491) (-2215.099) [-2206.904] (-2235.961) * [-2208.696] (-2208.895) (-2215.756) (-2228.098) -- 0:00:34
867500 -- (-2220.082) (-2210.173) [-2213.102] (-2219.928) * [-2217.921] (-2213.580) (-2207.893) (-2221.752) -- 0:00:34
868000 -- [-2210.393] (-2211.476) (-2215.241) (-2231.762) * (-2216.590) (-2217.263) (-2211.643) [-2218.003] -- 0:00:34
868500 -- [-2212.534] (-2213.406) (-2218.280) (-2216.925) * (-2221.922) [-2207.028] (-2211.706) (-2227.281) -- 0:00:34
869000 -- (-2219.647) [-2214.050] (-2229.964) (-2208.013) * (-2218.849) [-2213.710] (-2220.122) (-2211.180) -- 0:00:34
869500 -- (-2205.306) [-2218.319] (-2220.638) (-2221.021) * (-2219.945) [-2211.122] (-2217.329) (-2214.269) -- 0:00:34
870000 -- (-2213.605) (-2218.024) [-2217.709] (-2201.809) * (-2219.213) (-2207.517) [-2214.119] (-2219.947) -- 0:00:34
Average standard deviation of split frequencies: 0.005373
870500 -- (-2217.127) (-2212.417) (-2224.233) [-2210.015] * (-2213.405) (-2212.404) [-2213.935] (-2219.224) -- 0:00:34
871000 -- (-2220.714) [-2210.955] (-2218.437) (-2214.627) * [-2210.665] (-2223.904) (-2216.777) (-2211.581) -- 0:00:33
871500 -- (-2214.098) [-2215.633] (-2214.415) (-2223.791) * [-2215.071] (-2221.675) (-2219.078) (-2226.852) -- 0:00:33
872000 -- [-2206.260] (-2216.263) (-2216.019) (-2210.557) * (-2219.224) [-2220.458] (-2225.341) (-2211.478) -- 0:00:33
872500 -- (-2209.521) (-2218.602) [-2213.736] (-2217.892) * (-2211.634) (-2224.431) (-2222.712) [-2217.103] -- 0:00:33
873000 -- (-2206.037) [-2210.153] (-2215.285) (-2232.079) * (-2215.060) (-2227.921) [-2222.213] (-2210.827) -- 0:00:33
873500 -- (-2213.228) [-2208.018] (-2212.789) (-2217.747) * [-2214.880] (-2224.965) (-2208.877) (-2217.413) -- 0:00:33
874000 -- [-2211.991] (-2203.223) (-2228.695) (-2223.853) * [-2214.251] (-2223.795) (-2229.732) (-2211.078) -- 0:00:33
874500 -- (-2207.443) [-2207.923] (-2219.018) (-2218.108) * (-2222.056) [-2205.586] (-2218.114) (-2211.254) -- 0:00:33
875000 -- (-2217.707) (-2213.841) (-2216.882) [-2207.790] * [-2211.804] (-2214.195) (-2214.843) (-2206.586) -- 0:00:32
Average standard deviation of split frequencies: 0.005009
875500 -- (-2220.257) (-2219.562) [-2209.300] (-2209.414) * (-2219.546) (-2216.262) [-2225.983] (-2224.066) -- 0:00:32
876000 -- (-2223.141) (-2220.671) [-2210.127] (-2211.014) * [-2206.089] (-2208.794) (-2206.069) (-2230.560) -- 0:00:32
876500 -- (-2212.164) [-2212.621] (-2221.405) (-2219.186) * (-2207.155) (-2225.695) (-2208.347) [-2218.209] -- 0:00:32
877000 -- [-2210.966] (-2204.277) (-2223.049) (-2227.917) * (-2215.149) (-2204.310) [-2211.508] (-2207.349) -- 0:00:32
877500 -- (-2222.687) [-2211.047] (-2220.514) (-2221.996) * [-2209.614] (-2209.459) (-2210.384) (-2222.341) -- 0:00:32
878000 -- (-2215.427) (-2209.764) (-2220.022) [-2216.897] * (-2212.309) (-2219.804) [-2210.042] (-2205.815) -- 0:00:32
878500 -- (-2212.190) [-2212.225] (-2224.704) (-2209.546) * (-2215.294) (-2222.878) [-2212.896] (-2207.571) -- 0:00:31
879000 -- (-2209.486) (-2217.733) (-2218.970) [-2204.155] * (-2231.898) (-2217.048) [-2210.974] (-2213.231) -- 0:00:31
879500 -- [-2211.914] (-2218.791) (-2212.258) (-2213.304) * (-2222.396) [-2207.321] (-2220.641) (-2221.305) -- 0:00:31
880000 -- (-2212.708) (-2219.944) (-2213.918) [-2211.376] * (-2209.730) [-2209.548] (-2223.842) (-2209.857) -- 0:00:31
Average standard deviation of split frequencies: 0.005023
880500 -- [-2217.103] (-2218.369) (-2209.577) (-2212.712) * (-2221.044) (-2213.660) [-2216.564] (-2210.409) -- 0:00:31
881000 -- (-2217.979) (-2219.216) (-2213.675) [-2208.148] * (-2210.571) (-2223.850) [-2207.246] (-2225.887) -- 0:00:31
881500 -- [-2209.952] (-2211.548) (-2217.904) (-2215.419) * (-2213.989) (-2226.323) (-2220.462) [-2213.739] -- 0:00:31
882000 -- (-2212.945) [-2207.997] (-2215.636) (-2212.366) * (-2213.169) (-2218.014) [-2204.540] (-2226.842) -- 0:00:31
882500 -- (-2205.870) (-2222.903) [-2220.090] (-2212.201) * (-2212.282) (-2215.063) (-2211.242) [-2212.930] -- 0:00:30
883000 -- (-2226.006) [-2212.141] (-2219.409) (-2208.533) * [-2210.920] (-2215.919) (-2214.256) (-2215.293) -- 0:00:30
883500 -- (-2220.688) (-2217.657) [-2217.083] (-2208.702) * (-2207.339) (-2218.935) (-2208.313) [-2218.362] -- 0:00:30
884000 -- (-2222.132) [-2211.276] (-2240.571) (-2216.267) * (-2213.859) [-2217.309] (-2211.199) (-2211.189) -- 0:00:30
884500 -- [-2203.485] (-2216.317) (-2238.060) (-2216.937) * [-2201.896] (-2214.011) (-2210.365) (-2217.587) -- 0:00:30
885000 -- (-2208.539) (-2219.387) (-2207.860) [-2217.233] * (-2212.619) (-2217.103) [-2209.308] (-2218.146) -- 0:00:30
Average standard deviation of split frequencies: 0.004993
885500 -- [-2209.691] (-2221.252) (-2205.906) (-2218.166) * (-2218.482) (-2211.870) [-2227.996] (-2224.020) -- 0:00:30
886000 -- (-2215.258) [-2211.404] (-2215.044) (-2211.766) * (-2214.254) (-2218.953) [-2218.023] (-2215.827) -- 0:00:29
886500 -- [-2205.658] (-2219.282) (-2216.476) (-2211.574) * (-2227.854) (-2216.137) [-2218.694] (-2235.664) -- 0:00:29
887000 -- (-2211.421) (-2212.088) [-2210.402] (-2209.514) * (-2217.067) [-2203.479] (-2223.058) (-2215.615) -- 0:00:29
887500 -- [-2204.934] (-2221.344) (-2216.936) (-2212.111) * (-2200.944) (-2224.700) [-2207.773] (-2222.404) -- 0:00:29
888000 -- (-2216.878) (-2224.090) [-2210.339] (-2221.684) * (-2217.948) [-2211.070] (-2220.751) (-2216.264) -- 0:00:29
888500 -- (-2215.952) [-2215.173] (-2204.419) (-2209.210) * [-2215.462] (-2209.647) (-2226.739) (-2214.600) -- 0:00:29
889000 -- (-2218.434) [-2215.422] (-2207.271) (-2207.874) * (-2212.443) (-2218.196) [-2207.431] (-2211.654) -- 0:00:29
889500 -- (-2208.518) [-2206.844] (-2213.972) (-2213.877) * [-2215.154] (-2215.707) (-2224.856) (-2220.605) -- 0:00:29
890000 -- (-2212.543) (-2211.358) (-2218.291) [-2209.237] * (-2225.439) (-2206.608) [-2213.988] (-2217.144) -- 0:00:28
Average standard deviation of split frequencies: 0.005130
890500 -- [-2216.300] (-2219.401) (-2211.915) (-2207.592) * (-2210.659) [-2210.676] (-2212.562) (-2224.753) -- 0:00:28
891000 -- [-2213.001] (-2203.757) (-2209.942) (-2213.864) * [-2216.095] (-2206.443) (-2213.903) (-2227.521) -- 0:00:28
891500 -- [-2214.988] (-2215.075) (-2218.854) (-2214.182) * (-2205.647) (-2212.532) (-2208.605) [-2216.062] -- 0:00:28
892000 -- (-2219.130) (-2209.457) [-2209.645] (-2208.701) * (-2213.064) (-2214.754) (-2216.068) [-2210.229] -- 0:00:28
892500 -- (-2224.343) (-2215.826) [-2203.772] (-2211.783) * (-2220.224) (-2217.898) [-2211.440] (-2212.286) -- 0:00:28
893000 -- (-2213.955) (-2217.214) (-2213.475) [-2212.534] * (-2208.163) (-2214.601) (-2210.718) [-2216.793] -- 0:00:28
893500 -- (-2218.392) (-2223.940) (-2211.386) [-2210.442] * (-2223.916) (-2228.652) (-2214.250) [-2209.811] -- 0:00:28
894000 -- (-2218.316) (-2213.993) (-2213.017) [-2214.044] * (-2210.158) (-2210.053) (-2213.620) [-2219.820] -- 0:00:27
894500 -- (-2224.508) (-2219.191) (-2218.743) [-2215.169] * (-2211.431) (-2220.157) (-2212.759) [-2215.621] -- 0:00:27
895000 -- (-2230.722) [-2208.983] (-2207.465) (-2212.609) * [-2209.884] (-2220.954) (-2213.797) (-2216.260) -- 0:00:27
Average standard deviation of split frequencies: 0.004654
895500 -- (-2223.668) (-2214.969) (-2219.089) [-2205.858] * (-2211.417) [-2219.504] (-2209.528) (-2224.257) -- 0:00:27
896000 -- (-2219.375) [-2208.252] (-2222.837) (-2212.149) * (-2208.480) (-2214.606) (-2211.647) [-2217.096] -- 0:00:27
896500 -- (-2218.750) (-2222.284) (-2207.831) [-2205.878] * [-2210.125] (-2219.793) (-2212.588) (-2217.877) -- 0:00:27
897000 -- (-2217.375) [-2215.735] (-2220.579) (-2221.642) * (-2217.365) (-2214.603) [-2221.751] (-2221.296) -- 0:00:26
897500 -- (-2211.992) (-2215.558) [-2205.037] (-2212.108) * [-2211.227] (-2212.936) (-2218.679) (-2223.912) -- 0:00:26
898000 -- (-2215.292) [-2217.018] (-2213.098) (-2220.738) * (-2223.449) (-2207.406) [-2218.986] (-2217.192) -- 0:00:26
898500 -- [-2211.847] (-2220.145) (-2205.119) (-2221.683) * (-2229.066) [-2212.750] (-2226.717) (-2212.068) -- 0:00:26
899000 -- (-2206.200) (-2217.066) [-2212.787] (-2215.148) * (-2227.002) [-2210.423] (-2217.993) (-2215.117) -- 0:00:26
899500 -- (-2211.693) (-2214.734) [-2209.326] (-2208.467) * (-2207.495) [-2205.823] (-2225.765) (-2209.895) -- 0:00:26
900000 -- (-2210.713) (-2211.909) (-2219.080) [-2202.916] * [-2214.110] (-2225.484) (-2207.604) (-2211.757) -- 0:00:26
Average standard deviation of split frequencies: 0.004872
900500 -- (-2207.028) (-2226.876) [-2212.424] (-2213.629) * (-2212.187) [-2206.602] (-2215.426) (-2228.230) -- 0:00:26
901000 -- (-2213.108) (-2226.047) (-2216.191) [-2207.859] * [-2204.458] (-2217.797) (-2216.468) (-2213.574) -- 0:00:25
901500 -- [-2215.261] (-2221.395) (-2209.516) (-2214.031) * (-2210.495) (-2222.970) [-2206.597] (-2219.250) -- 0:00:25
902000 -- (-2226.668) (-2223.264) (-2213.526) [-2216.304] * [-2208.502] (-2215.812) (-2223.384) (-2220.768) -- 0:00:25
902500 -- [-2209.205] (-2218.112) (-2206.633) (-2223.539) * (-2206.144) [-2219.509] (-2217.642) (-2219.461) -- 0:00:25
903000 -- (-2217.135) (-2211.053) [-2215.876] (-2224.819) * (-2223.247) (-2224.756) (-2219.357) [-2210.883] -- 0:00:25
903500 -- (-2222.172) (-2209.307) (-2215.700) [-2218.755] * (-2213.263) (-2216.209) (-2202.609) [-2212.070] -- 0:00:25
904000 -- [-2211.518] (-2205.884) (-2218.385) (-2222.108) * (-2214.749) [-2213.686] (-2212.067) (-2205.445) -- 0:00:25
904500 -- [-2205.423] (-2210.313) (-2221.544) (-2214.235) * (-2226.305) [-2207.406] (-2226.277) (-2217.901) -- 0:00:25
905000 -- [-2205.139] (-2215.896) (-2205.777) (-2224.439) * (-2213.364) [-2207.263] (-2226.528) (-2220.230) -- 0:00:24
Average standard deviation of split frequencies: 0.004683
905500 -- (-2213.067) (-2209.490) [-2205.709] (-2225.301) * [-2218.033] (-2217.611) (-2214.239) (-2225.693) -- 0:00:24
906000 -- [-2210.157] (-2218.060) (-2208.172) (-2224.304) * (-2204.493) (-2212.522) (-2226.726) [-2213.968] -- 0:00:24
906500 -- (-2209.244) [-2221.591] (-2212.194) (-2215.649) * (-2211.209) [-2215.177] (-2221.492) (-2221.366) -- 0:00:24
907000 -- (-2222.000) (-2220.541) (-2220.616) [-2213.567] * (-2217.725) (-2218.269) (-2218.550) [-2214.724] -- 0:00:24
907500 -- [-2212.869] (-2223.104) (-2208.701) (-2210.503) * (-2210.478) (-2210.483) (-2211.656) [-2219.872] -- 0:00:24
908000 -- (-2216.539) (-2209.082) (-2214.863) [-2211.214] * (-2214.193) (-2212.347) [-2216.469] (-2224.892) -- 0:00:24
908500 -- (-2216.910) [-2212.269] (-2211.326) (-2215.622) * [-2216.968] (-2212.420) (-2221.114) (-2216.643) -- 0:00:23
909000 -- (-2222.760) (-2212.489) (-2211.612) [-2208.305] * (-2213.151) (-2215.767) [-2210.953] (-2210.631) -- 0:00:23
909500 -- (-2218.743) (-2223.304) (-2224.332) [-2202.708] * (-2218.436) (-2213.283) [-2218.540] (-2220.452) -- 0:00:23
910000 -- [-2213.479] (-2224.922) (-2213.761) (-2216.384) * (-2223.315) (-2202.633) (-2230.835) [-2220.072] -- 0:00:23
Average standard deviation of split frequencies: 0.004619
910500 -- (-2224.003) [-2218.316] (-2217.165) (-2218.718) * (-2216.346) (-2209.389) (-2209.492) [-2213.037] -- 0:00:23
911000 -- (-2215.680) (-2216.713) [-2207.138] (-2213.484) * (-2212.278) (-2215.112) (-2222.681) [-2208.422] -- 0:00:23
911500 -- (-2215.207) (-2219.751) [-2204.051] (-2218.974) * (-2220.183) (-2220.299) [-2207.803] (-2211.751) -- 0:00:23
912000 -- (-2205.743) (-2214.398) (-2207.931) [-2208.145] * (-2213.064) (-2223.133) [-2206.928] (-2216.444) -- 0:00:23
912500 -- (-2212.221) (-2208.460) (-2211.206) [-2208.849] * (-2218.411) (-2213.694) (-2211.536) [-2214.453] -- 0:00:22
913000 -- (-2217.226) (-2212.200) (-2209.095) [-2209.767] * (-2219.549) [-2214.537] (-2214.595) (-2207.635) -- 0:00:22
913500 -- (-2204.780) [-2217.168] (-2214.840) (-2205.701) * (-2217.568) (-2216.052) [-2208.778] (-2217.891) -- 0:00:22
914000 -- (-2211.810) (-2218.146) [-2216.177] (-2213.533) * [-2209.333] (-2213.762) (-2217.661) (-2219.147) -- 0:00:22
914500 -- (-2208.541) [-2220.115] (-2215.041) (-2226.131) * (-2230.244) (-2222.399) [-2211.962] (-2210.360) -- 0:00:22
915000 -- (-2217.978) (-2214.742) [-2211.713] (-2211.791) * (-2221.513) (-2220.225) (-2208.230) [-2215.887] -- 0:00:22
Average standard deviation of split frequencies: 0.004592
915500 -- (-2211.046) [-2210.868] (-2217.209) (-2203.079) * [-2223.019] (-2218.596) (-2213.327) (-2236.569) -- 0:00:22
916000 -- (-2211.913) (-2216.900) (-2219.038) [-2209.658] * (-2218.911) (-2213.257) [-2205.893] (-2221.195) -- 0:00:22
916500 -- [-2202.354] (-2233.659) (-2215.525) (-2217.274) * (-2211.647) (-2220.867) (-2207.980) [-2224.176] -- 0:00:21
917000 -- (-2211.091) (-2224.791) (-2223.754) [-2213.130] * [-2209.885] (-2220.145) (-2224.710) (-2227.009) -- 0:00:21
917500 -- (-2215.266) (-2219.456) [-2216.756] (-2208.578) * [-2220.971] (-2227.547) (-2213.390) (-2223.358) -- 0:00:21
918000 -- (-2215.821) (-2216.455) (-2219.595) [-2218.021] * (-2224.453) (-2220.970) (-2210.330) [-2215.138] -- 0:00:21
918500 -- [-2209.511] (-2216.755) (-2211.281) (-2208.151) * (-2234.467) (-2221.631) (-2218.445) [-2208.188] -- 0:00:21
919000 -- [-2208.014] (-2205.577) (-2221.313) (-2215.714) * (-2239.412) (-2212.579) (-2223.285) [-2208.210] -- 0:00:21
919500 -- (-2207.705) (-2216.628) [-2209.271] (-2223.458) * (-2213.016) [-2212.797] (-2218.248) (-2221.591) -- 0:00:21
920000 -- (-2218.090) [-2215.105] (-2215.175) (-2210.342) * (-2216.732) (-2229.368) (-2210.107) [-2208.850] -- 0:00:20
Average standard deviation of split frequencies: 0.004411
920500 -- (-2223.132) [-2219.706] (-2210.042) (-2206.972) * (-2217.790) [-2215.372] (-2212.474) (-2205.881) -- 0:00:20
921000 -- (-2226.073) [-2209.081] (-2210.229) (-2211.486) * (-2221.262) [-2217.025] (-2214.005) (-2217.190) -- 0:00:20
921500 -- (-2214.447) (-2209.967) [-2221.536] (-2226.222) * (-2207.475) (-2205.437) [-2209.728] (-2214.905) -- 0:00:20
922000 -- (-2208.030) (-2218.721) (-2216.715) [-2206.841] * (-2220.640) (-2210.163) [-2215.155] (-2212.118) -- 0:00:20
922500 -- (-2210.673) (-2226.085) (-2218.064) [-2212.596] * (-2220.549) (-2221.082) [-2216.898] (-2212.249) -- 0:00:20
923000 -- (-2217.576) (-2210.855) (-2206.966) [-2206.273] * (-2218.892) (-2215.903) (-2220.336) [-2204.377] -- 0:00:20
923500 -- (-2223.961) (-2210.105) [-2214.922] (-2207.192) * (-2225.088) (-2207.607) [-2204.478] (-2207.781) -- 0:00:20
924000 -- (-2227.289) (-2217.344) [-2206.739] (-2218.784) * (-2218.214) (-2210.480) [-2213.388] (-2222.759) -- 0:00:19
924500 -- (-2213.142) (-2212.563) (-2215.527) [-2211.021] * (-2226.387) (-2207.295) (-2210.501) [-2216.796] -- 0:00:19
925000 -- (-2208.575) [-2214.903] (-2211.961) (-2219.044) * (-2212.274) (-2205.216) [-2215.973] (-2213.895) -- 0:00:19
Average standard deviation of split frequencies: 0.004777
925500 -- (-2208.267) (-2223.422) (-2211.632) [-2203.636] * (-2217.486) (-2209.378) (-2210.642) [-2212.887] -- 0:00:19
926000 -- (-2214.225) (-2207.751) (-2223.957) [-2205.076] * (-2213.461) [-2211.555] (-2210.556) (-2216.337) -- 0:00:19
926500 -- (-2214.873) [-2207.066] (-2216.525) (-2215.967) * (-2209.466) [-2206.973] (-2211.033) (-2219.407) -- 0:00:19
927000 -- (-2216.245) [-2208.241] (-2215.771) (-2202.041) * (-2208.575) (-2221.690) (-2212.065) [-2209.784] -- 0:00:19
927500 -- [-2211.810] (-2218.495) (-2207.665) (-2214.637) * [-2215.481] (-2207.184) (-2212.294) (-2217.790) -- 0:00:18
928000 -- (-2211.700) (-2218.861) (-2228.117) [-2212.623] * (-2213.010) [-2215.941] (-2213.615) (-2214.551) -- 0:00:18
928500 -- (-2209.449) (-2224.889) [-2219.954] (-2216.082) * [-2207.059] (-2213.158) (-2216.131) (-2217.002) -- 0:00:18
929000 -- [-2217.207] (-2225.461) (-2230.105) (-2218.204) * [-2208.389] (-2220.079) (-2213.453) (-2214.224) -- 0:00:18
929500 -- (-2203.124) (-2220.613) (-2229.741) [-2214.613] * (-2220.554) (-2222.397) [-2208.309] (-2222.476) -- 0:00:18
930000 -- (-2205.538) [-2210.906] (-2231.424) (-2215.968) * (-2213.546) (-2212.359) [-2218.798] (-2225.938) -- 0:00:18
Average standard deviation of split frequencies: 0.004870
930500 -- (-2210.868) [-2213.528] (-2231.055) (-2220.039) * (-2213.705) (-2213.578) [-2212.758] (-2207.739) -- 0:00:18
931000 -- [-2205.456] (-2211.877) (-2239.877) (-2218.883) * (-2212.864) (-2215.550) [-2216.996] (-2213.239) -- 0:00:18
931500 -- (-2205.609) (-2234.053) [-2211.380] (-2219.074) * (-2225.881) (-2216.994) (-2210.968) [-2217.877] -- 0:00:17
932000 -- (-2215.332) (-2225.431) [-2209.942] (-2224.103) * [-2216.627] (-2220.422) (-2212.382) (-2221.106) -- 0:00:17
932500 -- (-2218.081) (-2212.224) [-2218.538] (-2209.431) * [-2215.323] (-2215.609) (-2219.316) (-2230.770) -- 0:00:17
933000 -- (-2210.097) [-2211.825] (-2215.334) (-2218.070) * (-2209.140) [-2204.739] (-2228.951) (-2213.037) -- 0:00:17
933500 -- [-2213.156] (-2214.684) (-2214.541) (-2210.349) * (-2214.858) (-2210.833) (-2216.433) [-2208.846] -- 0:00:17
934000 -- (-2211.240) [-2206.001] (-2222.955) (-2215.725) * (-2222.109) (-2220.566) [-2213.364] (-2213.187) -- 0:00:17
934500 -- (-2213.042) (-2212.924) (-2213.542) [-2215.469] * (-2224.796) (-2205.109) [-2215.591] (-2218.996) -- 0:00:17
935000 -- [-2213.228] (-2225.122) (-2214.412) (-2218.673) * (-2210.301) (-2213.284) (-2209.683) [-2215.954] -- 0:00:17
Average standard deviation of split frequencies: 0.004610
935500 -- (-2211.979) (-2223.417) (-2207.460) [-2216.458] * (-2217.652) [-2206.965] (-2216.026) (-2224.734) -- 0:00:16
936000 -- [-2212.176] (-2217.050) (-2223.296) (-2213.593) * [-2201.463] (-2219.075) (-2212.446) (-2217.836) -- 0:00:16
936500 -- (-2218.989) (-2216.278) [-2205.729] (-2208.001) * (-2220.911) (-2224.282) (-2211.016) [-2214.614] -- 0:00:16
937000 -- (-2214.851) (-2210.425) [-2208.805] (-2223.987) * (-2215.819) [-2209.334] (-2210.745) (-2230.911) -- 0:00:16
937500 -- [-2208.597] (-2212.258) (-2210.975) (-2223.321) * (-2213.156) [-2212.886] (-2208.431) (-2224.875) -- 0:00:16
938000 -- (-2215.749) (-2215.636) (-2217.661) [-2221.966] * (-2218.038) [-2212.419] (-2216.812) (-2210.008) -- 0:00:16
938500 -- (-2207.714) [-2204.912] (-2217.616) (-2219.151) * (-2215.905) (-2203.812) [-2216.955] (-2227.830) -- 0:00:16
939000 -- (-2208.645) (-2214.115) (-2220.073) [-2213.557] * (-2213.478) [-2210.274] (-2214.663) (-2209.329) -- 0:00:15
939500 -- (-2212.977) [-2210.748] (-2221.122) (-2217.535) * (-2218.953) (-2210.995) (-2207.724) [-2208.961] -- 0:00:15
940000 -- (-2218.597) [-2214.745] (-2214.721) (-2207.914) * (-2208.004) (-2210.449) (-2213.572) [-2205.205] -- 0:00:15
Average standard deviation of split frequencies: 0.004433
940500 -- (-2211.167) [-2213.867] (-2217.413) (-2213.302) * [-2205.545] (-2209.213) (-2213.819) (-2221.383) -- 0:00:15
941000 -- [-2208.079] (-2204.836) (-2217.596) (-2217.872) * (-2229.353) (-2218.859) [-2204.363] (-2217.630) -- 0:00:15
941500 -- (-2207.342) [-2215.412] (-2212.774) (-2212.717) * (-2211.448) (-2222.383) [-2203.709] (-2219.204) -- 0:00:15
942000 -- (-2208.899) [-2218.110] (-2213.141) (-2208.593) * (-2210.514) [-2215.716] (-2212.637) (-2206.959) -- 0:00:15
942500 -- (-2215.330) (-2209.082) (-2214.746) [-2216.513] * [-2219.988] (-2237.481) (-2214.490) (-2228.529) -- 0:00:15
943000 -- (-2221.177) [-2216.486] (-2208.008) (-2219.362) * [-2214.323] (-2219.428) (-2213.231) (-2211.083) -- 0:00:14
943500 -- (-2210.991) (-2203.536) [-2207.591] (-2209.968) * (-2210.437) (-2229.895) (-2211.757) [-2225.398] -- 0:00:14
944000 -- (-2227.260) (-2210.332) [-2208.467] (-2223.305) * [-2209.022] (-2220.842) (-2215.198) (-2213.725) -- 0:00:14
944500 -- (-2208.425) [-2208.044] (-2215.929) (-2220.203) * (-2218.609) (-2214.681) [-2204.687] (-2219.016) -- 0:00:14
945000 -- [-2209.979] (-2208.137) (-2216.332) (-2219.182) * (-2208.364) (-2206.650) (-2211.051) [-2209.066] -- 0:00:14
Average standard deviation of split frequencies: 0.004178
945500 -- (-2211.669) (-2204.659) [-2213.899] (-2220.555) * [-2210.463] (-2206.164) (-2216.995) (-2225.414) -- 0:00:14
946000 -- (-2205.035) (-2217.106) [-2215.195] (-2210.776) * [-2206.527] (-2218.239) (-2208.197) (-2219.415) -- 0:00:14
946500 -- (-2216.103) [-2212.385] (-2214.159) (-2224.648) * (-2213.128) (-2210.932) [-2213.144] (-2217.940) -- 0:00:14
947000 -- [-2210.162] (-2210.521) (-2223.344) (-2212.462) * (-2215.520) (-2214.741) [-2224.039] (-2216.530) -- 0:00:13
947500 -- (-2208.503) (-2207.053) [-2213.480] (-2210.518) * (-2204.822) (-2218.597) [-2218.169] (-2235.232) -- 0:00:13
948000 -- (-2212.669) (-2228.412) (-2216.975) [-2209.101] * (-2213.480) [-2206.483] (-2223.146) (-2215.453) -- 0:00:13
948500 -- [-2210.510] (-2217.243) (-2215.273) (-2219.860) * (-2210.124) (-2216.222) (-2215.004) [-2212.367] -- 0:00:13
949000 -- (-2205.342) [-2211.839] (-2204.364) (-2215.459) * [-2206.966] (-2218.404) (-2205.285) (-2216.417) -- 0:00:13
949500 -- [-2202.798] (-2216.939) (-2214.546) (-2220.551) * [-2218.030] (-2220.573) (-2211.324) (-2207.756) -- 0:00:13
950000 -- (-2209.705) [-2207.764] (-2211.616) (-2226.805) * (-2213.385) [-2214.194] (-2219.383) (-2224.083) -- 0:00:13
Average standard deviation of split frequencies: 0.004387
950500 -- (-2209.231) [-2213.686] (-2212.892) (-2217.935) * (-2221.670) (-2216.683) [-2205.939] (-2226.139) -- 0:00:12
951000 -- (-2223.204) [-2210.514] (-2210.669) (-2210.683) * (-2221.962) [-2214.533] (-2213.073) (-2216.210) -- 0:00:12
951500 -- (-2217.514) (-2215.150) (-2219.787) [-2213.878] * (-2214.926) (-2214.489) (-2210.601) [-2207.863] -- 0:00:12
952000 -- (-2215.333) (-2213.468) [-2218.900] (-2223.416) * (-2214.169) (-2215.594) [-2211.970] (-2216.095) -- 0:00:12
952500 -- (-2217.512) [-2222.566] (-2213.580) (-2234.696) * [-2213.771] (-2217.873) (-2216.007) (-2220.797) -- 0:00:12
953000 -- [-2209.879] (-2213.183) (-2216.085) (-2233.549) * (-2221.966) (-2234.828) (-2220.262) [-2225.234] -- 0:00:12
953500 -- (-2227.337) (-2219.811) [-2215.472] (-2219.048) * (-2214.880) [-2211.826] (-2217.051) (-2216.428) -- 0:00:12
954000 -- (-2227.280) [-2217.554] (-2215.648) (-2217.539) * [-2200.968] (-2214.147) (-2219.645) (-2216.129) -- 0:00:12
954500 -- (-2210.759) (-2206.668) [-2210.827] (-2219.881) * (-2218.874) (-2213.069) [-2216.229] (-2212.543) -- 0:00:11
955000 -- (-2218.950) (-2209.124) [-2211.123] (-2218.681) * (-2210.376) [-2208.777] (-2209.447) (-2222.330) -- 0:00:11
Average standard deviation of split frequencies: 0.004248
955500 -- [-2219.097] (-2216.139) (-2211.321) (-2213.798) * [-2215.779] (-2209.664) (-2227.037) (-2214.362) -- 0:00:11
956000 -- (-2215.949) (-2208.664) [-2209.652] (-2213.012) * (-2210.417) (-2211.153) [-2216.736] (-2218.555) -- 0:00:11
956500 -- (-2215.972) [-2211.228] (-2221.290) (-2217.056) * (-2208.409) [-2210.889] (-2222.708) (-2220.283) -- 0:00:11
957000 -- [-2219.214] (-2219.303) (-2217.155) (-2215.511) * (-2208.373) [-2211.251] (-2208.332) (-2207.577) -- 0:00:11
957500 -- (-2206.192) (-2223.487) [-2215.321] (-2232.496) * (-2216.773) (-2206.978) (-2216.863) [-2208.554] -- 0:00:11
958000 -- [-2210.024] (-2213.852) (-2213.632) (-2216.818) * (-2210.315) [-2212.118] (-2215.553) (-2214.364) -- 0:00:11
958500 -- (-2231.391) (-2212.341) [-2208.611] (-2209.072) * (-2211.109) (-2211.717) [-2212.219] (-2221.058) -- 0:00:10
959000 -- (-2218.705) (-2211.308) [-2209.198] (-2213.140) * (-2203.115) (-2225.958) [-2208.696] (-2228.931) -- 0:00:10
959500 -- [-2212.641] (-2210.301) (-2211.400) (-2216.704) * (-2213.164) (-2219.526) [-2214.888] (-2223.609) -- 0:00:10
960000 -- (-2227.815) (-2211.438) (-2207.564) [-2209.434] * (-2224.433) (-2213.187) (-2208.099) [-2213.472] -- 0:00:10
Average standard deviation of split frequencies: 0.004454
960500 -- (-2219.840) (-2206.908) (-2215.029) [-2205.493] * (-2216.812) (-2214.983) [-2206.550] (-2211.029) -- 0:00:10
961000 -- (-2212.829) (-2221.950) (-2210.989) [-2222.033] * (-2218.962) (-2219.072) (-2205.515) [-2212.290] -- 0:00:10
961500 -- (-2215.005) (-2214.594) (-2207.384) [-2215.046] * (-2208.797) [-2217.318] (-2206.981) (-2210.280) -- 0:00:10
962000 -- (-2220.997) (-2229.353) [-2214.605] (-2214.190) * (-2216.515) [-2210.871] (-2211.134) (-2207.221) -- 0:00:09
962500 -- (-2216.176) (-2221.134) (-2209.347) [-2213.597] * (-2210.386) (-2217.286) [-2210.735] (-2210.563) -- 0:00:09
963000 -- (-2205.474) (-2208.644) (-2212.693) [-2207.206] * (-2204.112) (-2216.120) [-2214.206] (-2216.969) -- 0:00:09
963500 -- (-2211.742) (-2212.150) [-2209.936] (-2220.567) * (-2217.877) [-2220.037] (-2208.471) (-2218.849) -- 0:00:09
964000 -- (-2216.815) (-2206.428) [-2207.348] (-2221.266) * [-2211.787] (-2220.906) (-2209.886) (-2202.446) -- 0:00:09
964500 -- (-2220.160) [-2213.834] (-2206.300) (-2217.691) * [-2209.415] (-2214.462) (-2222.530) (-2208.632) -- 0:00:09
965000 -- (-2211.085) [-2207.989] (-2217.276) (-2220.395) * (-2211.362) (-2213.370) (-2213.267) [-2212.401] -- 0:00:09
Average standard deviation of split frequencies: 0.004317
965500 -- (-2209.296) (-2212.540) (-2222.302) [-2216.688] * (-2212.771) [-2215.061] (-2224.432) (-2218.836) -- 0:00:09
966000 -- (-2214.754) (-2208.218) [-2210.652] (-2220.660) * [-2212.302] (-2212.805) (-2219.371) (-2223.358) -- 0:00:08
966500 -- (-2213.057) (-2216.787) [-2201.175] (-2207.915) * [-2218.644] (-2211.105) (-2214.789) (-2225.065) -- 0:00:08
967000 -- (-2226.168) (-2215.877) [-2206.024] (-2209.357) * (-2228.967) (-2210.827) [-2209.398] (-2213.000) -- 0:00:08
967500 -- (-2212.616) [-2208.455] (-2210.352) (-2216.450) * (-2213.703) (-2212.767) [-2206.660] (-2218.806) -- 0:00:08
968000 -- [-2209.443] (-2212.420) (-2217.867) (-2206.100) * (-2223.549) (-2207.241) (-2228.239) [-2208.930] -- 0:00:08
968500 -- [-2213.259] (-2212.315) (-2217.747) (-2206.002) * [-2211.050] (-2219.952) (-2224.019) (-2225.058) -- 0:00:08
969000 -- (-2214.601) [-2214.348] (-2221.847) (-2211.734) * (-2217.999) [-2216.312] (-2206.266) (-2219.563) -- 0:00:08
969500 -- (-2211.883) [-2210.201] (-2220.874) (-2222.854) * (-2215.261) (-2210.571) [-2207.872] (-2213.988) -- 0:00:07
970000 -- (-2213.890) [-2224.102] (-2218.292) (-2216.432) * (-2210.251) (-2219.216) [-2217.386] (-2226.932) -- 0:00:07
Average standard deviation of split frequencies: 0.004483
970500 -- (-2216.073) (-2205.122) (-2220.949) [-2214.215] * [-2206.455] (-2209.096) (-2214.344) (-2218.595) -- 0:00:07
971000 -- (-2214.954) (-2217.438) [-2211.777] (-2204.802) * (-2213.706) (-2211.580) [-2207.462] (-2212.330) -- 0:00:07
971500 -- [-2209.602] (-2215.875) (-2216.098) (-2206.007) * (-2224.076) (-2207.803) (-2215.197) [-2218.020] -- 0:00:07
972000 -- (-2211.238) (-2217.360) [-2214.386] (-2214.357) * (-2215.197) (-2210.099) [-2204.984] (-2225.765) -- 0:00:07
972500 -- [-2214.080] (-2225.441) (-2222.388) (-2210.696) * (-2214.395) [-2213.213] (-2217.239) (-2217.908) -- 0:00:07
973000 -- (-2220.554) [-2212.274] (-2211.481) (-2209.289) * (-2211.895) (-2216.520) (-2212.779) [-2216.978] -- 0:00:07
973500 -- (-2217.390) (-2220.954) (-2211.358) [-2213.827] * (-2204.174) (-2213.818) [-2208.044] (-2220.554) -- 0:00:06
974000 -- (-2212.628) [-2206.454] (-2223.006) (-2226.010) * (-2212.792) (-2218.550) (-2216.701) [-2210.558] -- 0:00:06
974500 -- (-2205.660) (-2210.986) (-2221.398) [-2217.067] * [-2208.744] (-2226.108) (-2217.154) (-2213.469) -- 0:00:06
975000 -- (-2207.819) (-2211.492) (-2217.415) [-2213.333] * (-2209.025) [-2226.085] (-2212.416) (-2210.266) -- 0:00:06
Average standard deviation of split frequencies: 0.004681
975500 -- [-2217.007] (-2219.139) (-2212.501) (-2217.009) * (-2223.459) (-2209.891) (-2216.355) [-2208.499] -- 0:00:06
976000 -- [-2210.885] (-2211.649) (-2210.447) (-2225.597) * (-2210.666) [-2210.860] (-2206.167) (-2213.962) -- 0:00:06
976500 -- [-2211.072] (-2214.618) (-2219.760) (-2229.199) * (-2208.136) (-2209.540) (-2218.232) [-2217.596] -- 0:00:06
977000 -- (-2214.406) [-2205.458] (-2216.568) (-2213.768) * (-2209.823) (-2207.463) (-2221.029) [-2215.077] -- 0:00:06
977500 -- [-2216.589] (-2208.110) (-2210.169) (-2219.197) * [-2211.279] (-2213.237) (-2216.000) (-2211.741) -- 0:00:05
978000 -- (-2216.424) (-2210.972) [-2213.805] (-2221.864) * [-2215.450] (-2209.682) (-2228.588) (-2224.492) -- 0:00:05
978500 -- (-2220.395) (-2215.415) (-2208.325) [-2217.368] * (-2209.165) (-2217.285) (-2206.663) [-2212.264] -- 0:00:05
979000 -- (-2206.138) (-2224.807) (-2224.132) [-2209.881] * [-2208.186] (-2227.416) (-2215.028) (-2217.396) -- 0:00:05
979500 -- (-2224.113) (-2216.530) [-2212.995] (-2212.893) * [-2208.524] (-2221.559) (-2207.003) (-2220.302) -- 0:00:05
980000 -- (-2220.821) [-2214.782] (-2218.586) (-2220.175) * (-2211.357) (-2214.146) [-2205.081] (-2217.167) -- 0:00:05
Average standard deviation of split frequencies: 0.004548
980500 -- (-2230.825) [-2208.673] (-2217.902) (-2215.440) * (-2206.983) (-2222.400) [-2213.785] (-2213.203) -- 0:00:05
981000 -- (-2220.908) (-2209.196) [-2209.732] (-2220.403) * [-2200.353] (-2208.697) (-2207.742) (-2211.555) -- 0:00:04
981500 -- (-2234.239) [-2209.187] (-2210.440) (-2216.571) * [-2211.107] (-2208.424) (-2211.310) (-2210.519) -- 0:00:04
982000 -- (-2217.226) (-2216.989) [-2210.817] (-2213.711) * (-2209.426) [-2204.212] (-2219.997) (-2217.919) -- 0:00:04
982500 -- (-2216.266) [-2224.697] (-2213.707) (-2216.018) * [-2210.104] (-2210.635) (-2210.563) (-2211.280) -- 0:00:04
983000 -- [-2211.507] (-2208.157) (-2215.139) (-2212.842) * [-2207.184] (-2209.265) (-2208.959) (-2222.966) -- 0:00:04
983500 -- (-2215.377) (-2216.073) (-2221.824) [-2214.452] * (-2216.818) [-2208.186] (-2209.578) (-2225.748) -- 0:00:04
984000 -- [-2212.794] (-2220.799) (-2212.772) (-2215.077) * (-2212.218) (-2206.327) (-2209.232) [-2219.534] -- 0:00:04
984500 -- (-2221.330) [-2206.583] (-2208.332) (-2220.333) * (-2215.580) [-2216.788] (-2207.759) (-2215.584) -- 0:00:04
985000 -- (-2216.779) (-2210.021) [-2207.872] (-2213.515) * (-2210.458) [-2218.827] (-2204.906) (-2216.585) -- 0:00:03
Average standard deviation of split frequencies: 0.004524
985500 -- (-2216.547) (-2216.626) (-2215.884) [-2210.905] * (-2206.702) (-2214.018) [-2204.415] (-2215.477) -- 0:00:03
986000 -- (-2225.890) (-2218.107) [-2214.069] (-2222.736) * (-2210.528) (-2214.192) [-2211.214] (-2218.843) -- 0:00:03
986500 -- (-2218.003) [-2210.500] (-2212.898) (-2217.021) * (-2209.549) [-2215.846] (-2215.644) (-2211.397) -- 0:00:03
987000 -- (-2208.492) (-2223.243) (-2214.127) [-2209.208] * (-2216.185) (-2220.405) (-2214.047) [-2213.556] -- 0:00:03
987500 -- (-2213.934) (-2220.399) (-2219.963) [-2212.306] * (-2205.129) (-2214.491) [-2208.277] (-2210.134) -- 0:00:03
988000 -- (-2218.475) [-2213.719] (-2216.285) (-2210.619) * [-2204.931] (-2222.403) (-2215.326) (-2214.881) -- 0:00:03
988500 -- (-2221.244) [-2214.407] (-2214.084) (-2216.304) * (-2208.067) (-2212.172) (-2232.147) [-2212.833] -- 0:00:03
989000 -- (-2211.308) (-2209.827) [-2210.015] (-2209.126) * (-2218.128) (-2216.043) [-2223.920] (-2214.670) -- 0:00:02
989500 -- [-2204.846] (-2210.884) (-2217.715) (-2210.179) * (-2210.796) (-2218.340) [-2211.216] (-2207.729) -- 0:00:02
990000 -- (-2208.674) (-2212.883) [-2219.086] (-2218.307) * (-2225.675) (-2219.029) (-2213.549) [-2217.059] -- 0:00:02
Average standard deviation of split frequencies: 0.004978
990500 -- (-2207.128) (-2217.903) (-2208.060) [-2219.061] * (-2217.190) [-2215.611] (-2220.478) (-2216.424) -- 0:00:02
991000 -- [-2209.368] (-2233.921) (-2220.485) (-2219.980) * (-2219.918) [-2212.505] (-2212.774) (-2207.148) -- 0:00:02
991500 -- (-2220.967) (-2205.852) (-2214.767) [-2211.712] * (-2214.189) (-2219.864) [-2224.975] (-2205.636) -- 0:00:02
992000 -- (-2221.454) (-2207.984) [-2212.571] (-2217.049) * (-2221.903) [-2206.513] (-2220.874) (-2209.894) -- 0:00:02
992500 -- (-2208.727) [-2200.821] (-2214.124) (-2207.248) * (-2212.070) (-2220.039) [-2211.621] (-2207.225) -- 0:00:01
993000 -- (-2228.583) [-2209.940] (-2216.094) (-2212.037) * (-2208.830) [-2218.195] (-2214.441) (-2209.890) -- 0:00:01
993500 -- (-2215.571) (-2209.844) (-2207.503) [-2208.180] * (-2222.541) (-2213.818) [-2206.335] (-2214.355) -- 0:00:01
994000 -- [-2216.469] (-2218.870) (-2213.448) (-2219.792) * (-2218.800) [-2211.477] (-2210.392) (-2224.376) -- 0:00:01
994500 -- [-2219.789] (-2218.498) (-2213.855) (-2209.720) * (-2221.858) (-2212.674) [-2206.557] (-2217.342) -- 0:00:01
995000 -- (-2208.212) (-2218.102) [-2211.574] (-2211.817) * (-2210.365) (-2208.554) (-2214.945) [-2210.930] -- 0:00:01
Average standard deviation of split frequencies: 0.004842
995500 -- (-2214.974) (-2209.902) [-2217.014] (-2212.531) * (-2214.324) [-2219.807] (-2208.743) (-2208.471) -- 0:00:01
996000 -- [-2211.355] (-2218.425) (-2235.876) (-2219.581) * (-2217.628) (-2212.286) (-2209.915) [-2220.246] -- 0:00:01
996500 -- (-2216.630) [-2214.678] (-2220.192) (-2207.261) * (-2214.173) (-2215.387) [-2209.311] (-2221.103) -- 0:00:00
997000 -- [-2213.502] (-2218.844) (-2222.890) (-2214.857) * [-2213.067] (-2225.720) (-2218.452) (-2214.877) -- 0:00:00
997500 -- [-2212.348] (-2216.018) (-2211.938) (-2208.751) * [-2203.882] (-2230.793) (-2211.109) (-2210.806) -- 0:00:00
998000 -- (-2217.264) [-2205.174] (-2206.562) (-2221.650) * (-2218.398) [-2213.441] (-2215.129) (-2210.755) -- 0:00:00
998500 -- (-2218.323) (-2211.603) [-2212.913] (-2220.569) * (-2213.264) (-2209.776) [-2211.111] (-2211.912) -- 0:00:00
999000 -- (-2213.534) (-2217.292) (-2207.866) [-2214.600] * [-2209.858] (-2212.714) (-2219.105) (-2231.131) -- 0:00:00
999500 -- [-2204.481] (-2233.571) (-2222.488) (-2224.510) * [-2213.263] (-2210.429) (-2216.767) (-2218.652) -- 0:00:00
1000000 -- (-2218.972) (-2227.884) [-2209.585] (-2209.904) * (-2216.563) (-2223.925) (-2210.066) [-2207.678] -- 0:00:00
Average standard deviation of split frequencies: 0.004747
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -2218.971887 -- 26.173721
Chain 1 -- -2218.971887 -- 26.173721
Chain 2 -- -2227.884091 -- 23.644195
Chain 2 -- -2227.884083 -- 23.644195
Chain 3 -- -2209.585089 -- 23.368246
Chain 3 -- -2209.585084 -- 23.368246
Chain 4 -- -2209.903509 -- 25.765990
Chain 4 -- -2209.903509 -- 25.765990
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -2216.563230 -- 26.299264
Chain 1 -- -2216.563229 -- 26.299264
Chain 2 -- -2223.924966 -- 26.767528
Chain 2 -- -2223.924962 -- 26.767528
Chain 3 -- -2210.065938 -- 25.315649
Chain 3 -- -2210.065946 -- 25.315649
Chain 4 -- -2207.678437 -- 23.173485
Chain 4 -- -2207.678436 -- 23.173485
Analysis completed in 4 mins 21 seconds
Analysis used 260.91 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -2196.61
Likelihood of best state for "cold" chain of run 2 was -2197.23
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
49.4 % ( 40 %) Dirichlet(Revmat{all})
65.1 % ( 52 %) Slider(Revmat{all})
24.4 % ( 39 %) Dirichlet(Pi{all})
26.8 % ( 24 %) Slider(Pi{all})
56.1 % ( 31 %) Multiplier(Alpha{1,2})
46.5 % ( 25 %) Multiplier(Alpha{3})
34.3 % ( 25 %) Slider(Pinvar{all})
16.9 % ( 11 %) ExtSPR(Tau{all},V{all})
5.9 % ( 3 %) ExtTBR(Tau{all},V{all})
23.2 % ( 25 %) NNI(Tau{all},V{all})
22.2 % ( 24 %) ParsSPR(Tau{all},V{all})
26.9 % ( 31 %) Multiplier(V{all})
41.1 % ( 45 %) Nodeslider(V{all})
25.9 % ( 34 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
49.4 % ( 38 %) Dirichlet(Revmat{all})
65.5 % ( 57 %) Slider(Revmat{all})
24.8 % ( 21 %) Dirichlet(Pi{all})
27.0 % ( 24 %) Slider(Pi{all})
56.5 % ( 23 %) Multiplier(Alpha{1,2})
45.7 % ( 18 %) Multiplier(Alpha{3})
34.2 % ( 18 %) Slider(Pinvar{all})
17.0 % ( 22 %) ExtSPR(Tau{all},V{all})
5.9 % ( 13 %) ExtTBR(Tau{all},V{all})
23.4 % ( 22 %) NNI(Tau{all},V{all})
22.1 % ( 26 %) ParsSPR(Tau{all},V{all})
26.8 % ( 25 %) Multiplier(V{all})
41.4 % ( 34 %) Nodeslider(V{all})
26.0 % ( 25 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.53 0.36
2 | 166719 0.76 0.56
3 | 166590 166544 0.78
4 | 166436 166749 166962
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.75 0.53 0.37
2 | 166791 0.76 0.56
3 | 166699 166969 0.78
4 | 166322 166719 166500
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -2209.46
| 2 2 |
| 2 2 2 1 1 |
| 2 1 1 1 2 |
| 1 2 1 2 1 1 2 222 1 2 |
| 22 1 121 11 |
| 1* 1 212 11 2 1 1 1 |
| 1 2 1 11 2 1* 2 1 2 1 1 |
|2 2* 2 1 2 2 2 1 1 1 11 * 221|
|1 1 1 2 2 11 2 2 12 2 1 |
| 22 2 2 1 *2 2 2|
| 1 1 21 1 1 2 2 |
| 2 2 1 2 |
| 1 2 1 |
| 1 |
| 2 2 2 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -2214.15
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -2205.14 -2234.73
2 -2205.13 -2227.23
--------------------------------------
TOTAL -2205.13 -2234.03
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.315640 0.002686 0.220082 0.419878 0.311040 1342.86 1397.50 1.000
r(A<->C){all} 0.084137 0.001062 0.026188 0.149870 0.081130 860.03 882.14 1.000
r(A<->G){all} 0.260029 0.003798 0.142199 0.383183 0.255847 474.75 503.62 1.000
r(A<->T){all} 0.154218 0.002365 0.061459 0.245359 0.150074 788.27 808.38 1.000
r(C<->G){all} 0.062829 0.000441 0.024025 0.103231 0.060868 1061.61 1097.43 1.000
r(C<->T){all} 0.428427 0.004877 0.283915 0.562519 0.425465 400.97 470.37 1.000
r(G<->T){all} 0.010360 0.000104 0.000005 0.030362 0.007333 767.88 1011.12 1.001
pi(A){all} 0.243038 0.000143 0.220112 0.266212 0.243037 1043.84 1231.93 1.000
pi(C){all} 0.304775 0.000173 0.280382 0.331174 0.304813 1233.28 1278.59 1.000
pi(G){all} 0.264682 0.000163 0.240607 0.289446 0.264418 1161.02 1182.99 1.000
pi(T){all} 0.187505 0.000114 0.166301 0.208142 0.187633 1202.69 1207.14 1.000
alpha{1,2} 0.052249 0.000835 0.000353 0.097377 0.054898 965.52 1024.45 1.000
alpha{3} 2.312694 0.667555 1.002374 3.978123 2.176054 1219.79 1360.39 1.001
pinvar{all} 0.774445 0.000684 0.723657 0.825007 0.775335 1102.25 1301.62 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
----------------
1 -- .*********
2 -- .*........
3 -- ..*.......
4 -- ...*......
5 -- ....*.....
6 -- .....*....
7 -- ......*...
8 -- .......*..
9 -- ........*.
10 -- .........*
11 -- ....******
12 -- ........**
13 -- ...*******
14 -- .....**.**
15 -- ..********
16 -- .....**...
17 -- .....*****
18 -- ....*..*..
19 -- ....***.**
20 -- .....*..**
21 -- ......*.**
22 -- .**.......
23 -- .*.*******
----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
11 3002 1.000000 0.000000 1.000000 1.000000 2
12 3002 1.000000 0.000000 1.000000 1.000000 2
13 2999 0.999001 0.000471 0.998668 0.999334 2
14 2692 0.896736 0.010364 0.889407 0.904064 2
15 2238 0.745503 0.001884 0.744171 0.746835 2
16 2062 0.686875 0.006595 0.682212 0.691539 2
17 1195 0.398068 0.013662 0.388408 0.407728 2
18 903 0.300799 0.003298 0.298468 0.303131 2
19 826 0.275150 0.005653 0.271153 0.279147 2
20 401 0.133578 0.001413 0.132578 0.134577 2
21 393 0.130913 0.003298 0.128581 0.133245 2
22 390 0.129913 0.008480 0.123917 0.135909 2
23 374 0.124584 0.006595 0.119920 0.129247 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/acj6-PE/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.017195 0.000040 0.007058 0.030617 0.016360 1.000 2
length{all}[2] 0.003625 0.000008 0.000000 0.009073 0.002922 1.000 2
length{all}[3] 0.002041 0.000004 0.000000 0.006231 0.001415 1.000 2
length{all}[4] 0.004751 0.000014 0.000001 0.011878 0.003945 1.000 2
length{all}[5] 0.034781 0.000154 0.013541 0.060870 0.033178 1.000 2
length{all}[6] 0.019048 0.000054 0.006489 0.033770 0.017982 1.000 2
length{all}[7] 0.007043 0.000019 0.000635 0.015685 0.006152 1.000 2
length{all}[8] 0.091731 0.000669 0.048960 0.144848 0.088004 1.000 2
length{all}[9] 0.011552 0.000038 0.001450 0.024057 0.010545 1.000 2
length{all}[10] 0.016340 0.000054 0.003736 0.030410 0.015215 1.001 2
length{all}[11] 0.038154 0.000174 0.015647 0.063553 0.036093 1.000 2
length{all}[12] 0.030676 0.000130 0.011295 0.054756 0.029229 1.000 2
length{all}[13] 0.010587 0.000027 0.002255 0.020755 0.009809 1.000 2
length{all}[14] 0.012968 0.000047 0.002079 0.026802 0.011903 1.000 2
length{all}[15] 0.003397 0.000007 0.000003 0.008265 0.002833 1.000 2
length{all}[16] 0.006595 0.000027 0.000003 0.016920 0.005457 1.000 2
length{all}[17] 0.007421 0.000043 0.000016 0.019836 0.005779 0.999 2
length{all}[18] 0.005849 0.000032 0.000009 0.015929 0.004091 0.999 2
length{all}[19] 0.006816 0.000037 0.000009 0.019126 0.005173 0.999 2
length{all}[20] 0.003100 0.000009 0.000002 0.008330 0.002476 0.998 2
length{all}[21] 0.002921 0.000008 0.000013 0.008586 0.002015 0.999 2
length{all}[22] 0.002261 0.000007 0.000013 0.007664 0.001477 0.997 2
length{all}[23] 0.001846 0.000003 0.000002 0.005585 0.001365 1.006 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.004747
Maximum standard deviation of split frequencies = 0.013662
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.006
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C2 (2)
|
+ /---------------------------------------------------------- C3 (3)
| |
| | /----------------------------------------------- C4 (4)
\-----75----+ |
| | /----------------------------------- C5 (5)
| | |
\----100---+ | /------------ C6 (6)
| | /----69----+
| | | \------------ C7 (7)
\----100----+-----90----+
| | /------------ C9 (9)
| \----100---+
| \------------ C10 (10)
|
\----------------------------------- C8 (8)
Phylogram (based on average branch lengths):
/--------- C1 (1)
|
|-- C2 (2)
|
+/- C3 (3)
||
|| /-- C4 (4)
\+ |
| | /----------------- C5 (5)
| | |
\-----+ | /--------- C6 (6)
| | /--+
| | | \--- C7 (7)
\------------------+-----+
| | /------ C9 (9)
| \--------------+
| \-------- C10 (10)
|
\---------------------------------------------- C8 (8)
|---------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (96 trees sampled):
50 % credible set contains 4 trees
90 % credible set contains 23 trees
95 % credible set contains 34 trees
99 % credible set contains 67 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 10 ls = 1125
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Sequences read..
Counting site patterns.. 0:00
132 patterns at 375 / 375 sites (100.0%), 0:00
Counting codons..
360 bytes for distance
128832 bytes for conP
17952 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, 10)), 8)))); MP score: 116
450912 bytes for conP, adjusted
0.019968 0.004590 0.001595 0.001085 0.010013 0.005951 0.038161 0.042020 0.007824 0.006014 0.020343 0.009828 0.025766 0.015482 0.017524 0.077748 0.300000 1.300000
ntime & nrate & np: 16 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 18
lnL0 = -2383.944986
Iterating by ming2
Initial: fx= 2383.944986
x= 0.01997 0.00459 0.00159 0.00109 0.01001 0.00595 0.03816 0.04202 0.00782 0.00601 0.02034 0.00983 0.02577 0.01548 0.01752 0.07775 0.30000 1.30000
1 h-m-p 0.0000 0.0000 652.7080 ++ 2382.846908 m 0.0000 23 | 1/18
2 h-m-p 0.0000 0.0000 668.9357 +YYCCCC 2381.766115 5 0.0000 53 | 1/18
3 h-m-p 0.0000 0.0000 442.1657 +YYCCCC 2379.782331 5 0.0000 83 | 1/18
4 h-m-p 0.0000 0.0001 991.3303 +CYCCC 2369.841759 4 0.0001 113 | 1/18
5 h-m-p 0.0000 0.0000 3599.4619 +CCYC 2360.709223 3 0.0000 140 | 1/18
6 h-m-p 0.0000 0.0000 2503.8332 +YYYYC 2350.758959 4 0.0000 166 | 1/18
7 h-m-p 0.0000 0.0001 2876.6524 +YYYYCC 2336.906149 5 0.0000 194 | 1/18
8 h-m-p 0.0000 0.0000 10060.1950 +YCYCCC 2326.787518 5 0.0000 224 | 1/18
9 h-m-p 0.0000 0.0001 1451.3741 +YCYCCC 2321.108319 5 0.0000 254 | 1/18
10 h-m-p 0.0000 0.0001 970.1482 YCYCCC 2313.644914 5 0.0001 283 | 1/18
11 h-m-p 0.0001 0.0003 238.8571 CC 2312.946337 1 0.0001 306 | 1/18
12 h-m-p 0.0001 0.0007 239.7246 +YCCCCC 2309.544673 5 0.0003 337 | 1/18
13 h-m-p 0.0000 0.0002 1872.5585 +YYYYYYCCCC 2294.331683 10 0.0001 372 | 1/18
14 h-m-p 0.0000 0.0001 5127.8424 ++ 2205.005585 m 0.0001 393 | 1/18
15 h-m-p 0.0008 0.0039 4.6242 YCC 2198.194823 2 0.0018 417 | 1/18
16 h-m-p 0.0000 0.0001 628.2706 CYCC 2195.590656 3 0.0000 443 | 1/18
17 h-m-p 0.0000 0.0001 250.8066 YCCC 2195.396590 3 0.0000 469 | 1/18
18 h-m-p 0.0001 0.0085 16.8417 ++YCC 2194.848790 2 0.0014 495 | 1/18
19 h-m-p 0.0118 0.0638 2.0081 +CYC 2170.395146 2 0.0446 520 | 1/18
20 h-m-p 0.1227 0.6136 0.1563 +YYCCCC 2153.423212 5 0.4071 550 | 1/18
21 h-m-p 0.0454 0.2268 0.4078 +YYCYCC 2142.148079 5 0.1578 596 | 1/18
22 h-m-p 0.2436 1.2181 0.0904 +YYYCC 2137.140977 4 0.9246 640 | 1/18
23 h-m-p 0.1400 0.6999 0.4458 CYCCC 2135.756967 4 0.0847 686 | 1/18
24 h-m-p 0.2321 1.1606 0.1568 +YCYCCC 2130.946240 5 0.7067 733 | 1/18
25 h-m-p 0.3138 1.5692 0.2354 +YYCCC 2124.114876 4 1.0203 778 | 1/18
26 h-m-p 0.2759 1.3797 0.1071 +YCCCC 2122.683440 4 0.7412 824 | 1/18
27 h-m-p 0.9377 5.6584 0.0846 CYCC 2121.275836 3 1.2965 867 | 1/18
28 h-m-p 1.0874 5.4370 0.0866 CCCC 2120.405196 3 1.6931 911 | 1/18
29 h-m-p 1.3062 6.5310 0.0183 CCC 2120.010111 2 1.7825 953 | 1/18
30 h-m-p 1.6000 8.0000 0.0117 CC 2119.642369 1 2.1855 993 | 1/18
31 h-m-p 0.7258 8.0000 0.0351 YCC 2119.522369 2 1.5435 1034 | 1/18
32 h-m-p 1.6000 8.0000 0.0050 CC 2119.487454 1 2.2184 1074 | 1/18
33 h-m-p 1.1609 8.0000 0.0096 YC 2119.455634 1 2.8477 1113 | 1/18
34 h-m-p 1.6000 8.0000 0.0086 +YC 2119.411592 1 4.0787 1153 | 1/18
35 h-m-p 1.6000 8.0000 0.0011 YC 2119.376692 1 3.3371 1192 | 1/18
36 h-m-p 0.8045 8.0000 0.0046 +C 2119.360970 0 3.1016 1231 | 1/18
37 h-m-p 1.6000 8.0000 0.0005 YC 2119.345064 1 2.7960 1270 | 1/18
38 h-m-p 1.6000 8.0000 0.0006 ++ 2119.322360 m 8.0000 1308 | 1/18
39 h-m-p 0.9038 8.0000 0.0051 +C 2119.302385 0 3.6150 1347 | 1/18
40 h-m-p 1.6000 8.0000 0.0019 YC 2119.274571 1 3.2535 1386 | 1/18
41 h-m-p 0.8584 8.0000 0.0072 +YC 2119.266456 1 2.8767 1426 | 1/18
42 h-m-p 1.6000 8.0000 0.0019 CC 2119.262711 1 2.3126 1466 | 1/18
43 h-m-p 1.6000 8.0000 0.0014 YC 2119.260918 1 3.1071 1505 | 1/18
44 h-m-p 1.6000 8.0000 0.0012 YC 2119.259962 1 2.8851 1544 | 1/18
45 h-m-p 1.4004 8.0000 0.0024 +YC 2119.258919 1 3.8820 1584 | 1/18
46 h-m-p 1.6000 8.0000 0.0004 C 2119.258657 0 2.0843 1622 | 1/18
47 h-m-p 1.4728 8.0000 0.0006 +YC 2119.258418 1 4.2318 1662 | 1/18
48 h-m-p 1.6000 8.0000 0.0008 C 2119.258340 0 2.3490 1700 | 1/18
49 h-m-p 1.6000 8.0000 0.0004 +C 2119.258188 0 6.6123 1739 | 1/18
50 h-m-p 1.6000 8.0000 0.0001 C 2119.258107 0 2.4208 1777 | 1/18
51 h-m-p 0.7259 8.0000 0.0004 +C 2119.258066 0 2.6314 1816 | 1/18
52 h-m-p 1.6000 8.0000 0.0000 Y 2119.258053 0 3.7541 1854 | 1/18
53 h-m-p 0.7198 8.0000 0.0002 Y 2119.258047 0 1.6686 1892 | 1/18
54 h-m-p 1.6000 8.0000 0.0000 C 2119.258047 0 1.4243 1930 | 1/18
55 h-m-p 1.6000 8.0000 0.0000 --Y 2119.258047 0 0.0406 1970 | 1/18
56 h-m-p 0.0470 8.0000 0.0000 ----N 2119.258047 0 0.0000 2012
Out..
lnL = -2119.258047
2013 lfun, 2013 eigenQcodon, 32208 P(t)
Time used: 0:09
Model 1: NearlyNeutral
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, 10)), 8)))); MP score: 116
0.019968 0.004590 0.001595 0.001085 0.010013 0.005951 0.038161 0.042020 0.007824 0.006014 0.020343 0.009828 0.025766 0.015482 0.017524 0.077748 2.062731 0.816750 0.136540
ntime & nrate & np: 16 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 9.879119
np = 19
lnL0 = -2186.140863
Iterating by ming2
Initial: fx= 2186.140863
x= 0.01997 0.00459 0.00159 0.00109 0.01001 0.00595 0.03816 0.04202 0.00782 0.00601 0.02034 0.00983 0.02577 0.01548 0.01752 0.07775 2.06273 0.81675 0.13654
1 h-m-p 0.0000 0.0000 681.4654 ++ 2184.833172 m 0.0000 24 | 1/19
2 h-m-p 0.0000 0.0000 725.6591 +YYCYC 2183.278064 4 0.0000 52 | 1/19
3 h-m-p 0.0000 0.0001 585.8713 +YYYCYCCC 2178.384376 7 0.0000 85 | 1/19
4 h-m-p 0.0000 0.0000 2386.2832 +CYCCC 2168.072204 4 0.0000 115 | 1/19
5 h-m-p 0.0000 0.0000 10423.2733 ++ 2141.594554 m 0.0000 137 | 2/19
6 h-m-p 0.0000 0.0001 819.6970 +YYCCC 2138.472655 4 0.0001 166 | 2/19
7 h-m-p 0.0000 0.0002 97.0310 +YYCCC 2136.766985 4 0.0002 195 | 2/19
8 h-m-p 0.0000 0.0000 982.4372 +YYCYC 2135.471900 4 0.0000 223 | 2/19
9 h-m-p 0.0000 0.0001 97.3682 +YYYYYC 2132.579485 5 0.0001 251 | 2/19
10 h-m-p 0.0000 0.0001 252.9816 YCYCCC 2130.962086 5 0.0001 281 | 2/19
11 h-m-p 0.0001 0.0007 140.8632 YCCC 2129.299705 3 0.0002 308 | 2/19
12 h-m-p 0.0001 0.0007 105.1891 YYC 2128.870430 2 0.0001 332 | 2/19
13 h-m-p 0.0002 0.0008 71.8429 YC 2128.744736 1 0.0001 355 | 2/19
14 h-m-p 0.0001 0.0029 37.1591 YC 2128.609540 1 0.0003 378 | 2/19
15 h-m-p 0.0003 0.0037 36.4127 YC 2128.527184 1 0.0002 401 | 2/19
16 h-m-p 0.0011 0.0114 7.3379 YC 2128.494975 1 0.0006 424 | 2/19
17 h-m-p 0.0003 0.0041 14.8922 CC 2128.451595 1 0.0003 448 | 2/19
18 h-m-p 0.0003 0.0256 13.7148 +++CYYYC 2120.834729 4 0.0225 478 | 2/19
19 h-m-p 0.0265 0.1326 2.7128 CCCCC 2117.367395 4 0.0397 508 | 2/19
20 h-m-p 0.0914 2.0220 1.1776 +CCCCC 2115.174750 4 0.3909 539 | 2/19
21 h-m-p 0.6364 3.1818 0.0518 YC 2114.925332 1 0.2878 562 | 2/19
22 h-m-p 0.0425 5.8054 0.3510 +YC 2114.845677 1 0.3094 603 | 2/19
23 h-m-p 0.7959 8.0000 0.1365 CCC 2114.616802 2 1.1059 646 | 2/19
24 h-m-p 1.6000 8.0000 0.0294 YCC 2114.436640 2 1.0014 688 | 2/19
25 h-m-p 1.6000 8.0000 0.0089 YC 2114.353607 1 0.7668 728 | 2/19
26 h-m-p 0.7539 8.0000 0.0090 YC 2114.299005 1 1.5699 768 | 2/19
27 h-m-p 1.6000 8.0000 0.0025 CC 2114.256733 1 1.3722 809 | 2/19
28 h-m-p 0.3748 8.0000 0.0092 +CCC 2114.230460 2 1.6012 853 | 2/19
29 h-m-p 1.6000 8.0000 0.0008 CC 2114.214769 1 1.6896 894 | 2/19
30 h-m-p 0.7910 8.0000 0.0017 CC 2114.210635 1 1.0702 935 | 2/19
31 h-m-p 0.9432 8.0000 0.0019 CC 2114.209690 1 1.2626 976 | 2/19
32 h-m-p 1.6000 8.0000 0.0006 C 2114.209244 0 1.8624 1015 | 2/19
33 h-m-p 1.6000 8.0000 0.0006 C 2114.209038 0 1.6278 1054 | 2/19
34 h-m-p 1.6000 8.0000 0.0002 Y 2114.209022 0 1.1075 1093 | 2/19
35 h-m-p 1.6000 8.0000 0.0001 Y 2114.209021 0 1.1926 1132 | 2/19
36 h-m-p 1.6000 8.0000 0.0000 C 2114.209020 0 1.3261 1171 | 2/19
37 h-m-p 1.1444 8.0000 0.0000 C 2114.209020 0 1.7080 1210 | 2/19
38 h-m-p 1.6000 8.0000 0.0000 Y 2114.209020 0 3.5844 1249 | 2/19
39 h-m-p 1.6000 8.0000 0.0000 -----Y 2114.209020 0 0.0004 1293
Out..
lnL = -2114.209020
1294 lfun, 3882 eigenQcodon, 41408 P(t)
Time used: 0:21
Model 2: PositiveSelection
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, 10)), 8)))); MP score: 116
initial w for M2:NSpselection reset.
0.019968 0.004590 0.001595 0.001085 0.010013 0.005951 0.038161 0.042020 0.007824 0.006014 0.020343 0.009828 0.025766 0.015482 0.017524 0.077748 2.056038 1.098208 0.580294 0.458835 2.948231
ntime & nrate & np: 16 3 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 4.459821
np = 21
lnL0 = -2277.049546
Iterating by ming2
Initial: fx= 2277.049546
x= 0.01997 0.00459 0.00159 0.00109 0.01001 0.00595 0.03816 0.04202 0.00782 0.00601 0.02034 0.00983 0.02577 0.01548 0.01752 0.07775 2.05604 1.09821 0.58029 0.45883 2.94823
1 h-m-p 0.0000 0.0000 652.3898 ++ 2275.866778 m 0.0000 26 | 1/21
2 h-m-p 0.0000 0.0000 508.4441 +YCYCCC 2275.053564 5 0.0000 59 | 1/21
3 h-m-p 0.0000 0.0001 229.9660 YCCCC 2274.314203 4 0.0000 90 | 1/21
4 h-m-p 0.0000 0.0004 193.5845 YCCC 2273.658950 3 0.0001 119 | 1/21
5 h-m-p 0.0000 0.0001 199.8531 YCYCCC 2273.208214 5 0.0000 151 | 1/21
6 h-m-p 0.0000 0.0004 341.6088 +YCCCC 2271.643406 4 0.0001 183 | 1/21
7 h-m-p 0.0001 0.0003 698.2305 CCC 2269.945550 2 0.0001 211 | 1/21
8 h-m-p 0.0001 0.0005 867.4905 ++ 2239.580783 m 0.0005 235 | 2/21
9 h-m-p 0.0001 0.0004 2337.1029 CCCC 2237.632674 3 0.0001 265 | 2/21
10 h-m-p 0.0001 0.0003 1577.1629 CCCC 2236.562229 3 0.0001 295 | 2/21
11 h-m-p 0.0001 0.0006 150.7615 YCC 2236.446085 2 0.0001 322 | 2/21
12 h-m-p 0.0000 0.0004 412.9248 YCCC 2236.162890 3 0.0001 351 | 2/21
13 h-m-p 0.0005 0.0030 64.1341 YCC 2235.912392 2 0.0003 378 | 2/21
14 h-m-p 0.0003 0.0014 45.4157 YCCC 2235.767593 3 0.0002 407 | 2/21
15 h-m-p 0.0001 0.0026 64.1034 +YCCCC 2234.013699 4 0.0011 439 | 2/21
16 h-m-p 0.0002 0.0012 229.3096 +YYYCCC 2226.415178 5 0.0009 471 | 2/21
17 h-m-p 0.0000 0.0001 2345.8500 +YCYCCC 2222.341918 5 0.0001 504 | 2/21
18 h-m-p 0.0085 0.1039 16.2447 +YYCYCCCC 2214.661086 7 0.0462 540 | 2/21
19 h-m-p 0.0540 1.3620 13.9254 +YYCCCC 2173.119082 5 0.3436 573 | 2/21
20 h-m-p 0.0720 0.3599 3.5576 ++ 2161.388741 m 0.3599 597 | 3/21
21 h-m-p 0.1876 0.9379 1.8494 +CCCCC 2143.979024 4 0.8642 631 | 3/21
22 h-m-p 0.2837 1.4186 4.4254 +YCYCCC 2126.811563 5 0.8896 665 | 3/21
23 h-m-p 0.1821 0.9106 1.9912 YCCCCC 2123.345698 5 0.3865 698 | 3/21
24 h-m-p 0.0482 0.2412 2.8096 YCYCCC 2121.038654 5 0.1209 730 | 3/21
25 h-m-p 0.4359 2.1795 0.7283 CCCC 2117.959473 3 0.6387 760 | 3/21
26 h-m-p 1.2527 8.0000 0.3713 YCCC 2115.556270 3 2.0611 807 | 3/21
27 h-m-p 0.8881 4.4405 0.3684 YYC 2114.891019 2 0.6691 851 | 3/21
28 h-m-p 0.6459 3.2296 0.1945 YCCC 2114.485143 3 1.2264 898 | 2/21
29 h-m-p 0.9587 8.0000 0.2488 YCC 2114.286909 2 1.9016 943 | 2/21
30 h-m-p 1.3486 6.7428 0.2368 YYC 2114.220135 2 1.1556 988 | 2/21
31 h-m-p 1.6000 8.0000 0.0890 YC 2114.203183 1 1.0871 1032 | 2/21
32 h-m-p 1.3938 8.0000 0.0694 C 2114.189918 0 1.4648 1075 | 2/21
33 h-m-p 1.6000 8.0000 0.0596 YC 2114.168409 1 2.6312 1119 | 2/21
34 h-m-p 1.6000 8.0000 0.0645 YC 2114.142140 1 3.7951 1163 | 2/21
35 h-m-p 1.6000 8.0000 0.0570 C 2114.136202 0 1.5026 1206 | 2/21
36 h-m-p 1.6000 8.0000 0.0162 C 2114.135305 0 1.6627 1249 | 2/21
37 h-m-p 1.6000 8.0000 0.0059 YC 2114.134877 1 3.0390 1293 | 2/21
38 h-m-p 1.4881 8.0000 0.0121 ++ 2114.133776 m 8.0000 1336 | 2/21
39 h-m-p 1.6000 8.0000 0.0556 ++ 2114.126404 m 8.0000 1379 | 2/21
40 h-m-p 1.1750 8.0000 0.3785 CCC 2114.121344 2 1.5059 1426 | 2/21
41 h-m-p 1.6000 8.0000 0.1807 CYC 2114.114238 2 2.1625 1472 | 2/21
42 h-m-p 0.9376 8.0000 0.4168 CCC 2114.109128 2 1.4660 1519 | 2/21
43 h-m-p 1.6000 8.0000 0.1239 C 2114.105796 0 1.5253 1562 | 2/21
44 h-m-p 0.5551 8.0000 0.3406 +CC 2114.103569 1 2.0199 1608 | 2/21
45 h-m-p 1.6000 8.0000 0.2225 YC 2114.101717 1 2.9146 1652 | 2/21
46 h-m-p 1.3203 8.0000 0.4911 C 2114.100860 0 1.5501 1695 | 2/21
47 h-m-p 1.6000 8.0000 0.3136 YC 2114.100370 1 3.1424 1739 | 2/21
48 h-m-p 1.6000 8.0000 0.3615 C 2114.100197 0 2.0072 1782 | 2/21
49 h-m-p 1.6000 8.0000 0.3105 Y 2114.100114 0 3.0484 1825 | 2/21
50 h-m-p 1.6000 8.0000 0.3752 C 2114.100081 0 1.7780 1868 | 2/21
51 h-m-p 1.6000 8.0000 0.3619 C 2114.100068 0 2.0753 1911 | 2/21
52 h-m-p 1.6000 8.0000 0.3496 C 2114.100060 0 2.3514 1954 | 2/21
53 h-m-p 1.6000 8.0000 0.3652 C 2114.100056 0 2.4553 1997 | 2/21
54 h-m-p 1.6000 8.0000 0.3373 C 2114.100055 0 2.1679 2040 | 2/21
55 h-m-p 1.6000 8.0000 0.3576 C 2114.100054 0 2.1455 2083 | 2/21
56 h-m-p 1.6000 8.0000 0.3277 C 2114.100054 0 1.8057 2126 | 2/21
57 h-m-p 1.6000 8.0000 0.3057 Y 2114.100054 0 2.9542 2169 | 2/21
58 h-m-p 1.6000 8.0000 0.4158 Y 2114.100054 0 2.6251 2212 | 2/21
59 h-m-p 1.6000 8.0000 0.2909 C 2114.100054 0 1.3362 2255 | 2/21
60 h-m-p 0.9878 8.0000 0.3935 Y 2114.100053 0 2.0828 2298 | 2/21
61 h-m-p 1.6000 8.0000 0.2976 +C 2114.100053 0 5.8664 2342 | 2/21
62 h-m-p 1.6000 8.0000 0.1067 C 2114.100053 0 0.5352 2385 | 2/21
63 h-m-p 0.1430 8.0000 0.3992 -----Y 2114.100053 0 0.0000 2433 | 2/21
64 h-m-p 0.0527 8.0000 0.0003 ----C 2114.100053 0 0.0001 2480 | 2/21
65 h-m-p 0.0160 8.0000 0.0001 -------------.. | 2/21
66 h-m-p 0.0045 2.2486 0.0106 ------------ | 2/21
67 h-m-p 0.0045 2.2486 0.0106 ------------
Out..
lnL = -2114.100053
2641 lfun, 10564 eigenQcodon, 126768 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2155.688462 S = -2126.763259 -20.045613
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 132 patterns 0:56
did 20 / 132 patterns 0:57
did 30 / 132 patterns 0:57
did 40 / 132 patterns 0:57
did 50 / 132 patterns 0:57
did 60 / 132 patterns 0:57
did 70 / 132 patterns 0:57
did 80 / 132 patterns 0:57
did 90 / 132 patterns 0:57
did 100 / 132 patterns 0:57
did 110 / 132 patterns 0:57
did 120 / 132 patterns 0:57
did 130 / 132 patterns 0:57
did 132 / 132 patterns 0:57
Time used: 0:57
Model 3: discrete
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, 10)), 8)))); MP score: 116
0.019968 0.004590 0.001595 0.001085 0.010013 0.005951 0.038161 0.042020 0.007824 0.006014 0.020343 0.009828 0.025766 0.015482 0.017524 0.077748 2.063385 0.923969 0.634343 0.002577 0.006449 0.009009
ntime & nrate & np: 16 4 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 18.412519
np = 22
lnL0 = -2122.013105
Iterating by ming2
Initial: fx= 2122.013105
x= 0.01997 0.00459 0.00159 0.00109 0.01001 0.00595 0.03816 0.04202 0.00782 0.00601 0.02034 0.00983 0.02577 0.01548 0.01752 0.07775 2.06339 0.92397 0.63434 0.00258 0.00645 0.00901
1 h-m-p 0.0000 0.0000 628.0140 ++ 2120.946549 m 0.0000 49 | 1/22
2 h-m-p 0.0000 0.0000 553.2992 +CYCC 2120.025365 3 0.0000 102 | 1/22
3 h-m-p 0.0000 0.0000 373.8829 ++ 2119.875857 m 0.0000 148 | 2/22
4 h-m-p 0.0000 0.0005 92.1259 +YC 2119.609775 1 0.0001 196 | 2/22
5 h-m-p 0.0000 0.0001 193.2712 YCYCCC 2119.359768 5 0.0000 249 | 2/22
6 h-m-p 0.0000 0.0000 1162.5786 ++ 2119.028022 m 0.0000 294 | 3/22
7 h-m-p 0.0001 0.0007 50.3247 CCC 2118.841488 2 0.0001 343 | 3/22
8 h-m-p 0.0001 0.0007 81.6674 YCCC 2118.773087 3 0.0000 392 | 3/22
9 h-m-p 0.0001 0.0005 54.3248 YYC 2118.728126 2 0.0000 438 | 3/22
10 h-m-p 0.0001 0.0019 38.0040 CC 2118.695892 1 0.0001 484 | 3/22
11 h-m-p 0.0002 0.0033 13.7241 YC 2118.693069 1 0.0000 529 | 3/22
12 h-m-p 0.0001 0.0091 5.9270 YC 2118.690616 1 0.0001 574 | 3/22
13 h-m-p 0.0001 0.0093 6.7696 CC 2118.689081 1 0.0001 620 | 3/22
14 h-m-p 0.0002 0.0204 2.9313 C 2118.687939 0 0.0003 664 | 3/22
15 h-m-p 0.0001 0.0304 8.2762 +C 2118.683166 0 0.0004 709 | 3/22
16 h-m-p 0.0002 0.0615 19.9041 ++YCC 2118.628187 2 0.0019 758 | 3/22
17 h-m-p 0.0001 0.0037 326.0570 +YCCC 2118.249295 3 0.0008 808 | 3/22
18 h-m-p 0.0001 0.0004 1753.3910 CYCCC 2117.798112 4 0.0002 859 | 3/22
19 h-m-p 0.0001 0.0007 1007.9142 YCC 2117.640097 2 0.0001 906 | 3/22
20 h-m-p 0.1463 8.0000 0.7153 +CYCC 2117.137645 3 0.7574 956 | 3/22
21 h-m-p 0.5836 6.6898 0.9284 CCCC 2116.835127 3 0.8002 1006 | 3/22
22 h-m-p 0.2527 3.2135 2.9402 YCCC 2116.359334 3 0.4679 1055 | 3/22
23 h-m-p 1.6000 8.0000 0.3295 CC 2116.073490 1 2.1704 1101 | 3/22
24 h-m-p 1.6000 8.0000 0.1738 YCCC 2115.835832 3 2.9658 1150 | 3/22
25 h-m-p 1.6000 8.0000 0.1370 +YCCC 2115.537588 3 4.5899 1200 | 3/22
26 h-m-p 1.6000 8.0000 0.2955 YCC 2115.161458 2 3.3521 1247 | 3/22
27 h-m-p 1.6000 8.0000 0.2760 CC 2114.999601 1 2.4631 1293 | 3/22
28 h-m-p 1.3213 8.0000 0.5144 CCCC 2114.891138 3 1.5632 1343 | 3/22
29 h-m-p 0.7860 8.0000 1.0231 +YC 2114.578197 1 2.0217 1389 | 3/22
30 h-m-p 1.6000 8.0000 1.0139 YCCC 2114.293224 3 3.2197 1438 | 3/22
31 h-m-p 1.6000 8.0000 1.3064 CCC 2114.173989 2 2.2541 1486 | 3/22
32 h-m-p 1.6000 8.0000 1.1521 CCC 2114.126268 2 1.7531 1534 | 3/22
33 h-m-p 1.5352 8.0000 1.3156 CC 2114.107044 1 1.4069 1580 | 3/22
34 h-m-p 1.6000 8.0000 0.5085 CC 2114.100518 1 1.8630 1626 | 3/22
35 h-m-p 1.6000 8.0000 0.0100 C 2114.100067 0 1.3739 1670 | 3/22
36 h-m-p 0.2823 8.0000 0.0488 +C 2114.100054 0 1.2090 1715 | 3/22
37 h-m-p 1.6000 8.0000 0.0044 C 2114.100054 0 1.3873 1759 | 3/22
38 h-m-p 1.6000 8.0000 0.0005 Y 2114.100053 0 1.2628 1803 | 3/22
39 h-m-p 1.6000 8.0000 0.0001 C 2114.100053 0 1.8946 1847 | 3/22
40 h-m-p 1.6000 8.0000 0.0001 -----Y 2114.100053 0 0.0004 1896
Out..
lnL = -2114.100053
1897 lfun, 7588 eigenQcodon, 91056 P(t)
Time used: 1:22
Model 7: beta
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, 10)), 8)))); MP score: 116
0.019968 0.004590 0.001595 0.001085 0.010013 0.005951 0.038161 0.042020 0.007824 0.006014 0.020343 0.009828 0.025766 0.015482 0.017524 0.077748 2.063381 1.091300 1.180709
ntime & nrate & np: 16 1 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 7.617496
np = 19
lnL0 = -2219.670791
Iterating by ming2
Initial: fx= 2219.670791
x= 0.01997 0.00459 0.00159 0.00109 0.01001 0.00595 0.03816 0.04202 0.00782 0.00601 0.02034 0.00983 0.02577 0.01548 0.01752 0.07775 2.06338 1.09130 1.18071
1 h-m-p 0.0000 0.0000 623.7851 ++ 2218.640116 m 0.0000 43 | 1/19
2 h-m-p 0.0000 0.0000 468.3819 YCYCCC 2218.022984 5 0.0000 92 | 1/19
3 h-m-p 0.0000 0.0001 170.1337 CYCCC 2217.667413 4 0.0000 139 | 1/19
4 h-m-p 0.0000 0.0011 112.4056 YCCC 2217.354987 3 0.0001 184 | 1/19
5 h-m-p 0.0000 0.0001 162.4516 CYCCC 2217.187679 4 0.0000 231 | 1/19
6 h-m-p 0.0000 0.0006 202.8626 +CCCC 2216.328091 3 0.0002 278 | 1/19
7 h-m-p 0.0000 0.0003 684.5305 CYC 2215.417158 2 0.0001 321 | 1/19
8 h-m-p 0.0000 0.0002 716.7382 +YYYYC 2211.715231 4 0.0002 366 | 1/19
9 h-m-p 0.0000 0.0001 8790.8985 +CYYYCCCCC 2189.402960 8 0.0001 420 | 1/19
10 h-m-p 0.0000 0.0000 78569.2538 +YYCYCYCCC 2163.623482 8 0.0000 474 | 1/19
11 h-m-p 0.0000 0.0000 70060.5497 CYCCCC 2163.300116 5 0.0000 523 | 1/19
12 h-m-p 0.0002 0.0045 61.9709 YCCC 2163.014538 3 0.0003 568 | 1/19
13 h-m-p 0.0001 0.0034 222.3848 ++YYCCCC 2158.270534 5 0.0014 618 | 1/19
14 h-m-p 0.0002 0.0008 796.3480 YCYCCC 2152.496332 5 0.0004 666 | 1/19
15 h-m-p 0.0001 0.0004 2003.6302 +YCCC 2144.560339 3 0.0003 712 | 1/19
16 h-m-p 0.0005 0.0023 39.1619 CCC 2144.488701 2 0.0002 756 | 1/19
17 h-m-p 0.0009 0.0083 7.0011 YCC 2144.441193 2 0.0007 799 | 1/19
18 h-m-p 0.0005 0.1022 9.6500 +++CYCCCC 2135.769106 5 0.0441 851 | 1/19
19 h-m-p 0.1490 0.7452 1.6897 YCCCC 2132.871276 4 0.3288 898 | 1/19
20 h-m-p 0.2514 1.2571 0.6885 YCCCC 2128.736306 4 0.5560 945 | 1/19
21 h-m-p 0.1163 0.5816 2.6070 CCC 2127.396117 2 0.1833 989 | 1/19
22 h-m-p 1.0086 5.0430 0.2154 YCCCC 2124.181450 4 1.7800 1036 | 1/19
23 h-m-p 0.5324 2.6619 0.3884 CCCC 2122.788872 3 0.9340 1082 | 1/19
24 h-m-p 0.4410 3.0801 0.8225 YCC 2120.682468 2 1.0031 1125 | 1/19
25 h-m-p 1.1291 5.6453 0.5911 CCCC 2119.816694 3 0.8757 1171 | 1/19
26 h-m-p 0.6330 4.6205 0.8177 CCC 2118.720682 2 0.9270 1215 | 1/19
27 h-m-p 1.3155 8.0000 0.5762 CCC 2117.991791 2 1.5472 1259 | 1/19
28 h-m-p 1.6000 8.0000 0.4237 YCC 2117.772273 2 1.1539 1302 | 1/19
29 h-m-p 1.6000 8.0000 0.2467 YCC 2117.705801 2 1.1173 1345 | 1/19
30 h-m-p 1.4352 8.0000 0.1921 CC 2117.664500 1 1.2203 1387 | 1/19
31 h-m-p 1.6000 8.0000 0.0561 YCC 2117.615886 2 2.8299 1430 | 1/19
32 h-m-p 1.6000 8.0000 0.0505 YC 2117.536972 1 2.9253 1471 | 1/19
33 h-m-p 1.6000 8.0000 0.0077 YCC 2117.437511 2 2.8077 1514 | 1/19
34 h-m-p 0.3595 8.0000 0.0604 ++YC 2117.336905 1 3.9976 1557 | 1/19
35 h-m-p 1.6000 8.0000 0.0626 CCC 2117.280139 2 1.8149 1601 | 1/19
36 h-m-p 1.6000 8.0000 0.0326 CCC 2117.253626 2 1.3975 1645 | 1/19
37 h-m-p 1.4774 8.0000 0.0309 C 2117.251273 0 1.4727 1685 | 1/19
38 h-m-p 1.6000 8.0000 0.0104 YC 2117.250944 1 1.1271 1726 | 1/19
39 h-m-p 1.6000 8.0000 0.0013 YC 2117.250793 1 2.6848 1767 | 1/19
40 h-m-p 0.6411 8.0000 0.0054 ++ 2117.249447 m 8.0000 1807 | 1/19
41 h-m-p 0.2737 8.0000 0.1575 +YC 2117.244173 1 2.2726 1849 | 1/19
42 h-m-p 1.6000 8.0000 0.1709 ++ 2117.200775 m 8.0000 1889 | 1/19
43 h-m-p 0.0654 0.3706 20.9095 +YYCYC 2117.072518 4 0.2288 1936 | 1/19
44 h-m-p 0.0958 0.4789 6.1947 YYCYCYC 2117.048747 6 0.1749 1984 | 1/19
45 h-m-p 0.0787 0.3934 4.7881 Y
a 0.000000 0.078680 0.314722 0.187640
f 2117.048747 2117.023063 2117.027771 2117.039923
0.000000e+00 2117.048747
1.573608e-02 2117.042052
3.147216e-02 2117.036033
4.720823e-02 2117.030785
6.294431e-02 2117.026421
7.868039e-02 2117.023063
9.441647e-02 2117.020854
1.101525e-01 2117.019947
1.258886e-01 2117.020511
1.416247e-01 2117.022716
1.573608e-01 2117.026725
1.730969e-01 2117.032668
1.888329e-01 2117.040592
2.045690e-01 2117.050389
2.203051e-01 2117.061656
2.360412e-01 2117.073477
2.517772e-01 2117.084063
2.675133e-01 2117.090217
2.832494e-01 2117.086727
2.989855e-01 2117.066605
3.147216e-01 2117.027771
Linesearch2 a4: multiple optima?
YCCC 2117.019934 4 0.1122 2051 | 1/19
46 h-m-p 0.3375 1.6875 0.7978 YYYYYCCYCC 2117.005039 10 0.4857 2104 | 1/19
47 h-m-p 1.4195 7.0977 0.0091 YYC 2116.967884 2 1.2033 2146 | 1/19
48 h-m-p 0.0288 2.5496 0.3803 ++YYYYYC 2116.959793 5 0.4607 2193 | 1/19
49 h-m-p 1.6000 8.0000 0.0639 YC 2116.953356 1 0.6661 2234 | 1/19
50 h-m-p 0.3340 6.5658 0.1275 CYC 2116.952391 2 0.6343 2277 | 1/19
51 h-m-p 1.6000 8.0000 0.0219 C 2116.952018 0 1.7230 2317 | 1/19
52 h-m-p 1.1964 8.0000 0.0316 CYC 2116.951735 2 2.0481 2360 | 1/19
53 h-m-p 1.6000 8.0000 0.0400 C 2116.951526 0 0.5672 2400 | 1/19
54 h-m-p 0.3011 8.0000 0.0753 YC 2116.951321 1 0.6698 2441 | 1/19
55 h-m-p 1.2877 8.0000 0.0392 Y 2116.951232 0 0.6715 2481 | 1/19
56 h-m-p 1.6000 8.0000 0.0121 C 2116.951172 0 0.6260 2521 | 1/19
57 h-m-p 0.1803 8.0000 0.0419 +Y 2116.951101 0 0.7213 2562 | 1/19
58 h-m-p 1.0897 8.0000 0.0277 Y 2116.951053 0 1.0897 2602 | 1/19
59 h-m-p 1.6000 8.0000 0.0011 Y 2116.951019 0 0.6764 2642 | 1/19
60 h-m-p 0.0525 8.0000 0.0137 +++Y 2116.950969 0 2.1349 2685 | 1/19
61 h-m-p 1.6000 8.0000 0.0110 C 2116.950934 0 1.9698 2725 | 1/19
62 h-m-p 1.6000 8.0000 0.0114 Y 2116.950916 0 1.6000 2765 | 1/19
63 h-m-p 1.6000 8.0000 0.0057 Y 2116.950908 0 0.2564 2805 | 1/19
64 h-m-p 0.3346 8.0000 0.0043 +Y 2116.950896 0 2.7391 2846 | 1/19
65 h-m-p 1.6000 8.0000 0.0044 C 2116.950888 0 1.6250 2886 | 1/19
66 h-m-p 1.6000 8.0000 0.0034 -Y 2116.950888 0 0.1818 2927 | 1/19
67 h-m-p 0.2271 8.0000 0.0028 ++Y 2116.950884 0 2.3892 2969 | 1/19
68 h-m-p 1.6000 8.0000 0.0011 C 2116.950881 0 1.4228 3009 | 1/19
69 h-m-p 1.2452 8.0000 0.0013 ++ 2116.950877 m 8.0000 3049 | 1/19
70 h-m-p 1.6000 8.0000 0.0047 C 2116.950876 0 0.5442 3089 | 1/19
71 h-m-p 0.4749 8.0000 0.0054 -----------Y 2116.950876 0 0.0000 3140 | 1/19
72 h-m-p 0.0160 8.0000 0.0001 ++C 2116.950875 0 0.2301 3182 | 1/19
73 h-m-p 1.6000 8.0000 0.0000 Y 2116.950875 0 1.0115 3222 | 1/19
74 h-m-p 1.3622 8.0000 0.0000 Y 2116.950875 0 0.2310 3262 | 1/19
75 h-m-p 0.2909 8.0000 0.0000 -C 2116.950875 0 0.0182 3303 | 1/19
76 h-m-p 0.0190 8.0000 0.0000 C 2116.950875 0 0.0047 3343 | 1/19
77 h-m-p 0.0160 8.0000 0.0000 --Y 2116.950875 0 0.0003 3385
Out..
lnL = -2116.950875
3386 lfun, 37246 eigenQcodon, 541760 P(t)
Time used: 3:54
Model 8: beta&w>1
TREE # 1
(1, 2, (3, (4, (5, ((6, 7), (9, 10)), 8)))); MP score: 116
initial w for M8:NSbetaw>1 reset.
0.019968 0.004590 0.001595 0.001085 0.010013 0.005951 0.038161 0.042020 0.007824 0.006014 0.020343 0.009828 0.025766 0.015482 0.017524 0.077748 2.062741 0.900000 0.318342 1.765725 2.851152
ntime & nrate & np: 16 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 8.235271
np = 21
lnL0 = -2194.777387
Iterating by ming2
Initial: fx= 2194.777387
x= 0.01997 0.00459 0.00159 0.00109 0.01001 0.00595 0.03816 0.04202 0.00782 0.00601 0.02034 0.00983 0.02577 0.01548 0.01752 0.07775 2.06274 0.90000 0.31834 1.76572 2.85115
1 h-m-p 0.0000 0.0000 846.8531 ++ 2192.334525 m 0.0000 47 | 1/21
2 h-m-p 0.0000 0.0000 1183.5528 +YYCYCCC 2188.273883 6 0.0000 102 | 1/21
3 h-m-p 0.0000 0.0000 1378.8003 +YYCCCCC 2174.161267 6 0.0000 157 | 1/21
4 h-m-p 0.0000 0.0000 2152.1266 +CYCCC 2161.939830 4 0.0000 209 | 1/21
5 h-m-p 0.0000 0.0000 909.8893 ++ 2158.845572 m 0.0000 253 | 2/21
6 h-m-p 0.0000 0.0000 721.6779 +YYYCCC 2156.658611 5 0.0000 305 | 2/21
7 h-m-p 0.0000 0.0000 628.9316 YCCCC 2155.182523 4 0.0000 355 | 2/21
8 h-m-p 0.0000 0.0001 934.8369 YYCC 2153.564912 3 0.0000 402 | 2/21
9 h-m-p 0.0001 0.0003 362.7610 +YCCCC 2148.749503 4 0.0002 453 | 2/21
10 h-m-p 0.0001 0.0006 414.0235 CYCCC 2142.737607 4 0.0002 503 | 2/21
11 h-m-p 0.0000 0.0002 663.7005 +YYYCCC 2135.080040 5 0.0002 554 | 2/21
12 h-m-p 0.0000 0.0000 823.2404 YCCCCC 2134.122145 5 0.0000 606 | 1/21
13 h-m-p 0.0000 0.0000 22980.9576 ++ 2131.992281 m 0.0000 649 | 2/21
14 h-m-p 0.0001 0.0012 36.7505 YCC 2131.939531 2 0.0001 696 | 2/21
15 h-m-p 0.0002 0.0093 11.6916 +CCC 2131.844277 2 0.0012 744 | 2/21
16 h-m-p 0.0001 0.0111 134.9249 ++
QuantileBeta(0.15, 0.00500, 2.63396) = 9.561559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19363) = 1.198484e-160 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 2.19380) = 1.198361e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.41388) = 1.063773e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19799) = 1.195490e-160 2000 rounds
C
QuantileBeta(0.15, 0.00500, 2.30593) = 1.125832e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
C 2129.206731 3 0.0031 794
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.237178e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19817) = 1.195362e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19793) = 1.195529e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
QuantileBeta(0.15, 0.00500, 2.19805) = 1.195445e-160 2000 rounds
| 2/21
17 h-m-p 0.0001 0.0010 3473.8212
QuantileBeta(0.15, 0.00500, 2.57785) = 9.814905e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.71723) = 6.375497e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 5.20481) = 4.369855e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.15082) = 7.722362e-161 2000 rounds
C 2122.812967 1 0.0003 839
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.997359e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14915) = 7.727174e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14886) = 7.728010e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.14900) = 7.727592e-161 2000 rounds
| 2/21
18 h-m-p 0.0001 0.0004 1052.1653
QuantileBeta(0.15, 0.00500, 3.21742) = 7.535324e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42268) = 7.011703e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.21719) = 7.535967e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.32005) = 7.264135e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22361) = 7.518402e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.27183) = 7.389092e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
C 2122.288095 2 0.0001 886
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.780158e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22401) = 7.517316e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22372) = 7.518117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22386) = 7.517717e-161 2000 rounds
| 2/21
19 h-m-p 0.0014 0.0068 12.2615
QuantileBeta(0.15, 0.00500, 3.23132) = 7.497445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22573) = 7.512638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515042e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
C 2122.278057 1 0.0002 930
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.777393e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22499) = 7.514645e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22470) = 7.515446e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22484) = 7.515045e-161 2000 rounds
| 2/21
20 h-m-p 0.0003 0.1693 7.8203
QuantileBeta(0.15, 0.00500, 3.22509) = 7.514378e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.22582) = 7.512378e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.22876) = 7.504387e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.24051) = 7.472590e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.28749) = 7.348042e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 3.34721) = 7.195601e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.28840) = 7.345671e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.31781) = 7.269865e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.33251) = 7.232544e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30409) = 7.305024e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.30458) = 7.303777e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.31119) = 7.286782e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30557) = 7.301213e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.30838) = 7.293990e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
C 2118.047582 4 0.1118 985
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.555956e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30578) = 7.300695e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30548) = 7.301461e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.30563) = 7.301078e-161 2000 rounds
| 2/21
21 h-m-p 0.1819 0.9093 1.7550
QuantileBeta(0.15, 0.00500, 3.39235) = 7.084470e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.65253) = 6.505186e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.44701) = 6.954401e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.45665) = 6.931959e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.55459) = 6.711823e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46553) = 6.911401e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.51006) = 6.810157e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46673) = 6.908637e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.48840) = 6.859045e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
C 2116.309947 4 0.3384 1035
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 7.149179e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46715) = 6.907671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46685) = 6.908374e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.46700) = 6.908023e-161 2000 rounds
| 2/21
22 h-m-p 0.4266 2.1330 0.9977
QuantileBeta(0.15, 0.00500, 3.42334) = 7.010138e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.29237) = 7.335347e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.41612) = 7.027315e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.44517) = 6.958708e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42460) = 7.007146e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.43489) = 6.982843e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42491) = 7.006409e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.42990) = 6.994606e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
C 2115.326392 3 0.4110 1084
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.250928e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42510) = 7.005980e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42479) = 7.006699e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.42494) = 7.006339e-161 2000 rounds
| 2/21
23 h-m-p 1.3932 7.9118 0.2943
QuantileBeta(0.15, 0.00500, 3.81546) = 6.188141e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.98702) = 4.581000e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.70369) = 6.402199e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.68883) = 6.431789e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.55688) = 6.706832e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.68051) = 6.448461e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.61870) = 6.575119e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
C 2114.772051 3 0.9091 1132
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.675154e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67991) = 6.449671e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67959) = 6.450304e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.67975) = 6.449987e-161 2000 rounds
| 2/21
24 h-m-p 0.5025 2.5127 0.2902
QuantileBeta(0.15, 0.00500, 3.81618) = 6.186808e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.22549) = 5.511754e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.86707) = 6.094046e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.04628) = 5.788338e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89203) = 6.049555e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.96915) = 5.916074e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89559) = 6.043266e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 3.93237) = 5.978996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
C 2114.428143 3 0.7973 1181
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.253121e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89636) = 6.041904e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89603) = 6.042476e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.89620) = 6.042190e-161 2000 rounds
| 2/21
25 h-m-p 0.7511 3.7553 0.1793
QuantileBeta(0.15, 0.00500, 4.01073) = 5.846525e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.35433) = 5.328650e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.97661) = 5.903487e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.99009) = 5.880845e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
C 2114.281834 2 0.6168 1226
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 6.085855e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99042) = 5.880292e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99009) = 5.880841e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 3.99026) = 5.880567e-161 2000 rounds
| 2/21
26 h-m-p 0.7692 8.0000 0.1438
QuantileBeta(0.15, 0.00500, 4.00391) = 5.857823e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04486) = 5.790633e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00812) = 5.850852e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.02649) = 5.820587e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00710) = 5.852535e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
C 2114.163731 2 0.9454 1272
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 6.056952e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00720) = 5.852365e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00687) = 5.852911e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.00704) = 5.852638e-161 2000 rounds
| 2/21
27 h-m-p 1.6000 8.0000 0.0659
QuantileBeta(0.15, 0.00500, 4.03290) = 5.810096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.11050) = 5.686089e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02294) = 5.826408e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
C 2114.116915 1 0.9744 1316
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 6.030062e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02296) = 5.826384e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02263) = 5.826926e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02279) = 5.826655e-161 2000 rounds
| 2/21
28 h-m-p 1.6000 8.0000 0.0319
QuantileBeta(0.15, 0.00500, 4.05116) = 5.780445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.13626) = 5.646096e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04466) = 5.790959e-161 2000 rounds
Y
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
C 2114.109102 1 1.2476 1360
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.992706e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04507) = 5.790291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04474) = 5.790827e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04491) = 5.790559e-161 2000 rounds
| 2/21
29 h-m-p 1.6000 8.0000 0.0224
QuantileBeta(0.15, 0.00500, 4.04947) = 5.783170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.06316) = 5.761117e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
C 2114.105003 0 1.6490 1403
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.984825e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04978) = 5.782677e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04944) = 5.783212e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04961) = 5.782945e-161 2000 rounds
| 2/21
30 h-m-p 1.6000 8.0000 0.0128
QuantileBeta(0.15, 0.00500, 4.04363) = 5.792629e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02570) = 5.821878e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04235) = 5.794708e-161 2000 rounds
C
QuantileBeta(0.15, 0.00500, 4.03403) = 5.808261e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
C 2114.101042 1 1.9901 1448
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.997297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04234) = 5.794727e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04201) = 5.795264e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04218) = 5.794996e-161 2000 rounds
| 2/21
31 h-m-p 1.6000 8.0000 0.0104
QuantileBeta(0.15, 0.00500, 4.03776) = 5.802170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.02453) = 5.823799e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
C 2114.100340 0 1.4984 1491
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 6.004250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03821) = 5.801445e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03788) = 5.801983e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.03804) = 5.801714e-161 2000 rounds
| 2/21
32 h-m-p 1.6000 8.0000 0.0076
QuantileBeta(0.15, 0.00500, 4.04337) = 5.793058e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05934) = 5.767247e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
C 2114.100044 0 2.1456 1534
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.992244e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04535) = 5.789845e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04502) = 5.790381e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04518) = 5.790113e-161 2000 rounds
| 2/21
33 h-m-p 1.6000 8.0000 0.0019
QuantileBeta(0.15, 0.00500, 4.04810) = 5.785389e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05685) = 5.771265e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
C 2114.099980 0 1.3131 1577
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.988231e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04774) = 5.785968e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04741) = 5.786504e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04758) = 5.786236e-161 2000 rounds
| 2/21
34 h-m-p 1.6000 8.0000 0.0014
QuantileBeta(0.15, 0.00500, 4.04803) = 5.785498e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04940) = 5.783285e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
Y 2114.099932 0 2.9073 1620
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.986844e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04857) = 5.784627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785163e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04841) = 5.784895e-161 2000 rounds
| 2/21
35 h-m-p 1.6000 8.0000 0.0013
QuantileBeta(0.15, 0.00500, 4.04830) = 5.785065e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04798) = 5.785576e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
Y 2114.099893 0 2.5812 1663
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.987128e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04840) = 5.784902e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04807) = 5.785437e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04824) = 5.785170e-161 2000 rounds
| 2/21
36 h-m-p 1.6000 8.0000 0.0018
QuantileBeta(0.15, 0.00500, 4.04887) = 5.784137e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05079) = 5.781043e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
C 2114.099884 0 1.7625 1706
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.985951e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04910) = 5.783765e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04877) = 5.784300e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04894) = 5.784033e-161 2000 rounds
| 2/21
37 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 4.04884) = 5.784194e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04854) = 5.784676e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
C 2114.099882 0 2.3943 1749
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.986201e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04895) = 5.784006e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04862) = 5.784541e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784273e-161 2000 rounds
| 2/21
38 h-m-p 1.6000 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 4.04863) = 5.784528e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04816) = 5.785291e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
C 2114.099882 0 1.8335 1792
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.986502e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04877) = 5.784297e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04844) = 5.784833e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04861) = 5.784565e-161 2000 rounds
| 2/21
39 h-m-p 1.6000 8.0000 0.0001
QuantileBeta(0.15, 0.00500, 4.04863) = 5.784536e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04868) = 5.784448e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
Y 2114.099881 0 2.5751 1835
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.986454e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04880) = 5.784250e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04847) = 5.784786e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04864) = 5.784518e-161 2000 rounds
| 2/21
40 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.04868) = 5.784458e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04879) = 5.784277e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
C 2114.099881 0 2.2387 1878
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.986366e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04886) = 5.784166e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04852) = 5.784701e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784434e-161 2000 rounds
| 2/21
41 h-m-p 1.6000 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784427e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04871) = 5.784409e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
Y 2114.099881 0 1.0845 1921
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.986362e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04886) = 5.784162e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04853) = 5.784697e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04869) = 5.784429e-161 2000 rounds
| 2/21
42 h-m-p 0.7029 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784421e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04871) = 5.784395e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
C 2114.099881 0 0.9804 1964
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.986349e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04887) = 5.784150e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04853) = 5.784685e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04870) = 5.784417e-161 2000 rounds
| 2/21
43 h-m-p 0.5431 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.04871) = 5.784404e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04873) = 5.784365e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.04882) = 5.784223e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
C 2114.099881 0 2.4347 2008
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.986288e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04890) = 5.784090e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04857) = 5.784626e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04874) = 5.784358e-161 2000 rounds
| 2/21
44 h-m-p 1.5801 8.0000 0.0000
QuantileBeta(0.15, 0.00500, 4.04877) = 5.784302e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04888) = 5.784133e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
+ 2114.099881 m 8.0000 2051
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.985993e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04908) = 5.783805e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04875) = 5.784341e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04891) = 5.784073e-161 2000 rounds
| 2/21
45 h-m-p 1.0631 8.0000 0.0002
QuantileBeta(0.15, 0.00500, 4.04910) = 5.783774e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04965) = 5.782877e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.05030) = 5.781824e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
Y 2114.099881 0 5.8694 2095
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.984285e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05010) = 5.782155e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04977) = 5.782690e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.04993) = 5.782423e-161 2000 rounds
| 2/21
46 h-m-p 1.6000 8.0000 0.0003
QuantileBeta(0.15, 0.00500, 4.05035) = 5.781748e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05160) = 5.779726e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
+ 2114.099881 m 8.0000 2138
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.980798e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05218) = 5.778785e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05185) = 5.779320e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.05202) = 5.779053e-161 2000 rounds
| 2/21
47 h-m-p 0.2605 8.0000 0.0081
QuantileBeta(0.15, 0.00500, 4.05412) = 5.775664e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.06041) = 5.765522e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.08560) = 5.725307e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.11646) = 5.676784e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
Y 2114.099880 0 5.6757 2183
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.905322e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09791) = 5.705861e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09757) = 5.706385e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.09774) = 5.706123e-161 2000 rounds
| 2/21
48 h-m-p 1.1986 8.0000 0.0382
QuantileBeta(0.15, 0.00500, 4.14347) = 5.634987e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.28068) = 5.431809e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
+ 2114.099863 m 8.0000 2226
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.446344e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40316) = 5.262395e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40281) = 5.262860e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 4.40298) = 5.262627e-161 2000 rounds
| 2/21
49 h-m-p 0.1754 8.0000 1.7405
QuantileBeta(0.15, 0.00500, 4.70822) = 4.882956e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 5.62395) = 4.013743e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 9.28686) = 2.343471e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 18.32716) = 1.155715e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
Y 2114.099748 0 5.0483 2271
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.679991e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18994) = 1.623279e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18928) = 1.623364e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 13.18961) = 1.623321e-161 2000 rounds
| 2/21
50 h-m-p 1.6000 8.0000 0.7447
QuantileBeta(0.15, 0.00500, 14.38118) = 1.484063e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.95588) = 1.180286e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
Y 2114.099723 0 1.2737 2314
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.563216e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13855) = 1.510447e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13786) = 1.510524e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 14.13820) = 1.510486e-161 2000 rounds
| 2/21
51 h-m-p 1.0902 8.0000 0.8701
QuantileBeta(0.15, 0.00500, 15.08681) = 1.412313e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 17.93263) = 1.181860e-161 2000 rounds
+
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
+ 2114.099704 m 8.0000 2357
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.035156e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09971) = 1.000217e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09882) = 1.000260e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
QuantileBeta(0.15, 0.00500, 21.09927) = 1.000238e-161 2000 rounds
| 2/21
52 h-m-p 1.2829 8.0000 5.4259
QuantileBeta(0.15, 0.00500, 28.06033) = 7.476578e-162 2000 rounds
QuantileBeta(0.15, 0.00500, 48.94352) = 2.050730e-162 2000 rounds
++ 2114.099681 m 8.0000 2400 | 2/21
53 h-m-p 1.4486 7.2428 4.7624 C 2114.099678 0 1.3446 2443 | 2/21
54 h-m-p 1.1147 5.5736 5.0398 ++ 2114.099675 m 5.5736 2486 | 3/21
55 h-m-p 1.6000 8.0000 0.0003 Y 2114.099674 0 1.0419 2529 | 3/21
56 h-m-p 1.6000 8.0000 0.0000 ------C 2114.099674 0 0.0001 2577
Out..
lnL = -2114.099674
2578 lfun, 30936 eigenQcodon, 453728 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -2163.906761 S = -2126.763351 -28.280076
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 132 patterns 6:36
did 20 / 132 patterns 6:36
did 30 / 132 patterns 6:36
did 40 / 132 patterns 6:36
did 50 / 132 patterns 6:36
did 60 / 132 patterns 6:36
did 70 / 132 patterns 6:37
did 80 / 132 patterns 6:37
did 90 / 132 patterns 6:37
did 100 / 132 patterns 6:37
did 110 / 132 patterns 6:37
did 120 / 132 patterns 6:37
did 130 / 132 patterns 6:37
did 132 / 132 patterns 6:38
Time used: 6:38
CodeML output code: -1