--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 06:52:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/ac-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1244.29 -1253.45
2 -1244.10 -1255.21
--------------------------------------
TOTAL -1244.19 -1254.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.263367 0.004237 0.151082 0.388468 0.253370 943.49 1146.96 1.001
r(A<->C){all} 0.058351 0.001101 0.001309 0.120029 0.054139 780.12 873.36 1.001
r(A<->G){all} 0.257326 0.006266 0.115638 0.412947 0.248320 572.87 583.65 1.003
r(A<->T){all} 0.071954 0.001267 0.010794 0.142247 0.067106 721.46 762.16 1.000
r(C<->G){all} 0.167778 0.002878 0.066130 0.273326 0.163775 518.00 713.84 1.000
r(C<->T){all} 0.412161 0.006623 0.254416 0.574266 0.410864 504.70 549.20 1.002
r(G<->T){all} 0.032430 0.000732 0.000009 0.086177 0.025601 883.70 906.67 1.000
pi(A){all} 0.293465 0.000325 0.256516 0.327131 0.293080 1257.57 1311.51 1.001
pi(C){all} 0.271545 0.000302 0.239601 0.306537 0.271232 1238.94 1337.34 1.000
pi(G){all} 0.225372 0.000264 0.193058 0.255462 0.225002 880.59 1050.18 1.000
pi(T){all} 0.209618 0.000242 0.178262 0.239034 0.209108 1336.86 1354.10 1.000
alpha{1,2} 0.061454 0.002294 0.000115 0.143702 0.051878 1350.53 1425.77 1.000
alpha{3} 1.745881 0.546862 0.463289 3.164939 1.618189 1194.51 1347.75 1.000
pinvar{all} 0.547706 0.011068 0.330004 0.718701 0.564737 977.51 1068.80 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1205.698792
Model 2: PositiveSelection -1205.698792
Model 0: one-ratio -1208.199885
Model 3: discrete -1205.440704
Model 7: beta -1205.533468
Model 8: beta&w>1 -1205.533471
Model 0 vs 1 5.002186000000165
Model 2 vs 1 0.0
Model 8 vs 7 5.999999757477781E-6
>C1
MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C2
MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C3
MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C4
MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C5
MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=201
C1 MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
C2 MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C3 MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C4 MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C5 MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
****.**:*:* *******..*****************************
C1 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C2 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C3 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C4 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C5 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
**************************************************
C1 KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
C2 KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
C3 KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
C4 KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
C5 KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
****:*:**************::***:*: ******** ***** ****:
C1 PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C2 PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C3 PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C4 PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
C5 PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
* **********.*::******:***************************
C1 L
C2 L
C3 L
C4 L
C5 L
*
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 201 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 201 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [4020]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [4020]--->[4020]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.271 Mb, Max= 30.513 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C2
MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C3
MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C4
MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C5
MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
CLUSTAL W (1.83) multiple sequence alignment
C1 MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
C2 MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C3 MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C4 MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C5 MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
****.**:*:* *******..*****************************
C1 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C2 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C3 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C4 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C5 IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
**************************************************
C1 KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
C2 KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
C3 KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
C4 KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
C5 KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
****:*:**************::***:*: ******** ***** ****:
C1 PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C2 PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C3 PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C4 PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
C5 PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
* **********.*::******:***************************
C1 L
C2 L
C3 L
C4 L
C5 L
*
>C1
MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C2
MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C3
MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C4
MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C5
MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:201 S:100 BS:201
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES
BOT 0 1 97.01 C1 C2 97.01
TOP 1 0 97.01 C2 C1 97.01
BOT 0 2 97.51 C1 C3 97.51
TOP 2 0 97.51 C3 C1 97.51
BOT 0 3 91.04 C1 C4 91.04
TOP 3 0 91.04 C4 C1 91.04
BOT 0 4 93.53 C1 C5 93.53
TOP 4 0 93.53 C5 C1 93.53
BOT 1 2 98.51 C2 C3 98.51
TOP 2 1 98.51 C3 C2 98.51
BOT 1 3 92.54 C2 C4 92.54
TOP 3 1 92.54 C4 C2 92.54
BOT 1 4 94.53 C2 C5 94.53
TOP 4 1 94.53 C5 C2 94.53
BOT 2 3 93.03 C3 C4 93.03
TOP 3 2 93.03 C4 C3 93.03
BOT 2 4 96.02 C3 C5 96.02
TOP 4 2 96.02 C5 C3 96.02
BOT 3 4 94.53 C4 C5 94.53
TOP 4 3 94.53 C5 C4 94.53
AVG 0 C1 * 94.78
AVG 1 C2 * 95.65
AVG 2 C3 * 96.27
AVG 3 C4 * 92.79
AVG 4 C5 * 94.65
TOT TOT * 94.83
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGACGAGGAGTC
C2 ATGGCTTTGGGCGGCGAAAATCACTCTGTTTTCAACGACGATGAGGAGTC
C3 ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGATGAGGAATC
C4 ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCTACGACGACGAGGAGTC
C5 ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCAACGACGACGAGGAATC
************.********** *** *****:******* *****.**
C1 ATCTTCGGCCTTTAATGGACCCTCTGTTATCCGGAGAAATGCCCGGGAAC
C2 ATCTTCGCCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC
C3 ATCTTCGGCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC
C4 ATCTTCTCCCGTCAATGGACCCTCTGTTATCCGGCGAAATGCCCGGGAAC
C5 ATCTTCTGCCGTTAATGGGCCCTCTGTTATCCGGCGAAATGCCCGGGAAC
****** ** * *****.************** .***************
C1 GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT
C2 GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT
C3 GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAGCAT
C4 GCAACCGCGTAAAGCAGGTCAACAACGGCTTCAGCCAACTACGACAACAT
C5 GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAC
************************* ********************.**
C1 ATCCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
C2 ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
C3 ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
C4 ATTCCTGCGGCCGTAATTGCCGATTTGAGCAACGGTCGCCGGGGAATTGG
C5 ATTCCCGCGGCCGTAATTGCGGATTTGAGCAACGGTCGCCGGGGAATTGG
** ** ***********:** *****.***** *****************
C1 TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
C2 TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
C3 TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
C4 TCCAGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAGATGGCAG
C5 TCCCGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
***.** ***********************************.*******
C1 TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
C2 TGGAGTACATACGACGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
C3 TGGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
C4 TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
C5 TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
*.***********.************************************
C1 AAACAGAAACAGTTGCATTTGCAGCAGCAACATTTGCACTTTCAGCAGCA
C2 AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA
C3 AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA
C4 AAGCAGAAACAGATGCACATGCAGCAGCAGCATTTGCACTTTCAGCAGCA
C5 AAGCAGAAACAGTTGCACTTGCAGCAGCAACATCTGCACTTTCAGCAGCA
**.*****.***:**** :*.********.*** ****************
C1 GCAACAGCATCAACACTTATACGCCTGGCACCAAGAGTTGCAGTTGCAAT
C2 GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT
C3 GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT
C4 GCAACAGCATCAACACTTTTACGCCTGGCAGCAGCAGTCGCAGCTGCAAT
C5 GCAACAGCATCAAAACTTTTACGCCTGGCAGCAGCAGTTGCAGTTGCAGT
*************.****:*********** **. *** **** ****.*
C1 CTCCAACTGGCAGCACAAGTTCCTGCAACAGCATTAGCTCTTATTGCAAG
C2 CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG
C3 CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG
C4 CCCCCACTGGCAGCATAAGTTCCTGCAATAGCAGCAGCTCCTATTGCGAG
C5 CCCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCTTATTGCCAG
* **.********** ************ **** ***** ****** **
C1 CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTTCATAC
C2 CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTCCACAC
C3 CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTACGAATTTCCACAC
C4 CCAGCAACATCGACGATTCCAGGAGCAACACCTCCTACCAATTTGTATAC
C5 CCAGAAACATCGACGATTCCAGGAGCAACACCTCCCACCAATTTCCATAC
****.***************.************** *. ***** * **
C1 CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
C2 CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
C3 CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
C4 CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG
C5 CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG
*****************:********************************
C1 GTACTGAAGATGAGGACATCCTCGACTATATATCACTCTGGCAGGACGAC
C2 GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC
C3 GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC
C4 GTACTGAAGATGAGGACATCCTCGACTACATATCACTGTGGCAGGACGAC
C5 GTACCGAAGACGAGGACATCCTTGACTATATTTCACTCTGGCAGGACGAC
**** ***** *********** ***** **:***** ************
C1 CTG
C2 CTG
C3 CTG
C4 CTG
C5 CTG
***
>C1
ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGACGAGGAGTC
ATCTTCGGCCTTTAATGGACCCTCTGTTATCCGGAGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT
ATCCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAACAGAAACAGTTGCATTTGCAGCAGCAACATTTGCACTTTCAGCAGCA
GCAACAGCATCAACACTTATACGCCTGGCACCAAGAGTTGCAGTTGCAAT
CTCCAACTGGCAGCACAAGTTCCTGCAACAGCATTAGCTCTTATTGCAAG
CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTTCATAC
CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACTGAAGATGAGGACATCCTCGACTATATATCACTCTGGCAGGACGAC
CTG
>C2
ATGGCTTTGGGCGGCGAAAATCACTCTGTTTTCAACGACGATGAGGAGTC
ATCTTCGCCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT
ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
TGGAGTACATACGACGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA
GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT
CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG
CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTCCACAC
CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC
CTG
>C3
ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGATGAGGAATC
ATCTTCGGCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAGCAT
ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
TGGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA
GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT
CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG
CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTACGAATTTCCACAC
CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC
CTG
>C4
ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCTACGACGACGAGGAGTC
ATCTTCTCCCGTCAATGGACCCTCTGTTATCCGGCGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAACGGCTTCAGCCAACTACGACAACAT
ATTCCTGCGGCCGTAATTGCCGATTTGAGCAACGGTCGCCGGGGAATTGG
TCCAGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAGATGGCAG
TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAGCAGAAACAGATGCACATGCAGCAGCAGCATTTGCACTTTCAGCAGCA
GCAACAGCATCAACACTTTTACGCCTGGCAGCAGCAGTCGCAGCTGCAAT
CCCCCACTGGCAGCATAAGTTCCTGCAATAGCAGCAGCTCCTATTGCGAG
CCAGCAACATCGACGATTCCAGGAGCAACACCTCCTACCAATTTGTATAC
CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACTGAAGATGAGGACATCCTCGACTACATATCACTGTGGCAGGACGAC
CTG
>C5
ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCAACGACGACGAGGAATC
ATCTTCTGCCGTTAATGGGCCCTCTGTTATCCGGCGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAC
ATTCCCGCGGCCGTAATTGCGGATTTGAGCAACGGTCGCCGGGGAATTGG
TCCCGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAGCAGAAACAGTTGCACTTGCAGCAGCAACATCTGCACTTTCAGCAGCA
GCAACAGCATCAAAACTTTTACGCCTGGCAGCAGCAGTTGCAGTTGCAGT
CCCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCTTATTGCCAG
CCAGAAACATCGACGATTCCAGGAGCAACACCTCCCACCAATTTCCATAC
CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACCGAAGACGAGGACATCCTTGACTATATTTCACTCTGGCAGGACGAC
CTG
>C1
MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C2
MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C3
MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C4
MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C5
MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 5 taxa and 603 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479797343
Setting output file names to "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 1468792643
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4315310249
Seed = 1419924826
Swapseed = 1479797343
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 16 unique site patterns
Division 2 has 10 unique site patterns
Division 3 has 36 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1504.175647 -- -25.624409
Chain 2 -- -1486.784525 -- -25.624409
Chain 3 -- -1547.431818 -- -25.624409
Chain 4 -- -1525.595852 -- -25.624409
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1525.595852 -- -25.624409
Chain 2 -- -1547.431818 -- -25.624409
Chain 3 -- -1560.207842 -- -25.624409
Chain 4 -- -1548.629662 -- -25.624409
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1504.176] (-1486.785) (-1547.432) (-1525.596) * [-1525.596] (-1547.432) (-1560.208) (-1548.630)
500 -- [-1269.081] (-1274.521) (-1277.580) (-1276.293) * (-1272.945) (-1259.510) [-1270.968] (-1269.652) -- 0:00:00
1000 -- [-1255.886] (-1268.344) (-1280.183) (-1266.799) * (-1265.066) [-1262.849] (-1271.836) (-1274.209) -- 0:00:00
1500 -- [-1254.038] (-1258.127) (-1268.556) (-1270.168) * (-1264.291) (-1257.640) (-1264.145) [-1267.159] -- 0:00:00
2000 -- (-1254.781) [-1254.987] (-1262.070) (-1259.958) * (-1256.672) [-1262.995] (-1263.656) (-1261.581) -- 0:00:00
2500 -- (-1248.978) [-1253.080] (-1260.385) (-1261.390) * [-1253.735] (-1255.809) (-1252.685) (-1254.392) -- 0:00:00
3000 -- (-1250.981) [-1248.936] (-1268.301) (-1266.051) * (-1258.314) (-1252.193) [-1258.249] (-1261.656) -- 0:00:00
3500 -- (-1249.875) [-1250.901] (-1262.226) (-1261.378) * (-1258.259) (-1251.985) [-1249.953] (-1260.210) -- 0:00:00
4000 -- (-1244.987) [-1250.101] (-1253.924) (-1254.897) * (-1264.455) (-1249.823) [-1254.420] (-1254.245) -- 0:00:00
4500 -- [-1247.250] (-1247.933) (-1260.788) (-1245.445) * (-1260.174) (-1250.563) (-1252.974) [-1249.907] -- 0:03:41
5000 -- (-1243.654) (-1249.722) (-1255.402) [-1249.461] * (-1254.144) (-1251.252) (-1256.844) [-1247.647] -- 0:03:19
Average standard deviation of split frequencies: 0.000000
5500 -- [-1245.880] (-1250.653) (-1250.756) (-1252.950) * [-1246.332] (-1247.634) (-1251.528) (-1250.223) -- 0:03:00
6000 -- (-1249.353) (-1246.175) (-1249.869) [-1251.071] * (-1247.969) [-1248.062] (-1250.247) (-1250.336) -- 0:02:45
6500 -- [-1243.850] (-1247.639) (-1250.464) (-1248.385) * [-1249.541] (-1244.739) (-1252.720) (-1247.537) -- 0:02:32
7000 -- (-1246.608) [-1250.104] (-1249.031) (-1252.248) * (-1250.721) (-1243.996) (-1248.087) [-1248.306] -- 0:02:21
7500 -- (-1252.858) (-1250.308) [-1248.809] (-1251.187) * [-1242.317] (-1251.169) (-1249.185) (-1249.340) -- 0:02:12
8000 -- (-1253.075) (-1250.479) [-1250.758] (-1245.815) * (-1243.746) [-1250.439] (-1247.863) (-1255.301) -- 0:02:04
8500 -- [-1248.756] (-1241.277) (-1249.027) (-1249.520) * (-1251.403) [-1250.740] (-1252.694) (-1247.354) -- 0:01:56
9000 -- [-1248.902] (-1248.231) (-1249.542) (-1251.310) * [-1250.174] (-1262.130) (-1246.979) (-1248.671) -- 0:01:50
9500 -- (-1251.527) (-1246.728) (-1243.736) [-1249.198] * (-1253.411) (-1243.405) [-1252.751] (-1250.491) -- 0:01:44
10000 -- (-1249.605) (-1249.969) [-1245.618] (-1258.111) * (-1248.851) [-1245.410] (-1253.582) (-1254.136) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
10500 -- (-1249.267) (-1245.838) [-1244.014] (-1253.948) * [-1248.735] (-1248.491) (-1244.852) (-1247.711) -- 0:01:34
11000 -- (-1245.813) (-1248.347) [-1249.695] (-1248.518) * (-1242.757) [-1245.500] (-1248.731) (-1253.539) -- 0:01:29
11500 -- (-1250.685) (-1249.590) [-1249.182] (-1247.292) * [-1250.378] (-1242.584) (-1250.712) (-1249.821) -- 0:02:51
12000 -- (-1250.777) (-1249.798) (-1244.398) [-1249.674] * (-1248.770) [-1248.250] (-1247.912) (-1251.171) -- 0:02:44
12500 -- (-1255.398) [-1243.182] (-1253.616) (-1243.477) * [-1247.672] (-1246.438) (-1247.194) (-1248.282) -- 0:02:38
13000 -- (-1251.543) [-1247.177] (-1254.037) (-1242.810) * (-1248.153) (-1246.665) (-1249.057) [-1247.579] -- 0:02:31
13500 -- (-1250.149) (-1249.235) (-1248.512) [-1246.383] * [-1253.656] (-1249.451) (-1252.005) (-1251.564) -- 0:02:26
14000 -- (-1247.802) (-1248.865) [-1248.746] (-1246.388) * [-1249.666] (-1251.226) (-1252.910) (-1251.852) -- 0:02:20
14500 -- (-1254.702) [-1245.201] (-1251.528) (-1253.435) * (-1248.569) [-1245.076] (-1245.135) (-1251.331) -- 0:02:15
15000 -- (-1252.033) [-1244.777] (-1247.016) (-1245.716) * [-1247.354] (-1252.393) (-1244.016) (-1250.499) -- 0:02:11
Average standard deviation of split frequencies: 0.014731
15500 -- (-1248.396) (-1250.940) (-1249.730) [-1244.241] * (-1244.441) (-1252.337) (-1254.082) [-1246.138] -- 0:02:07
16000 -- (-1251.620) [-1245.982] (-1246.807) (-1243.905) * (-1246.374) (-1247.631) (-1247.789) [-1247.089] -- 0:02:03
16500 -- (-1246.853) [-1246.607] (-1254.760) (-1247.847) * [-1245.235] (-1246.097) (-1247.637) (-1246.144) -- 0:01:59
17000 -- (-1245.496) (-1251.732) (-1248.769) [-1250.266] * (-1254.203) [-1246.706] (-1247.388) (-1246.351) -- 0:01:55
17500 -- (-1250.821) (-1244.586) (-1248.482) [-1248.845] * (-1246.883) (-1248.532) (-1250.114) [-1245.668] -- 0:01:52
18000 -- (-1254.182) (-1251.755) [-1244.487] (-1248.972) * (-1243.184) (-1250.398) [-1247.528] (-1245.221) -- 0:01:49
18500 -- (-1253.768) (-1246.485) [-1246.581] (-1248.169) * [-1242.050] (-1249.902) (-1245.437) (-1243.474) -- 0:02:39
19000 -- (-1248.895) [-1248.640] (-1252.671) (-1252.092) * (-1247.412) (-1246.252) [-1244.774] (-1242.874) -- 0:02:34
19500 -- (-1253.851) (-1247.631) [-1247.604] (-1251.874) * [-1241.990] (-1244.930) (-1251.332) (-1249.504) -- 0:02:30
20000 -- [-1250.706] (-1246.148) (-1244.944) (-1250.872) * (-1243.189) (-1249.128) (-1244.942) [-1249.886] -- 0:02:27
Average standard deviation of split frequencies: 0.011405
20500 -- [-1248.898] (-1248.748) (-1245.625) (-1256.291) * (-1247.438) (-1244.500) (-1249.692) [-1247.396] -- 0:02:23
21000 -- (-1250.857) [-1251.801] (-1249.959) (-1256.620) * (-1246.039) (-1254.408) [-1249.556] (-1248.478) -- 0:02:19
21500 -- (-1251.360) [-1243.213] (-1246.702) (-1252.367) * [-1250.518] (-1252.252) (-1254.594) (-1253.923) -- 0:02:16
22000 -- (-1254.856) (-1244.971) (-1245.922) [-1248.614] * (-1246.340) (-1251.369) [-1249.769] (-1249.717) -- 0:02:13
22500 -- (-1248.978) [-1245.275] (-1255.314) (-1250.935) * [-1245.061] (-1255.588) (-1251.051) (-1257.589) -- 0:02:10
23000 -- (-1252.562) [-1251.128] (-1247.728) (-1251.676) * (-1249.183) [-1248.495] (-1245.312) (-1254.165) -- 0:02:07
23500 -- (-1257.375) (-1243.431) (-1246.755) [-1251.573] * (-1248.541) (-1245.417) [-1251.741] (-1251.825) -- 0:02:04
24000 -- (-1262.759) (-1246.494) (-1250.902) [-1245.456] * [-1246.204] (-1245.151) (-1243.449) (-1248.902) -- 0:02:02
24500 -- (-1250.405) (-1248.759) (-1256.143) [-1244.690] * (-1248.658) (-1246.915) (-1249.273) [-1250.213] -- 0:01:59
25000 -- (-1248.581) (-1249.316) [-1247.186] (-1240.510) * (-1249.155) [-1252.738] (-1244.587) (-1246.264) -- 0:01:57
Average standard deviation of split frequencies: 0.009065
25500 -- (-1255.101) [-1244.284] (-1249.274) (-1244.932) * [-1247.360] (-1251.320) (-1252.941) (-1258.390) -- 0:02:32
26000 -- [-1248.834] (-1252.501) (-1251.870) (-1244.191) * (-1246.731) (-1252.206) (-1248.214) [-1242.227] -- 0:02:29
26500 -- [-1248.105] (-1246.977) (-1259.326) (-1246.813) * (-1247.556) (-1255.218) [-1250.859] (-1244.995) -- 0:02:26
27000 -- [-1244.673] (-1253.476) (-1248.441) (-1252.998) * [-1241.544] (-1250.622) (-1245.145) (-1243.376) -- 0:02:24
27500 -- (-1253.219) (-1250.250) [-1248.584] (-1251.562) * (-1250.245) [-1251.766] (-1250.346) (-1250.390) -- 0:02:21
28000 -- [-1248.060] (-1243.672) (-1254.280) (-1247.930) * (-1246.545) [-1243.628] (-1246.591) (-1255.239) -- 0:02:18
28500 -- (-1248.956) (-1251.079) (-1254.997) [-1246.884] * [-1244.119] (-1246.070) (-1251.569) (-1253.466) -- 0:02:16
29000 -- (-1249.995) [-1250.960] (-1249.517) (-1250.320) * [-1242.510] (-1248.931) (-1248.704) (-1252.911) -- 0:02:13
29500 -- (-1250.844) [-1252.131] (-1247.617) (-1254.898) * (-1256.618) (-1245.608) (-1244.948) [-1253.103] -- 0:02:11
30000 -- [-1254.986] (-1253.347) (-1251.518) (-1249.024) * (-1250.509) (-1250.298) [-1244.589] (-1247.189) -- 0:02:09
Average standard deviation of split frequencies: 0.007686
30500 -- (-1253.167) (-1246.508) (-1248.879) [-1258.111] * (-1254.911) (-1247.309) (-1251.724) [-1247.865] -- 0:02:07
31000 -- (-1249.047) (-1249.719) (-1254.190) [-1252.024] * [-1246.666] (-1255.808) (-1249.728) (-1247.875) -- 0:02:05
31500 -- (-1250.941) [-1243.884] (-1251.672) (-1249.381) * (-1250.360) (-1247.541) (-1248.394) [-1243.651] -- 0:02:02
32000 -- (-1246.898) (-1251.400) (-1255.276) [-1246.099] * [-1245.991] (-1248.786) (-1254.777) (-1251.768) -- 0:02:01
32500 -- (-1251.196) [-1243.140] (-1259.343) (-1247.580) * [-1246.493] (-1244.439) (-1251.933) (-1243.087) -- 0:01:59
33000 -- (-1252.645) (-1246.310) (-1263.935) [-1244.477] * [-1243.976] (-1246.248) (-1250.163) (-1243.968) -- 0:02:26
33500 -- [-1253.008] (-1244.156) (-1255.723) (-1244.729) * (-1249.678) [-1247.446] (-1254.282) (-1251.842) -- 0:02:24
34000 -- (-1248.917) (-1249.753) (-1252.994) [-1250.011] * (-1246.942) (-1243.648) [-1247.976] (-1258.004) -- 0:02:22
34500 -- [-1247.286] (-1251.583) (-1254.911) (-1256.417) * (-1246.684) (-1247.875) (-1252.060) [-1246.081] -- 0:02:19
35000 -- (-1243.719) [-1248.886] (-1256.285) (-1252.318) * (-1247.796) (-1254.340) (-1256.058) [-1247.592] -- 0:02:17
Average standard deviation of split frequencies: 0.013095
35500 -- [-1246.246] (-1249.741) (-1256.366) (-1250.207) * (-1246.748) [-1247.284] (-1251.793) (-1248.853) -- 0:02:15
36000 -- (-1250.417) [-1248.180] (-1254.363) (-1248.285) * (-1246.982) (-1245.959) [-1250.563] (-1248.713) -- 0:02:13
36500 -- (-1248.209) (-1256.052) (-1251.703) [-1244.224] * (-1245.019) (-1252.115) [-1248.348] (-1254.633) -- 0:02:11
37000 -- (-1244.061) (-1253.619) (-1249.374) [-1243.689] * [-1247.967] (-1249.108) (-1249.499) (-1248.600) -- 0:02:10
37500 -- [-1244.111] (-1256.749) (-1254.106) (-1249.291) * (-1251.347) [-1248.019] (-1247.537) (-1250.130) -- 0:02:08
38000 -- [-1246.347] (-1253.101) (-1251.641) (-1245.997) * (-1249.210) [-1249.525] (-1247.006) (-1249.791) -- 0:02:06
38500 -- (-1245.356) (-1255.353) (-1259.231) [-1245.405] * (-1249.923) [-1248.706] (-1248.423) (-1246.555) -- 0:02:04
39000 -- (-1244.184) [-1251.036] (-1251.724) (-1249.325) * (-1251.721) (-1249.133) (-1246.991) [-1241.890] -- 0:02:03
39500 -- (-1241.577) (-1253.179) [-1247.383] (-1246.675) * (-1248.854) (-1244.737) [-1246.544] (-1245.997) -- 0:02:01
40000 -- (-1246.087) (-1255.994) [-1250.016] (-1250.569) * (-1249.269) (-1245.278) [-1247.659] (-1254.835) -- 0:02:24
Average standard deviation of split frequencies: 0.011592
40500 -- (-1244.532) [-1248.431] (-1257.310) (-1247.524) * (-1246.198) (-1245.828) [-1248.412] (-1243.592) -- 0:02:22
41000 -- [-1243.830] (-1255.632) (-1254.867) (-1245.776) * [-1250.104] (-1246.014) (-1240.156) (-1247.514) -- 0:02:20
41500 -- (-1246.704) (-1246.492) (-1246.094) [-1247.270] * [-1246.659] (-1244.597) (-1248.719) (-1242.582) -- 0:02:18
42000 -- (-1251.512) [-1249.169] (-1245.667) (-1247.184) * (-1245.059) (-1251.395) [-1247.019] (-1246.997) -- 0:02:16
42500 -- [-1244.520] (-1249.867) (-1247.869) (-1246.472) * (-1247.177) (-1246.448) (-1259.297) [-1247.109] -- 0:02:15
43000 -- (-1248.375) [-1251.358] (-1245.332) (-1245.067) * (-1244.529) [-1248.092] (-1243.744) (-1254.786) -- 0:02:13
43500 -- (-1257.473) [-1250.617] (-1245.110) (-1248.848) * (-1244.619) (-1248.336) (-1250.596) [-1256.348] -- 0:02:11
44000 -- (-1249.493) (-1247.211) [-1247.690] (-1246.325) * [-1244.388] (-1244.326) (-1248.375) (-1255.651) -- 0:02:10
44500 -- (-1253.005) (-1249.901) (-1249.645) [-1245.164] * (-1244.138) (-1244.523) (-1251.090) [-1246.705] -- 0:02:08
45000 -- (-1247.406) (-1251.446) (-1247.712) [-1243.667] * (-1245.784) (-1248.947) [-1243.188] (-1253.177) -- 0:02:07
Average standard deviation of split frequencies: 0.010248
45500 -- (-1244.098) (-1251.297) (-1250.445) [-1242.805] * [-1244.924] (-1244.657) (-1242.106) (-1252.720) -- 0:02:05
46000 -- (-1246.742) (-1247.878) (-1255.335) [-1252.191] * (-1242.628) (-1254.559) (-1251.028) [-1245.348] -- 0:02:04
46500 -- (-1245.747) (-1255.769) [-1255.570] (-1249.782) * (-1248.239) (-1244.848) [-1249.648] (-1243.891) -- 0:02:03
47000 -- (-1253.377) (-1252.774) (-1255.506) [-1247.915] * (-1248.357) (-1247.360) [-1249.914] (-1250.899) -- 0:02:21
47500 -- [-1244.591] (-1248.740) (-1251.118) (-1245.706) * (-1244.373) (-1250.808) (-1249.130) [-1249.352] -- 0:02:20
48000 -- (-1254.792) (-1254.501) (-1245.860) [-1246.170] * (-1256.058) [-1249.247] (-1260.011) (-1251.657) -- 0:02:18
48500 -- (-1260.927) [-1250.745] (-1248.594) (-1251.363) * (-1257.878) (-1247.779) (-1246.935) [-1242.941] -- 0:02:17
49000 -- (-1251.052) (-1250.743) (-1254.067) [-1242.807] * [-1257.238] (-1247.490) (-1253.801) (-1248.203) -- 0:02:15
49500 -- (-1249.852) (-1249.144) (-1251.853) [-1245.576] * (-1248.830) [-1244.666] (-1251.525) (-1249.808) -- 0:02:14
50000 -- (-1250.778) (-1250.437) (-1256.098) [-1249.509] * [-1245.621] (-1246.224) (-1248.373) (-1244.896) -- 0:02:13
Average standard deviation of split frequencies: 0.009304
50500 -- (-1245.902) (-1243.029) (-1250.690) [-1244.926] * (-1252.059) (-1251.713) [-1249.060] (-1243.424) -- 0:02:11
51000 -- (-1250.719) (-1250.358) (-1246.849) [-1242.217] * (-1254.964) (-1248.332) (-1252.558) [-1247.158] -- 0:02:10
51500 -- (-1246.255) (-1247.302) [-1245.788] (-1244.916) * (-1245.307) (-1246.645) [-1244.759] (-1252.058) -- 0:02:08
52000 -- (-1246.827) [-1249.155] (-1261.992) (-1251.691) * [-1246.983] (-1246.214) (-1247.239) (-1254.349) -- 0:02:07
52500 -- (-1251.887) [-1250.554] (-1257.169) (-1253.556) * (-1250.991) (-1246.112) (-1255.113) [-1247.993] -- 0:02:06
53000 -- (-1244.451) (-1248.630) [-1247.923] (-1245.815) * (-1246.100) (-1253.309) [-1252.319] (-1245.608) -- 0:02:05
53500 -- (-1249.947) [-1253.771] (-1248.542) (-1254.226) * (-1246.783) (-1246.636) (-1246.347) [-1245.387] -- 0:02:03
54000 -- (-1247.162) [-1248.566] (-1245.440) (-1251.186) * (-1247.515) [-1245.658] (-1251.818) (-1246.454) -- 0:02:02
54500 -- (-1245.960) (-1249.176) (-1248.287) [-1251.885] * (-1251.583) (-1245.600) [-1247.552] (-1253.967) -- 0:02:18
55000 -- (-1250.274) (-1248.895) [-1252.405] (-1250.716) * (-1246.163) (-1246.592) (-1251.206) [-1251.490] -- 0:02:17
Average standard deviation of split frequencies: 0.008418
55500 -- [-1253.305] (-1254.014) (-1246.094) (-1249.311) * (-1248.027) (-1247.112) [-1246.334] (-1247.083) -- 0:02:16
56000 -- (-1244.763) [-1251.722] (-1246.124) (-1246.088) * (-1248.485) (-1245.831) (-1245.058) [-1244.731] -- 0:02:14
56500 -- [-1243.983] (-1247.723) (-1245.434) (-1253.565) * (-1248.744) (-1244.076) (-1250.088) [-1246.112] -- 0:02:13
57000 -- [-1248.094] (-1257.185) (-1242.332) (-1249.855) * (-1245.696) [-1245.750] (-1250.433) (-1243.986) -- 0:02:12
57500 -- (-1249.354) (-1250.476) [-1243.115] (-1252.828) * (-1249.923) (-1243.446) [-1244.418] (-1247.599) -- 0:02:11
58000 -- (-1249.560) [-1249.275] (-1245.810) (-1252.647) * (-1252.510) (-1250.529) (-1244.086) [-1243.575] -- 0:02:09
58500 -- [-1249.687] (-1250.935) (-1249.865) (-1248.980) * (-1244.553) [-1248.290] (-1246.073) (-1249.414) -- 0:02:08
59000 -- [-1246.368] (-1246.628) (-1252.748) (-1245.174) * (-1247.875) [-1240.383] (-1243.776) (-1251.228) -- 0:02:07
59500 -- (-1245.127) (-1244.560) (-1251.009) [-1245.028] * (-1244.075) [-1248.701] (-1248.403) (-1251.565) -- 0:02:06
60000 -- (-1247.386) [-1244.085] (-1267.618) (-1249.559) * (-1254.472) (-1248.993) (-1251.002) [-1246.908] -- 0:02:05
Average standard deviation of split frequencies: 0.007770
60500 -- [-1249.415] (-1244.864) (-1257.647) (-1247.020) * (-1247.380) (-1249.714) [-1249.881] (-1244.603) -- 0:02:04
61000 -- (-1249.838) [-1245.434] (-1254.588) (-1250.890) * (-1255.283) (-1248.071) (-1252.372) [-1245.598] -- 0:02:03
61500 -- [-1246.625] (-1246.430) (-1250.113) (-1243.203) * (-1254.633) [-1248.496] (-1247.290) (-1252.805) -- 0:02:17
62000 -- (-1247.733) (-1242.312) [-1247.855] (-1249.401) * (-1251.567) [-1245.126] (-1249.547) (-1247.659) -- 0:02:16
62500 -- (-1245.309) (-1246.511) (-1255.970) [-1243.364] * (-1256.149) [-1248.005] (-1248.026) (-1254.516) -- 0:02:15
63000 -- (-1244.411) (-1248.493) (-1249.929) [-1244.067] * (-1262.858) [-1245.420] (-1243.758) (-1246.795) -- 0:02:13
63500 -- (-1250.404) (-1246.721) (-1258.783) [-1243.142] * (-1248.674) (-1248.525) (-1253.877) [-1245.141] -- 0:02:12
64000 -- [-1248.076] (-1244.713) (-1251.209) (-1246.699) * (-1251.707) (-1249.225) (-1250.533) [-1252.901] -- 0:02:11
64500 -- [-1244.468] (-1251.551) (-1250.781) (-1245.687) * [-1249.070] (-1250.907) (-1250.046) (-1246.499) -- 0:02:10
65000 -- [-1243.699] (-1249.046) (-1243.624) (-1252.968) * (-1245.905) [-1242.652] (-1249.838) (-1249.567) -- 0:02:09
Average standard deviation of split frequencies: 0.007142
65500 -- (-1251.658) [-1253.950] (-1245.509) (-1249.407) * (-1252.801) [-1248.567] (-1247.507) (-1248.570) -- 0:02:08
66000 -- (-1252.771) [-1249.255] (-1246.246) (-1251.740) * (-1244.625) [-1247.503] (-1255.826) (-1249.408) -- 0:02:07
66500 -- (-1244.170) (-1247.119) (-1246.519) [-1248.134] * (-1248.398) (-1253.792) [-1248.146] (-1244.164) -- 0:02:06
67000 -- [-1248.806] (-1247.334) (-1249.679) (-1249.744) * (-1250.516) (-1243.386) (-1249.136) [-1246.673] -- 0:02:05
67500 -- (-1248.272) (-1248.401) [-1244.383] (-1249.892) * [-1250.284] (-1242.879) (-1252.909) (-1246.923) -- 0:02:04
68000 -- (-1248.617) [-1246.500] (-1252.429) (-1253.205) * [-1247.695] (-1248.978) (-1244.490) (-1245.464) -- 0:02:03
68500 -- (-1244.840) (-1249.739) [-1249.862] (-1249.167) * (-1247.623) [-1253.073] (-1245.813) (-1246.187) -- 0:02:15
69000 -- [-1247.878] (-1243.824) (-1248.201) (-1248.471) * (-1252.485) (-1242.887) [-1248.469] (-1255.192) -- 0:02:14
69500 -- (-1247.693) (-1251.133) [-1246.638] (-1249.398) * (-1251.475) (-1247.559) (-1253.196) [-1251.346] -- 0:02:13
70000 -- (-1254.533) (-1256.102) [-1248.895] (-1255.104) * [-1257.728] (-1245.091) (-1250.388) (-1254.691) -- 0:02:12
Average standard deviation of split frequencies: 0.006671
70500 -- (-1251.899) [-1250.831] (-1244.745) (-1247.533) * (-1253.802) [-1244.202] (-1248.155) (-1254.108) -- 0:02:11
71000 -- (-1246.525) (-1247.144) [-1247.355] (-1245.903) * [-1252.863] (-1247.424) (-1243.354) (-1245.918) -- 0:02:10
71500 -- [-1247.939] (-1255.114) (-1247.673) (-1245.269) * (-1250.443) (-1252.546) [-1245.436] (-1243.128) -- 0:02:09
72000 -- (-1244.431) [-1244.141] (-1248.937) (-1245.860) * (-1246.675) (-1250.660) [-1243.982] (-1248.463) -- 0:02:08
72500 -- (-1245.880) (-1242.238) (-1249.286) [-1248.262] * (-1254.132) (-1245.725) [-1244.102] (-1247.872) -- 0:02:07
73000 -- (-1246.362) (-1253.387) [-1243.865] (-1245.721) * [-1246.054] (-1248.499) (-1248.580) (-1249.039) -- 0:02:06
73500 -- (-1247.620) (-1247.528) [-1245.266] (-1245.318) * (-1247.240) [-1245.754] (-1252.894) (-1247.361) -- 0:02:06
74000 -- (-1246.282) [-1246.366] (-1245.558) (-1244.790) * [-1244.294] (-1242.400) (-1247.324) (-1247.390) -- 0:02:05
74500 -- (-1253.191) [-1248.920] (-1251.526) (-1254.608) * (-1245.983) [-1249.153] (-1249.381) (-1245.681) -- 0:02:04
75000 -- (-1246.940) [-1248.056] (-1256.960) (-1250.701) * (-1242.261) [-1246.167] (-1245.468) (-1251.684) -- 0:02:03
Average standard deviation of split frequencies: 0.006203
75500 -- (-1244.643) [-1245.161] (-1250.955) (-1249.823) * (-1246.872) [-1246.867] (-1247.956) (-1247.904) -- 0:02:14
76000 -- [-1243.799] (-1245.912) (-1248.355) (-1254.100) * [-1251.774] (-1245.980) (-1248.074) (-1246.847) -- 0:02:13
76500 -- (-1245.736) (-1247.257) [-1245.764] (-1249.074) * [-1245.824] (-1247.903) (-1248.129) (-1246.812) -- 0:02:12
77000 -- (-1245.800) (-1253.413) (-1250.759) [-1248.129] * (-1249.419) (-1248.948) [-1249.028] (-1248.522) -- 0:02:11
77500 -- [-1245.529] (-1250.926) (-1248.080) (-1252.728) * (-1252.769) [-1245.371] (-1247.113) (-1248.937) -- 0:02:10
78000 -- [-1249.037] (-1248.869) (-1252.344) (-1245.571) * (-1249.608) [-1245.964] (-1246.218) (-1254.528) -- 0:02:10
78500 -- (-1249.574) [-1248.967] (-1248.311) (-1247.074) * (-1246.725) [-1245.395] (-1247.474) (-1245.528) -- 0:02:09
79000 -- [-1248.016] (-1249.297) (-1249.604) (-1244.544) * (-1254.453) [-1248.556] (-1251.835) (-1246.287) -- 0:02:08
79500 -- (-1252.414) [-1247.642] (-1245.579) (-1247.293) * (-1246.855) (-1246.622) (-1248.754) [-1253.106] -- 0:02:07
80000 -- (-1252.056) (-1254.493) (-1247.266) [-1244.834] * (-1245.401) (-1246.196) (-1247.866) [-1249.789] -- 0:02:06
Average standard deviation of split frequencies: 0.008766
80500 -- (-1245.387) (-1246.638) [-1245.225] (-1248.121) * (-1247.472) (-1241.660) [-1244.351] (-1246.385) -- 0:02:05
81000 -- (-1249.258) [-1246.765] (-1248.995) (-1242.863) * [-1244.396] (-1243.660) (-1244.014) (-1247.342) -- 0:02:04
81500 -- (-1246.652) (-1253.862) (-1246.331) [-1244.590] * (-1247.698) [-1246.338] (-1246.154) (-1247.260) -- 0:02:03
82000 -- (-1245.687) (-1255.382) (-1249.969) [-1254.069] * (-1246.309) (-1248.270) [-1249.961] (-1245.313) -- 0:02:03
82500 -- (-1247.053) (-1247.892) [-1245.863] (-1248.572) * [-1250.088] (-1244.888) (-1247.569) (-1245.347) -- 0:02:13
83000 -- (-1251.071) (-1247.696) [-1251.941] (-1252.639) * (-1253.928) (-1248.135) (-1249.601) [-1244.097] -- 0:02:12
83500 -- (-1251.198) (-1245.979) (-1245.028) [-1245.672] * (-1252.563) (-1249.177) (-1250.594) [-1243.991] -- 0:02:11
84000 -- (-1253.986) [-1247.921] (-1245.517) (-1244.414) * (-1255.383) (-1251.561) [-1246.405] (-1244.013) -- 0:02:10
84500 -- (-1246.888) (-1249.284) (-1243.626) [-1243.454] * (-1250.429) [-1245.145] (-1253.237) (-1246.620) -- 0:02:10
85000 -- [-1245.617] (-1250.533) (-1248.819) (-1245.851) * (-1254.180) [-1248.926] (-1245.492) (-1247.658) -- 0:02:09
Average standard deviation of split frequencies: 0.008222
85500 -- (-1247.192) (-1245.674) (-1248.936) [-1244.103] * (-1255.462) (-1246.989) (-1244.542) [-1252.025] -- 0:02:08
86000 -- (-1245.010) (-1254.889) (-1250.971) [-1245.342] * (-1244.300) (-1251.147) [-1243.559] (-1246.922) -- 0:02:07
86500 -- [-1246.551] (-1245.713) (-1246.276) (-1244.804) * (-1247.430) (-1244.937) (-1247.731) [-1245.868] -- 0:02:06
87000 -- [-1241.645] (-1249.704) (-1248.410) (-1249.173) * (-1251.457) (-1249.117) [-1245.868] (-1253.669) -- 0:02:05
87500 -- (-1243.344) (-1250.738) [-1247.705] (-1253.188) * (-1247.263) (-1245.422) [-1240.126] (-1252.950) -- 0:02:05
88000 -- (-1248.183) (-1247.733) (-1253.766) [-1248.184] * [-1244.383] (-1246.716) (-1249.761) (-1245.586) -- 0:02:04
88500 -- [-1249.384] (-1250.837) (-1249.304) (-1252.490) * (-1249.654) (-1256.248) [-1243.808] (-1245.484) -- 0:02:03
89000 -- (-1248.159) (-1256.219) [-1246.431] (-1248.231) * (-1248.260) [-1247.015] (-1246.205) (-1247.128) -- 0:02:02
89500 -- [-1244.940] (-1254.182) (-1245.454) (-1251.677) * (-1248.409) [-1246.112] (-1250.371) (-1244.348) -- 0:02:12
90000 -- [-1245.013] (-1254.101) (-1251.121) (-1241.145) * (-1251.672) [-1247.796] (-1248.973) (-1246.016) -- 0:02:11
Average standard deviation of split frequencies: 0.007799
90500 -- (-1250.055) (-1251.204) [-1246.650] (-1243.781) * (-1252.179) [-1251.047] (-1245.292) (-1251.600) -- 0:02:10
91000 -- (-1252.444) (-1247.377) [-1242.840] (-1254.573) * (-1243.750) (-1251.301) [-1243.046] (-1248.749) -- 0:02:09
91500 -- (-1254.941) (-1249.835) [-1247.606] (-1255.767) * [-1247.449] (-1248.237) (-1247.001) (-1241.532) -- 0:02:09
92000 -- (-1251.902) (-1250.341) (-1244.284) [-1245.957] * (-1256.263) [-1244.917] (-1250.575) (-1254.123) -- 0:02:08
92500 -- (-1250.567) (-1260.122) (-1245.320) [-1245.491] * (-1244.840) (-1248.805) (-1253.154) [-1245.506] -- 0:02:07
93000 -- (-1246.018) (-1258.985) [-1245.326] (-1249.062) * (-1246.365) (-1254.774) (-1253.336) [-1249.837] -- 0:02:06
93500 -- [-1245.637] (-1252.074) (-1242.351) (-1251.070) * (-1249.262) (-1255.077) (-1251.334) [-1248.081] -- 0:02:06
94000 -- (-1243.958) (-1251.240) [-1247.596] (-1255.838) * (-1244.898) (-1251.734) (-1249.801) [-1254.624] -- 0:02:05
94500 -- [-1243.967] (-1250.814) (-1250.478) (-1250.228) * (-1255.736) [-1247.786] (-1253.779) (-1249.725) -- 0:02:04
95000 -- (-1244.113) (-1251.261) [-1254.000] (-1251.421) * (-1250.831) [-1247.897] (-1254.542) (-1254.209) -- 0:02:03
Average standard deviation of split frequencies: 0.004910
95500 -- (-1245.909) [-1251.092] (-1245.398) (-1252.994) * (-1253.831) [-1244.687] (-1255.090) (-1247.979) -- 0:02:03
96000 -- (-1248.496) [-1246.976] (-1247.702) (-1252.018) * (-1254.004) (-1246.075) (-1251.479) [-1245.928] -- 0:02:02
96500 -- (-1254.651) [-1246.465] (-1246.230) (-1248.942) * [-1250.291] (-1244.004) (-1249.984) (-1248.037) -- 0:02:11
97000 -- (-1249.566) [-1243.370] (-1245.172) (-1249.140) * (-1252.624) (-1252.578) [-1250.511] (-1246.975) -- 0:02:10
97500 -- (-1249.952) [-1246.301] (-1243.822) (-1249.869) * (-1248.986) (-1245.508) [-1248.269] (-1246.542) -- 0:02:09
98000 -- [-1248.954] (-1244.646) (-1247.349) (-1247.521) * [-1251.858] (-1252.398) (-1245.823) (-1248.803) -- 0:02:08
98500 -- (-1245.410) (-1244.989) (-1243.374) [-1247.079] * (-1249.644) (-1254.586) [-1250.048] (-1251.182) -- 0:02:08
99000 -- [-1242.470] (-1253.651) (-1246.853) (-1247.884) * (-1246.385) [-1244.644] (-1246.356) (-1247.564) -- 0:02:07
99500 -- [-1243.439] (-1243.176) (-1243.093) (-1248.126) * [-1244.666] (-1250.178) (-1253.153) (-1248.067) -- 0:02:06
100000 -- (-1251.530) [-1245.761] (-1249.362) (-1244.152) * (-1244.180) (-1252.216) [-1247.603] (-1251.282) -- 0:02:05
Average standard deviation of split frequencies: 0.004683
100500 -- (-1246.049) [-1247.426] (-1248.958) (-1247.293) * (-1247.745) (-1244.635) [-1244.635] (-1251.474) -- 0:02:05
101000 -- (-1249.287) (-1245.101) (-1250.257) [-1250.664] * (-1244.987) (-1251.958) (-1252.754) [-1243.922] -- 0:02:04
101500 -- (-1245.904) [-1248.076] (-1250.828) (-1252.398) * [-1252.759] (-1252.809) (-1252.344) (-1245.715) -- 0:02:03
102000 -- (-1249.114) (-1246.780) [-1245.544] (-1250.022) * (-1254.528) (-1251.903) (-1246.720) [-1243.892] -- 0:02:03
102500 -- (-1248.332) [-1247.814] (-1242.273) (-1249.254) * (-1250.824) (-1250.604) [-1252.805] (-1247.671) -- 0:02:02
103000 -- [-1248.764] (-1247.743) (-1246.641) (-1247.561) * (-1242.375) (-1250.329) [-1250.439] (-1247.195) -- 0:02:01
103500 -- (-1254.116) (-1251.100) (-1246.116) [-1244.766] * (-1245.391) (-1249.817) [-1249.272] (-1250.143) -- 0:02:01
104000 -- (-1253.553) [-1242.965] (-1245.080) (-1243.836) * (-1248.195) [-1250.844] (-1250.900) (-1249.542) -- 0:02:09
104500 -- (-1248.748) (-1246.847) [-1244.759] (-1244.416) * (-1244.987) [-1247.406] (-1246.630) (-1252.834) -- 0:02:08
105000 -- (-1245.436) (-1251.877) (-1247.953) [-1249.211] * [-1244.365] (-1253.476) (-1253.207) (-1243.351) -- 0:02:07
Average standard deviation of split frequencies: 0.004447
105500 -- [-1247.177] (-1250.985) (-1247.867) (-1254.063) * [-1245.805] (-1254.847) (-1252.338) (-1250.743) -- 0:02:07
106000 -- (-1252.410) (-1246.826) (-1250.395) [-1248.122] * (-1245.440) [-1242.412] (-1255.613) (-1247.035) -- 0:02:06
106500 -- (-1252.611) (-1255.623) (-1244.613) [-1246.423] * (-1248.201) [-1247.391] (-1254.702) (-1244.193) -- 0:02:05
107000 -- (-1248.160) (-1244.468) (-1257.947) [-1245.090] * (-1248.243) [-1248.081] (-1254.284) (-1243.453) -- 0:02:05
107500 -- (-1252.378) (-1250.757) (-1253.952) [-1243.136] * (-1247.064) (-1251.453) (-1256.785) [-1248.165] -- 0:02:04
108000 -- (-1249.362) (-1254.475) (-1249.682) [-1243.567] * (-1254.118) (-1246.988) (-1248.454) [-1246.263] -- 0:02:03
108500 -- (-1252.232) (-1247.945) (-1248.851) [-1243.894] * (-1245.316) [-1246.999] (-1252.264) (-1246.398) -- 0:02:03
109000 -- (-1255.757) (-1247.757) (-1249.587) [-1243.778] * [-1246.838] (-1250.890) (-1246.893) (-1248.871) -- 0:02:02
109500 -- (-1255.150) [-1249.461] (-1248.831) (-1247.933) * (-1248.863) (-1247.360) [-1248.013] (-1252.191) -- 0:02:01
110000 -- (-1258.697) (-1251.065) (-1248.609) [-1245.378] * (-1251.615) (-1249.445) (-1247.911) [-1249.979] -- 0:02:01
Average standard deviation of split frequencies: 0.004260
110500 -- [-1245.987] (-1253.716) (-1251.598) (-1245.584) * (-1245.812) (-1249.368) [-1247.475] (-1250.878) -- 0:02:00
111000 -- (-1246.429) [-1246.672] (-1253.928) (-1245.088) * (-1246.912) (-1244.764) (-1245.802) [-1250.400] -- 0:02:00
111500 -- (-1242.806) (-1250.499) [-1247.996] (-1245.875) * [-1242.364] (-1246.886) (-1245.596) (-1251.359) -- 0:02:07
112000 -- (-1242.011) (-1251.469) [-1241.918] (-1247.605) * (-1240.794) [-1250.204] (-1242.417) (-1248.028) -- 0:02:06
112500 -- (-1245.954) [-1253.378] (-1245.826) (-1250.402) * [-1245.914] (-1242.328) (-1243.590) (-1253.392) -- 0:02:06
113000 -- (-1244.703) (-1246.757) (-1250.472) [-1254.002] * (-1247.538) [-1241.868] (-1247.478) (-1248.632) -- 0:02:05
113500 -- (-1246.039) [-1247.994] (-1244.164) (-1257.021) * [-1245.304] (-1252.875) (-1248.816) (-1251.503) -- 0:02:04
114000 -- [-1245.756] (-1245.870) (-1248.315) (-1250.010) * (-1252.627) [-1248.110] (-1246.163) (-1245.932) -- 0:02:04
114500 -- [-1244.213] (-1250.724) (-1251.363) (-1250.248) * (-1252.214) (-1246.099) (-1246.206) [-1252.978] -- 0:02:03
115000 -- [-1246.756] (-1245.980) (-1248.553) (-1254.783) * (-1254.486) (-1245.923) [-1248.053] (-1248.874) -- 0:02:03
Average standard deviation of split frequencies: 0.002032
115500 -- (-1253.283) [-1245.421] (-1247.828) (-1249.883) * [-1250.795] (-1246.064) (-1245.649) (-1248.552) -- 0:02:02
116000 -- (-1251.329) (-1247.793) [-1250.323] (-1245.069) * (-1254.496) [-1248.336] (-1244.918) (-1257.068) -- 0:02:01
116500 -- (-1250.224) [-1247.777] (-1245.652) (-1248.081) * (-1246.316) (-1247.306) (-1243.698) [-1251.481] -- 0:02:01
117000 -- (-1250.689) (-1247.145) [-1249.622] (-1249.657) * (-1249.674) (-1249.665) [-1248.164] (-1248.544) -- 0:02:00
117500 -- (-1250.826) (-1246.554) [-1250.211] (-1252.128) * (-1248.163) (-1246.599) (-1249.513) [-1247.918] -- 0:02:00
118000 -- [-1245.475] (-1252.702) (-1248.955) (-1252.780) * [-1246.775] (-1249.506) (-1250.023) (-1248.666) -- 0:01:59
118500 -- [-1248.120] (-1249.364) (-1256.050) (-1257.856) * (-1245.107) [-1254.137] (-1244.223) (-1253.362) -- 0:02:06
119000 -- (-1247.347) (-1248.335) [-1249.742] (-1249.618) * [-1248.459] (-1254.435) (-1250.000) (-1250.114) -- 0:02:05
119500 -- (-1243.776) (-1251.365) [-1248.479] (-1247.933) * [-1245.867] (-1248.264) (-1250.616) (-1250.609) -- 0:02:05
120000 -- [-1242.148] (-1251.516) (-1246.462) (-1252.004) * [-1245.287] (-1247.417) (-1251.182) (-1252.577) -- 0:02:04
Average standard deviation of split frequencies: 0.001953
120500 -- (-1248.081) (-1246.416) (-1247.280) [-1246.174] * (-1245.333) (-1245.445) (-1251.976) [-1248.150] -- 0:02:04
121000 -- (-1252.900) (-1244.263) [-1245.240] (-1244.827) * (-1246.930) (-1258.279) [-1252.190] (-1243.951) -- 0:02:03
121500 -- [-1249.507] (-1249.110) (-1240.706) (-1247.988) * (-1247.108) [-1247.185] (-1251.181) (-1246.199) -- 0:02:02
122000 -- (-1253.947) (-1249.127) [-1241.937] (-1244.852) * [-1248.111] (-1245.302) (-1249.647) (-1246.553) -- 0:02:02
122500 -- (-1245.482) [-1246.049] (-1242.809) (-1250.093) * [-1255.155] (-1250.073) (-1246.266) (-1247.224) -- 0:02:01
123000 -- (-1253.140) (-1247.629) [-1244.164] (-1247.829) * (-1252.585) (-1248.873) (-1246.912) [-1245.039] -- 0:02:01
123500 -- (-1250.671) [-1254.660] (-1248.813) (-1252.709) * (-1253.588) (-1245.428) [-1246.808] (-1246.454) -- 0:02:00
124000 -- [-1243.335] (-1256.752) (-1242.567) (-1248.473) * (-1248.996) (-1247.864) (-1249.355) [-1246.710] -- 0:02:00
124500 -- [-1244.088] (-1251.197) (-1245.461) (-1253.242) * [-1247.110] (-1247.804) (-1252.980) (-1248.108) -- 0:01:59
125000 -- (-1247.996) (-1257.131) [-1244.690] (-1247.005) * (-1245.860) (-1249.612) [-1247.416] (-1250.049) -- 0:01:59
Average standard deviation of split frequencies: 0.000000
125500 -- (-1246.695) (-1249.008) [-1245.547] (-1250.229) * [-1244.323] (-1244.048) (-1247.045) (-1252.484) -- 0:01:58
126000 -- [-1254.031] (-1251.972) (-1251.047) (-1248.551) * [-1250.242] (-1246.510) (-1249.146) (-1251.668) -- 0:02:04
126500 -- (-1248.376) (-1245.915) (-1247.989) [-1249.637] * (-1248.329) (-1250.134) (-1245.960) [-1244.803] -- 0:02:04
127000 -- [-1243.788] (-1243.573) (-1249.522) (-1245.494) * (-1246.787) (-1252.824) (-1255.571) [-1244.921] -- 0:02:03
127500 -- (-1243.906) (-1249.167) (-1243.053) [-1246.461] * (-1245.017) (-1249.968) [-1245.227] (-1245.222) -- 0:02:03
128000 -- (-1248.005) [-1244.722] (-1245.297) (-1248.835) * (-1251.148) (-1248.993) [-1245.411] (-1250.183) -- 0:02:02
128500 -- [-1248.911] (-1256.025) (-1245.659) (-1248.031) * (-1245.597) (-1247.922) [-1244.627] (-1246.938) -- 0:02:02
129000 -- (-1259.741) (-1246.952) [-1250.543] (-1257.031) * (-1252.592) (-1251.319) [-1246.725] (-1248.057) -- 0:02:01
129500 -- (-1248.662) [-1245.154] (-1243.760) (-1247.454) * (-1263.225) [-1246.604] (-1248.585) (-1246.938) -- 0:02:00
130000 -- (-1249.754) (-1249.703) (-1248.664) [-1244.873] * (-1248.019) (-1248.952) [-1246.009] (-1248.790) -- 0:02:00
Average standard deviation of split frequencies: 0.000000
130500 -- [-1248.376] (-1249.180) (-1247.854) (-1245.964) * (-1247.365) (-1243.709) [-1243.767] (-1251.381) -- 0:01:59
131000 -- (-1251.662) (-1248.111) (-1247.639) [-1244.723] * (-1246.974) (-1248.735) [-1246.860] (-1242.749) -- 0:01:59
131500 -- (-1251.198) [-1245.078] (-1249.473) (-1252.173) * (-1248.561) [-1247.760] (-1244.158) (-1251.581) -- 0:01:58
132000 -- (-1249.361) (-1254.676) [-1247.079] (-1248.969) * (-1247.964) (-1249.886) (-1246.595) [-1243.243] -- 0:01:58
132500 -- [-1246.909] (-1250.313) (-1250.449) (-1241.384) * [-1248.993] (-1242.610) (-1245.062) (-1248.002) -- 0:01:57
133000 -- (-1250.896) (-1254.753) (-1254.409) [-1250.236] * (-1247.399) (-1247.211) (-1251.817) [-1247.841] -- 0:01:57
133500 -- (-1251.203) (-1253.045) [-1251.530] (-1245.121) * (-1250.840) [-1247.144] (-1252.374) (-1244.768) -- 0:02:03
134000 -- [-1245.593] (-1253.852) (-1258.348) (-1252.347) * [-1247.824] (-1247.666) (-1250.406) (-1249.495) -- 0:02:02
134500 -- (-1252.150) [-1251.783] (-1251.396) (-1246.700) * (-1244.907) [-1247.896] (-1248.619) (-1247.454) -- 0:02:02
135000 -- (-1243.920) (-1250.610) (-1250.325) [-1243.271] * (-1251.793) [-1246.187] (-1248.478) (-1256.015) -- 0:02:01
Average standard deviation of split frequencies: 0.001733
135500 -- (-1244.303) (-1249.068) (-1250.722) [-1246.026] * (-1249.771) (-1247.589) [-1250.724] (-1253.025) -- 0:02:01
136000 -- (-1254.208) (-1254.563) [-1253.710] (-1247.027) * [-1247.510] (-1252.657) (-1253.462) (-1246.624) -- 0:02:00
136500 -- (-1245.633) [-1253.651] (-1248.304) (-1250.368) * (-1245.433) [-1248.890] (-1244.188) (-1245.171) -- 0:02:00
137000 -- [-1248.031] (-1249.100) (-1244.200) (-1251.177) * [-1253.513] (-1247.696) (-1245.168) (-1250.882) -- 0:01:59
137500 -- [-1245.851] (-1255.716) (-1254.773) (-1247.870) * (-1249.314) (-1245.447) (-1251.439) [-1249.132] -- 0:01:59
138000 -- [-1253.755] (-1255.140) (-1253.626) (-1248.718) * (-1244.470) (-1250.952) [-1246.833] (-1252.479) -- 0:01:58
138500 -- (-1250.961) [-1247.317] (-1255.048) (-1251.287) * [-1248.435] (-1245.146) (-1249.801) (-1250.272) -- 0:01:58
139000 -- [-1245.763] (-1249.216) (-1252.087) (-1248.610) * (-1252.959) (-1249.069) [-1242.707] (-1252.581) -- 0:01:57
139500 -- [-1246.018] (-1246.741) (-1244.836) (-1246.458) * (-1247.139) [-1252.402] (-1247.227) (-1253.517) -- 0:01:57
140000 -- [-1247.706] (-1246.766) (-1250.733) (-1248.110) * (-1251.927) (-1243.958) (-1259.769) [-1249.090] -- 0:01:56
Average standard deviation of split frequencies: 0.003351
140500 -- (-1250.731) (-1247.799) [-1246.008] (-1248.003) * (-1246.224) (-1246.343) (-1253.627) [-1249.826] -- 0:01:56
141000 -- (-1243.618) [-1253.114] (-1252.733) (-1244.045) * (-1249.258) (-1250.349) (-1244.305) [-1249.141] -- 0:02:01
141500 -- [-1249.274] (-1251.173) (-1252.537) (-1245.112) * (-1249.698) (-1243.822) (-1250.443) [-1248.734] -- 0:02:01
142000 -- [-1246.947] (-1249.411) (-1252.304) (-1246.751) * (-1246.219) (-1250.602) (-1252.908) [-1246.258] -- 0:02:00
142500 -- (-1244.634) [-1248.793] (-1254.401) (-1242.400) * (-1248.190) (-1256.282) (-1259.432) [-1243.366] -- 0:02:00
143000 -- (-1247.727) [-1249.157] (-1246.107) (-1249.643) * (-1251.550) [-1249.756] (-1254.581) (-1244.979) -- 0:01:59
143500 -- (-1244.829) (-1250.587) [-1246.143] (-1249.110) * (-1252.428) (-1253.681) (-1249.885) [-1245.882] -- 0:01:59
144000 -- (-1248.997) (-1249.168) [-1241.969] (-1248.393) * (-1248.547) (-1252.203) [-1246.895] (-1249.982) -- 0:01:58
144500 -- (-1254.074) [-1245.341] (-1249.272) (-1245.126) * (-1248.664) (-1251.645) (-1254.273) [-1245.038] -- 0:01:58
145000 -- (-1253.489) (-1245.949) (-1251.532) [-1243.391] * [-1248.072] (-1253.450) (-1255.031) (-1249.816) -- 0:01:57
Average standard deviation of split frequencies: 0.003229
145500 -- (-1254.961) (-1245.707) (-1245.547) [-1243.229] * (-1245.064) [-1247.502] (-1253.951) (-1245.135) -- 0:01:57
146000 -- (-1250.151) (-1251.644) [-1251.176] (-1248.850) * (-1253.769) (-1248.265) (-1251.429) [-1246.771] -- 0:01:56
146500 -- (-1247.216) (-1250.887) (-1248.561) [-1247.372] * [-1255.660] (-1256.233) (-1249.724) (-1249.912) -- 0:01:56
147000 -- (-1250.118) (-1252.005) (-1249.106) [-1245.679] * (-1252.742) (-1249.886) [-1246.878] (-1250.078) -- 0:01:56
147500 -- [-1249.724] (-1250.410) (-1246.316) (-1249.641) * (-1250.945) (-1249.224) [-1248.592] (-1249.022) -- 0:01:55
148000 -- [-1249.183] (-1246.079) (-1249.992) (-1248.828) * (-1248.008) [-1244.824] (-1248.542) (-1249.924) -- 0:02:00
148500 -- (-1250.262) [-1252.460] (-1244.794) (-1246.131) * (-1246.139) [-1247.604] (-1247.897) (-1256.832) -- 0:02:00
149000 -- (-1246.014) (-1249.318) (-1245.465) [-1247.878] * (-1247.081) (-1248.909) [-1244.195] (-1247.607) -- 0:01:59
149500 -- (-1252.862) (-1248.482) (-1246.509) [-1245.681] * (-1250.510) (-1248.631) [-1248.944] (-1246.462) -- 0:01:59
150000 -- (-1254.176) [-1253.530] (-1248.020) (-1248.763) * (-1248.461) (-1256.330) [-1247.676] (-1246.303) -- 0:01:58
Average standard deviation of split frequencies: 0.003129
150500 -- (-1250.346) (-1257.341) [-1248.960] (-1248.341) * (-1253.194) [-1251.124] (-1256.721) (-1244.475) -- 0:01:58
151000 -- [-1245.838] (-1256.622) (-1251.890) (-1247.008) * (-1249.626) (-1251.367) [-1249.623] (-1247.676) -- 0:01:58
151500 -- (-1246.456) (-1258.174) [-1249.307] (-1253.585) * (-1253.303) (-1253.117) (-1253.047) [-1245.313] -- 0:01:57
152000 -- (-1246.436) [-1246.909] (-1248.740) (-1246.632) * (-1255.026) (-1250.482) (-1251.438) [-1247.266] -- 0:01:57
152500 -- [-1246.999] (-1250.475) (-1246.882) (-1248.931) * (-1256.039) [-1245.751] (-1253.009) (-1250.164) -- 0:01:56
153000 -- (-1253.062) (-1244.642) (-1244.719) [-1249.633] * (-1258.746) (-1248.777) (-1246.842) [-1245.728] -- 0:01:56
153500 -- (-1254.952) (-1242.356) (-1247.461) [-1251.497] * (-1257.248) (-1253.111) (-1248.448) [-1241.449] -- 0:01:55
154000 -- (-1257.959) (-1245.177) (-1251.312) [-1249.767] * (-1255.614) [-1247.617] (-1250.117) (-1244.705) -- 0:01:55
154500 -- (-1256.664) [-1244.549] (-1247.300) (-1245.691) * (-1248.942) [-1248.057] (-1247.109) (-1247.196) -- 0:01:54
155000 -- (-1251.679) (-1244.645) (-1249.927) [-1245.489] * [-1249.374] (-1247.775) (-1249.670) (-1248.460) -- 0:01:54
Average standard deviation of split frequencies: 0.003022
155500 -- (-1254.541) (-1243.321) (-1249.163) [-1241.949] * (-1250.080) [-1250.836] (-1245.032) (-1249.053) -- 0:01:59
156000 -- (-1249.719) (-1248.882) (-1246.952) [-1245.575] * (-1244.820) [-1253.610] (-1250.305) (-1251.044) -- 0:01:59
156500 -- (-1249.974) (-1251.137) [-1246.155] (-1242.923) * (-1249.956) [-1246.879] (-1251.868) (-1245.028) -- 0:01:58
157000 -- (-1254.674) [-1242.899] (-1249.720) (-1249.046) * [-1253.356] (-1249.094) (-1251.508) (-1246.447) -- 0:01:58
157500 -- (-1248.886) [-1251.909] (-1253.893) (-1247.971) * [-1252.362] (-1252.254) (-1250.797) (-1244.392) -- 0:01:57
158000 -- [-1246.132] (-1247.749) (-1251.463) (-1258.367) * (-1245.448) (-1246.783) [-1249.452] (-1248.287) -- 0:01:57
158500 -- (-1244.209) [-1247.732] (-1247.573) (-1247.702) * (-1250.018) (-1245.696) [-1245.145] (-1249.330) -- 0:01:56
159000 -- (-1249.890) [-1246.409] (-1246.562) (-1252.766) * (-1244.466) (-1246.150) [-1250.382] (-1250.558) -- 0:01:56
159500 -- (-1247.744) (-1249.698) [-1249.886] (-1250.441) * (-1244.514) [-1246.298] (-1248.173) (-1244.863) -- 0:01:55
160000 -- (-1243.778) [-1248.481] (-1246.954) (-1243.499) * (-1242.350) [-1247.674] (-1243.956) (-1245.960) -- 0:01:55
Average standard deviation of split frequencies: 0.002934
160500 -- (-1246.975) (-1250.530) (-1252.370) [-1242.681] * (-1248.676) (-1248.068) [-1245.504] (-1248.601) -- 0:01:55
161000 -- [-1247.715] (-1251.824) (-1247.285) (-1248.436) * (-1246.993) (-1248.758) [-1247.993] (-1246.547) -- 0:01:54
161500 -- (-1245.907) [-1253.908] (-1245.920) (-1251.426) * (-1244.579) [-1251.888] (-1243.267) (-1245.538) -- 0:01:54
162000 -- (-1250.240) (-1254.882) (-1247.098) [-1243.277] * (-1244.395) (-1253.672) [-1248.253] (-1248.170) -- 0:01:53
162500 -- (-1250.691) [-1251.736] (-1248.564) (-1259.674) * (-1251.269) (-1250.649) [-1246.938] (-1248.473) -- 0:01:53
163000 -- (-1248.282) [-1246.300] (-1244.349) (-1248.629) * (-1253.054) [-1248.786] (-1251.616) (-1247.873) -- 0:01:58
163500 -- (-1253.702) (-1248.915) (-1247.296) [-1245.843] * (-1250.393) [-1250.844] (-1251.775) (-1250.199) -- 0:01:57
164000 -- (-1254.204) [-1249.029] (-1249.038) (-1250.405) * [-1246.511] (-1250.479) (-1243.175) (-1244.871) -- 0:01:57
164500 -- (-1251.619) (-1242.777) (-1250.141) [-1242.009] * (-1245.140) (-1247.790) [-1242.770] (-1250.295) -- 0:01:56
165000 -- (-1247.817) (-1243.229) [-1245.183] (-1246.755) * (-1247.227) (-1248.755) (-1246.138) [-1241.710] -- 0:01:56
Average standard deviation of split frequencies: 0.002840
165500 -- (-1251.944) (-1245.890) (-1248.665) [-1247.676] * (-1249.113) (-1248.142) (-1246.951) [-1250.280] -- 0:01:55
166000 -- (-1250.896) [-1245.171] (-1251.882) (-1248.470) * [-1252.750] (-1242.586) (-1245.823) (-1247.198) -- 0:01:55
166500 -- (-1251.803) [-1248.805] (-1250.509) (-1244.398) * (-1248.733) [-1247.643] (-1245.527) (-1251.285) -- 0:01:55
167000 -- (-1249.056) (-1247.110) [-1249.704] (-1245.980) * [-1249.195] (-1249.682) (-1250.985) (-1250.455) -- 0:01:54
167500 -- (-1249.805) [-1246.529] (-1246.475) (-1244.883) * (-1254.264) (-1250.362) [-1246.863] (-1246.809) -- 0:01:54
168000 -- (-1251.019) (-1249.654) [-1247.924] (-1249.939) * [-1247.903] (-1248.034) (-1250.506) (-1252.972) -- 0:01:53
168500 -- (-1252.169) (-1246.162) [-1247.145] (-1252.651) * (-1248.489) [-1243.201] (-1244.499) (-1248.852) -- 0:01:53
169000 -- (-1249.250) (-1252.144) (-1258.008) [-1247.831] * (-1247.089) (-1248.063) (-1247.725) [-1249.069] -- 0:01:53
169500 -- [-1251.340] (-1256.147) (-1263.178) (-1247.466) * (-1250.198) (-1246.791) [-1246.936] (-1249.001) -- 0:01:52
170000 -- (-1254.642) [-1250.358] (-1248.051) (-1247.435) * [-1244.928] (-1251.095) (-1243.974) (-1250.145) -- 0:01:52
Average standard deviation of split frequencies: 0.002762
170500 -- (-1254.245) [-1252.819] (-1246.721) (-1242.832) * [-1249.734] (-1245.212) (-1245.392) (-1250.901) -- 0:01:56
171000 -- (-1253.968) (-1247.815) (-1246.623) [-1248.871] * (-1255.644) (-1247.122) [-1249.203] (-1249.774) -- 0:01:56
171500 -- [-1248.631] (-1255.181) (-1249.570) (-1256.344) * (-1253.143) (-1250.902) [-1246.616] (-1249.796) -- 0:01:55
172000 -- (-1243.951) [-1252.370] (-1248.896) (-1245.698) * [-1250.525] (-1244.234) (-1242.026) (-1244.335) -- 0:01:55
172500 -- (-1250.302) [-1245.376] (-1261.092) (-1255.125) * (-1244.787) (-1245.281) [-1244.013] (-1247.128) -- 0:01:55
173000 -- (-1242.886) (-1247.664) (-1246.379) [-1250.240] * (-1246.468) [-1252.121] (-1250.919) (-1248.007) -- 0:01:54
173500 -- [-1252.486] (-1247.365) (-1250.058) (-1251.037) * (-1250.183) (-1256.964) [-1248.663] (-1247.548) -- 0:01:54
174000 -- (-1246.325) (-1246.308) [-1245.438] (-1252.298) * (-1259.257) [-1247.319] (-1251.297) (-1246.611) -- 0:01:53
174500 -- (-1240.558) [-1246.073] (-1245.034) (-1253.478) * [-1250.299] (-1254.133) (-1251.105) (-1248.727) -- 0:01:53
175000 -- [-1251.518] (-1249.433) (-1245.304) (-1251.757) * (-1255.619) [-1246.987] (-1256.396) (-1251.326) -- 0:01:53
Average standard deviation of split frequencies: 0.004018
175500 -- [-1247.177] (-1259.889) (-1248.698) (-1245.598) * (-1253.351) [-1243.155] (-1254.017) (-1252.567) -- 0:01:52
176000 -- [-1242.172] (-1254.528) (-1251.734) (-1243.661) * (-1249.035) (-1245.364) (-1251.510) [-1245.921] -- 0:01:52
176500 -- (-1248.996) (-1253.150) (-1245.636) [-1246.310] * (-1250.330) (-1250.837) (-1253.756) [-1246.817] -- 0:01:51
177000 -- (-1252.694) (-1250.298) (-1252.032) [-1242.999] * (-1249.360) (-1246.675) (-1246.323) [-1241.365] -- 0:01:51
177500 -- (-1245.951) [-1245.983] (-1250.081) (-1248.641) * (-1245.095) (-1246.486) (-1242.147) [-1243.954] -- 0:01:55
178000 -- (-1255.664) (-1249.201) (-1250.795) [-1245.921] * (-1249.820) (-1250.538) (-1245.367) [-1247.206] -- 0:01:55
178500 -- (-1254.677) (-1248.821) (-1253.348) [-1245.573] * (-1246.745) [-1241.927] (-1242.351) (-1262.181) -- 0:01:55
179000 -- (-1247.443) (-1248.212) (-1246.888) [-1242.457] * (-1246.700) [-1240.538] (-1245.474) (-1253.866) -- 0:01:54
179500 -- (-1249.973) (-1254.913) (-1246.788) [-1243.534] * (-1251.455) (-1245.259) [-1245.580] (-1246.677) -- 0:01:54
180000 -- (-1253.627) (-1246.550) (-1249.135) [-1247.035] * (-1251.346) [-1244.398] (-1252.712) (-1246.368) -- 0:01:53
Average standard deviation of split frequencies: 0.003914
180500 -- (-1249.128) (-1254.845) (-1247.254) [-1248.576] * (-1251.542) [-1245.042] (-1249.419) (-1249.919) -- 0:01:53
181000 -- (-1244.072) (-1249.225) (-1251.822) [-1250.319] * (-1248.854) [-1244.856] (-1246.142) (-1245.896) -- 0:01:53
181500 -- (-1247.011) (-1249.054) (-1246.377) [-1246.923] * (-1246.981) (-1250.151) [-1246.304] (-1250.732) -- 0:01:52
182000 -- (-1253.599) (-1244.576) (-1247.550) [-1251.039] * (-1245.570) (-1254.495) [-1250.554] (-1253.952) -- 0:01:52
182500 -- (-1254.590) [-1245.011] (-1245.251) (-1248.386) * (-1244.139) [-1247.831] (-1248.294) (-1247.986) -- 0:01:51
183000 -- (-1247.421) (-1251.190) [-1248.787] (-1250.128) * [-1249.278] (-1250.058) (-1245.538) (-1244.617) -- 0:01:51
183500 -- (-1246.427) (-1247.451) [-1256.057] (-1259.246) * (-1248.737) [-1250.751] (-1250.911) (-1253.287) -- 0:01:51
184000 -- (-1246.411) [-1246.046] (-1258.300) (-1251.706) * (-1249.088) [-1244.989] (-1246.872) (-1246.945) -- 0:01:50
184500 -- [-1245.849] (-1246.727) (-1252.800) (-1251.569) * (-1248.104) (-1245.215) [-1250.682] (-1244.377) -- 0:01:50
185000 -- [-1250.264] (-1245.367) (-1245.094) (-1251.342) * (-1248.754) [-1244.257] (-1246.435) (-1244.600) -- 0:01:54
Average standard deviation of split frequencies: 0.005069
185500 -- [-1245.860] (-1249.536) (-1247.657) (-1252.614) * (-1246.305) (-1248.180) (-1248.818) [-1248.248] -- 0:01:54
186000 -- (-1248.153) (-1247.760) (-1243.587) [-1252.612] * [-1248.340] (-1250.525) (-1249.937) (-1251.890) -- 0:01:53
186500 -- (-1250.132) (-1244.704) (-1246.504) [-1254.835] * (-1243.064) [-1249.048] (-1245.044) (-1249.442) -- 0:01:53
187000 -- [-1245.361] (-1246.331) (-1246.675) (-1252.016) * (-1253.959) (-1248.973) (-1249.588) [-1246.035] -- 0:01:53
187500 -- (-1249.303) (-1245.122) [-1247.668] (-1251.855) * (-1246.047) (-1253.729) (-1251.038) [-1250.229] -- 0:01:52
188000 -- [-1247.538] (-1251.050) (-1248.466) (-1248.591) * (-1253.034) (-1247.085) [-1251.112] (-1247.982) -- 0:01:52
188500 -- (-1246.915) (-1243.742) [-1246.850] (-1251.927) * (-1245.797) (-1244.785) [-1254.693] (-1245.004) -- 0:01:51
189000 -- (-1246.358) (-1244.692) [-1248.701] (-1251.547) * (-1246.443) (-1251.593) (-1250.844) [-1244.417] -- 0:01:51
189500 -- (-1251.689) [-1245.553] (-1254.832) (-1248.571) * (-1246.705) [-1255.221] (-1253.747) (-1246.046) -- 0:01:51
190000 -- [-1249.887] (-1246.654) (-1258.503) (-1256.663) * (-1248.714) [-1247.637] (-1249.103) (-1250.639) -- 0:01:50
Average standard deviation of split frequencies: 0.002472
190500 -- (-1247.364) [-1248.101] (-1251.966) (-1252.851) * (-1252.451) (-1243.038) [-1248.364] (-1252.880) -- 0:01:50
191000 -- (-1247.314) [-1251.854] (-1253.364) (-1247.381) * (-1249.442) (-1246.221) (-1250.808) [-1246.948] -- 0:01:50
191500 -- (-1243.011) (-1246.812) [-1248.402] (-1249.609) * (-1250.802) [-1251.619] (-1241.806) (-1249.074) -- 0:01:49
192000 -- (-1248.571) [-1251.386] (-1249.403) (-1250.640) * (-1250.287) [-1245.779] (-1247.935) (-1249.663) -- 0:01:49
192500 -- (-1255.578) (-1245.777) (-1248.233) [-1253.056] * (-1251.068) (-1248.495) (-1255.273) [-1245.503] -- 0:01:53
193000 -- (-1251.166) (-1253.838) [-1246.898] (-1250.413) * (-1259.866) [-1245.819] (-1249.988) (-1247.126) -- 0:01:52
193500 -- (-1255.324) [-1250.718] (-1250.669) (-1248.635) * (-1253.425) (-1245.054) (-1248.512) [-1246.893] -- 0:01:52
194000 -- [-1244.204] (-1250.485) (-1249.140) (-1246.638) * (-1257.105) (-1245.446) [-1248.679] (-1246.646) -- 0:01:52
194500 -- [-1250.599] (-1246.074) (-1254.290) (-1247.506) * (-1251.124) [-1244.103] (-1257.846) (-1250.183) -- 0:01:51
195000 -- (-1246.509) (-1252.284) [-1246.064] (-1247.022) * (-1251.198) (-1251.900) (-1247.292) [-1245.093] -- 0:01:51
Average standard deviation of split frequencies: 0.002405
195500 -- (-1246.752) (-1249.407) [-1244.586] (-1247.922) * (-1257.012) (-1253.049) (-1247.688) [-1241.824] -- 0:01:51
196000 -- (-1253.322) (-1248.080) (-1249.234) [-1248.691] * (-1252.765) [-1246.883] (-1250.912) (-1249.160) -- 0:01:50
196500 -- (-1243.897) [-1245.505] (-1253.927) (-1247.730) * (-1263.403) (-1250.701) (-1246.913) [-1244.585] -- 0:01:50
197000 -- (-1242.980) (-1247.068) (-1249.234) [-1241.757] * (-1256.557) (-1246.210) [-1249.358] (-1246.631) -- 0:01:50
197500 -- (-1253.798) [-1240.769] (-1252.548) (-1250.425) * (-1254.050) (-1246.492) [-1249.347] (-1249.458) -- 0:01:49
198000 -- (-1249.942) [-1246.492] (-1246.165) (-1244.277) * (-1253.970) (-1241.586) (-1250.246) [-1248.354] -- 0:01:49
198500 -- [-1248.035] (-1247.329) (-1253.956) (-1246.170) * (-1252.567) [-1248.678] (-1246.218) (-1248.724) -- 0:01:49
199000 -- (-1252.815) (-1247.999) (-1246.778) [-1243.828] * (-1257.213) [-1248.023] (-1250.384) (-1249.229) -- 0:01:48
199500 -- (-1253.228) [-1243.955] (-1255.292) (-1247.234) * (-1253.970) (-1245.425) [-1246.702] (-1253.810) -- 0:01:48
200000 -- (-1253.668) [-1249.139] (-1245.920) (-1242.786) * [-1251.945] (-1258.665) (-1248.348) (-1248.541) -- 0:01:51
Average standard deviation of split frequencies: 0.001175
200500 -- [-1249.410] (-1253.231) (-1246.304) (-1246.410) * (-1258.449) (-1248.233) (-1245.399) [-1248.454] -- 0:01:51
201000 -- (-1250.276) (-1254.286) [-1252.784] (-1246.027) * [-1250.536] (-1256.485) (-1251.650) (-1252.930) -- 0:01:51
201500 -- (-1251.828) [-1249.345] (-1244.829) (-1247.246) * (-1249.119) (-1251.331) (-1262.022) [-1247.153] -- 0:01:50
202000 -- (-1254.144) (-1244.007) [-1245.545] (-1249.766) * (-1251.673) (-1251.407) (-1246.099) [-1241.916] -- 0:01:50
202500 -- (-1256.356) (-1251.876) (-1249.380) [-1242.805] * (-1245.382) (-1250.037) (-1246.729) [-1243.412] -- 0:01:50
203000 -- (-1249.725) [-1246.711] (-1249.703) (-1248.653) * (-1250.388) (-1249.030) (-1249.422) [-1242.973] -- 0:01:49
203500 -- (-1248.335) [-1245.675] (-1247.946) (-1249.435) * (-1249.304) (-1243.346) [-1243.481] (-1247.792) -- 0:01:49
204000 -- (-1251.809) (-1251.063) [-1241.621] (-1253.175) * (-1245.573) (-1246.376) (-1249.654) [-1245.509] -- 0:01:49
204500 -- [-1251.184] (-1248.453) (-1245.687) (-1249.054) * [-1246.938] (-1252.073) (-1247.061) (-1249.332) -- 0:01:48
205000 -- [-1248.503] (-1247.283) (-1253.845) (-1250.351) * (-1253.671) (-1247.998) (-1249.926) [-1251.659] -- 0:01:48
Average standard deviation of split frequencies: 0.002288
205500 -- (-1243.957) [-1245.701] (-1244.327) (-1248.826) * [-1246.652] (-1242.367) (-1242.997) (-1247.603) -- 0:01:48
206000 -- (-1246.287) (-1244.394) (-1246.384) [-1250.225] * (-1249.492) (-1249.086) [-1245.211] (-1252.825) -- 0:01:47
206500 -- (-1245.046) [-1248.864] (-1246.434) (-1243.834) * (-1249.200) (-1243.558) (-1246.900) [-1243.665] -- 0:01:47
207000 -- (-1243.538) [-1244.391] (-1244.668) (-1254.222) * [-1253.731] (-1250.818) (-1251.886) (-1255.519) -- 0:01:51
207500 -- (-1242.963) (-1245.260) [-1242.773] (-1248.941) * [-1247.451] (-1252.405) (-1249.807) (-1249.075) -- 0:01:50
208000 -- (-1245.180) [-1246.942] (-1242.462) (-1255.449) * (-1248.667) [-1243.260] (-1245.989) (-1255.596) -- 0:01:50
208500 -- [-1251.260] (-1248.379) (-1244.022) (-1249.769) * [-1251.042] (-1256.106) (-1248.116) (-1246.195) -- 0:01:50
209000 -- [-1248.821] (-1245.648) (-1245.141) (-1249.596) * (-1247.393) [-1249.342] (-1247.983) (-1251.127) -- 0:01:49
209500 -- (-1253.522) (-1248.217) (-1245.595) [-1247.627] * (-1253.249) [-1251.934] (-1240.881) (-1245.004) -- 0:01:49
210000 -- (-1250.115) (-1249.716) (-1246.096) [-1244.408] * (-1251.809) (-1249.130) [-1241.756] (-1243.005) -- 0:01:49
Average standard deviation of split frequencies: 0.001119
210500 -- (-1246.673) (-1253.453) [-1241.341] (-1252.788) * [-1251.631] (-1247.910) (-1248.698) (-1249.188) -- 0:01:48
211000 -- (-1252.315) (-1250.815) (-1249.463) [-1243.317] * (-1250.054) (-1247.398) (-1246.429) [-1251.844] -- 0:01:48
211500 -- (-1252.743) (-1249.816) [-1243.876] (-1247.163) * (-1246.375) (-1247.719) (-1246.491) [-1246.239] -- 0:01:48
212000 -- [-1249.922] (-1247.026) (-1244.909) (-1246.994) * (-1251.330) [-1247.907] (-1244.256) (-1251.164) -- 0:01:47
212500 -- [-1245.125] (-1251.015) (-1245.990) (-1244.734) * [-1246.883] (-1246.776) (-1252.574) (-1250.979) -- 0:01:47
213000 -- (-1248.702) (-1244.480) (-1250.062) [-1243.669] * (-1245.653) [-1246.278] (-1244.000) (-1250.435) -- 0:01:47
213500 -- (-1245.363) [-1243.221] (-1248.444) (-1250.914) * (-1247.933) (-1253.089) (-1247.458) [-1247.548] -- 0:01:46
214000 -- [-1246.149] (-1248.738) (-1247.786) (-1253.955) * (-1252.480) (-1247.068) (-1251.205) [-1246.045] -- 0:01:46
214500 -- (-1247.219) (-1249.900) [-1242.094] (-1248.441) * [-1252.378] (-1247.979) (-1252.649) (-1246.208) -- 0:01:49
215000 -- (-1249.456) (-1242.700) (-1248.320) [-1246.104] * (-1249.697) (-1248.639) [-1252.799] (-1244.618) -- 0:01:49
Average standard deviation of split frequencies: 0.001091
215500 -- (-1252.131) [-1247.880] (-1243.831) (-1248.414) * [-1244.701] (-1247.205) (-1253.954) (-1254.780) -- 0:01:49
216000 -- (-1247.266) (-1245.043) [-1251.732] (-1249.940) * (-1249.273) (-1251.316) (-1257.692) [-1248.589] -- 0:01:48
216500 -- [-1243.986] (-1249.849) (-1251.508) (-1249.829) * (-1257.449) [-1244.446] (-1258.887) (-1251.154) -- 0:01:48
217000 -- (-1246.988) [-1250.076] (-1248.078) (-1244.438) * (-1247.846) (-1242.798) [-1251.114] (-1243.436) -- 0:01:48
217500 -- (-1251.933) (-1246.910) [-1245.940] (-1244.950) * (-1247.526) (-1244.081) (-1249.843) [-1246.635] -- 0:01:47
218000 -- [-1249.210] (-1248.580) (-1245.256) (-1244.666) * (-1243.468) (-1246.672) (-1251.402) [-1249.455] -- 0:01:47
218500 -- [-1243.362] (-1255.586) (-1246.028) (-1249.448) * (-1253.349) (-1250.328) (-1247.566) [-1246.122] -- 0:01:47
219000 -- (-1245.568) (-1255.900) (-1247.842) [-1244.789] * (-1255.658) [-1247.672] (-1253.072) (-1254.480) -- 0:01:46
219500 -- (-1258.351) (-1255.625) [-1254.151] (-1248.313) * (-1252.552) [-1248.168] (-1248.040) (-1248.231) -- 0:01:46
220000 -- (-1247.645) (-1247.907) (-1247.391) [-1248.394] * (-1246.605) [-1243.111] (-1247.660) (-1247.759) -- 0:01:46
Average standard deviation of split frequencies: 0.001068
220500 -- [-1246.603] (-1253.841) (-1249.366) (-1243.960) * (-1246.066) [-1245.608] (-1247.856) (-1254.231) -- 0:01:46
221000 -- (-1259.220) [-1247.971] (-1250.724) (-1246.845) * (-1245.546) [-1246.680] (-1248.736) (-1252.925) -- 0:01:45
221500 -- (-1248.097) [-1246.272] (-1256.672) (-1249.612) * [-1249.581] (-1248.260) (-1245.102) (-1251.165) -- 0:01:45
222000 -- (-1244.812) (-1243.587) (-1251.709) [-1244.738] * (-1250.421) (-1247.011) (-1251.192) [-1247.728] -- 0:01:48
222500 -- (-1242.671) [-1250.690] (-1249.537) (-1260.736) * (-1252.343) (-1245.251) [-1248.477] (-1245.532) -- 0:01:48
223000 -- [-1248.429] (-1250.432) (-1247.688) (-1249.312) * [-1247.914] (-1242.251) (-1247.759) (-1252.961) -- 0:01:48
223500 -- (-1247.939) (-1252.500) (-1248.557) [-1245.224] * [-1250.303] (-1247.540) (-1246.687) (-1247.131) -- 0:01:47
224000 -- (-1245.485) [-1247.638] (-1246.264) (-1242.869) * [-1252.586] (-1250.173) (-1249.296) (-1251.244) -- 0:01:47
224500 -- (-1248.596) (-1250.616) [-1240.359] (-1248.156) * (-1245.168) (-1246.216) [-1248.780] (-1251.176) -- 0:01:47
225000 -- (-1250.889) (-1242.444) (-1242.435) [-1241.760] * (-1244.775) (-1249.320) (-1246.811) [-1248.254] -- 0:01:46
Average standard deviation of split frequencies: 0.001043
225500 -- (-1246.010) (-1256.441) [-1242.368] (-1245.208) * (-1249.792) (-1247.530) [-1251.689] (-1251.339) -- 0:01:46
226000 -- (-1248.712) (-1247.554) (-1245.574) [-1248.634] * (-1243.920) (-1249.143) (-1260.839) [-1248.335] -- 0:01:46
226500 -- (-1245.412) [-1245.285] (-1244.768) (-1243.436) * (-1249.250) [-1252.735] (-1253.567) (-1250.927) -- 0:01:45
227000 -- (-1252.270) (-1244.659) [-1244.972] (-1250.781) * (-1244.180) (-1245.912) (-1247.844) [-1251.848] -- 0:01:45
227500 -- (-1252.032) (-1243.707) (-1243.783) [-1251.198] * [-1245.743] (-1246.641) (-1251.427) (-1246.023) -- 0:01:45
228000 -- (-1253.376) (-1248.261) [-1249.110] (-1249.867) * (-1242.877) [-1248.529] (-1250.870) (-1245.299) -- 0:01:44
228500 -- (-1259.223) [-1257.405] (-1245.573) (-1251.396) * [-1249.664] (-1244.417) (-1251.703) (-1243.094) -- 0:01:44
229000 -- (-1249.691) (-1261.783) [-1245.411] (-1249.695) * [-1252.549] (-1242.919) (-1247.178) (-1251.021) -- 0:01:44
229500 -- (-1247.401) (-1254.843) [-1253.427] (-1249.467) * (-1251.275) (-1243.406) (-1251.572) [-1241.888] -- 0:01:47
230000 -- (-1248.324) [-1253.998] (-1253.340) (-1249.151) * (-1243.770) (-1248.017) [-1245.958] (-1248.228) -- 0:01:47
Average standard deviation of split frequencies: 0.000000
230500 -- [-1248.185] (-1247.840) (-1247.957) (-1255.464) * [-1244.480] (-1256.335) (-1248.362) (-1254.249) -- 0:01:46
231000 -- (-1249.786) [-1248.183] (-1241.841) (-1253.416) * [-1243.201] (-1241.888) (-1254.784) (-1251.581) -- 0:01:46
231500 -- (-1249.577) (-1247.828) (-1243.817) [-1247.738] * [-1244.947] (-1250.519) (-1245.729) (-1245.800) -- 0:01:46
232000 -- (-1251.439) (-1251.086) (-1242.670) [-1252.323] * (-1245.968) (-1249.549) [-1245.296] (-1244.936) -- 0:01:45
232500 -- [-1258.377] (-1249.411) (-1244.118) (-1247.142) * [-1247.462] (-1247.073) (-1241.243) (-1249.715) -- 0:01:45
233000 -- (-1249.251) (-1256.500) (-1247.436) [-1245.273] * [-1243.400] (-1249.713) (-1248.311) (-1241.607) -- 0:01:45
233500 -- (-1259.941) (-1252.392) (-1250.112) [-1244.348] * (-1250.622) (-1243.044) (-1256.607) [-1242.545] -- 0:01:45
234000 -- (-1245.972) [-1244.535] (-1247.031) (-1247.559) * (-1248.541) (-1250.241) (-1247.325) [-1243.116] -- 0:01:44
234500 -- (-1253.647) [-1248.062] (-1246.090) (-1249.229) * (-1243.335) (-1242.121) (-1254.881) [-1246.982] -- 0:01:44
235000 -- (-1248.868) (-1251.561) (-1246.080) [-1248.949] * [-1245.787] (-1245.905) (-1244.184) (-1247.907) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
235500 -- [-1246.960] (-1248.007) (-1245.034) (-1254.345) * (-1244.748) (-1252.487) (-1241.449) [-1248.276] -- 0:01:43
236000 -- (-1253.442) [-1249.473] (-1247.868) (-1246.559) * (-1245.061) [-1251.259] (-1251.245) (-1251.731) -- 0:01:43
236500 -- (-1254.692) (-1247.401) (-1246.105) [-1244.751] * (-1242.392) [-1251.289] (-1246.200) (-1260.381) -- 0:01:46
237000 -- [-1249.684] (-1257.007) (-1246.664) (-1245.877) * [-1244.095] (-1254.368) (-1253.729) (-1253.647) -- 0:01:46
237500 -- (-1256.221) (-1249.993) [-1244.467] (-1244.511) * [-1256.034] (-1245.445) (-1243.655) (-1257.203) -- 0:01:45
238000 -- (-1252.688) [-1251.081] (-1249.188) (-1243.894) * (-1248.493) [-1240.913] (-1251.207) (-1256.374) -- 0:01:45
238500 -- [-1244.488] (-1249.651) (-1246.935) (-1241.307) * (-1245.070) (-1248.939) (-1245.523) [-1249.144] -- 0:01:45
239000 -- (-1247.269) [-1243.743] (-1252.659) (-1248.124) * [-1246.539] (-1249.090) (-1245.815) (-1253.715) -- 0:01:45
239500 -- [-1246.580] (-1250.512) (-1246.094) (-1244.539) * (-1248.518) [-1246.474] (-1251.031) (-1249.378) -- 0:01:44
240000 -- (-1245.653) [-1242.298] (-1249.934) (-1249.247) * [-1245.258] (-1246.265) (-1246.205) (-1246.707) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
240500 -- [-1241.996] (-1245.439) (-1253.768) (-1248.413) * [-1240.943] (-1250.899) (-1255.936) (-1248.759) -- 0:01:44
241000 -- (-1246.965) [-1248.875] (-1247.263) (-1264.525) * [-1246.494] (-1249.084) (-1250.680) (-1253.074) -- 0:01:43
241500 -- [-1249.390] (-1245.776) (-1243.920) (-1257.867) * (-1250.689) [-1247.882] (-1246.411) (-1250.578) -- 0:01:43
242000 -- (-1243.668) [-1244.525] (-1250.025) (-1246.163) * (-1248.461) (-1250.888) (-1245.574) [-1246.972] -- 0:01:43
242500 -- (-1251.511) [-1249.342] (-1250.813) (-1248.151) * (-1246.660) [-1245.564] (-1249.344) (-1247.011) -- 0:01:43
243000 -- (-1253.056) (-1243.760) (-1255.049) [-1247.451] * (-1251.646) (-1254.417) [-1240.894] (-1246.352) -- 0:01:42
243500 -- (-1251.176) (-1249.873) [-1249.657] (-1254.102) * (-1248.259) (-1251.194) (-1248.627) [-1250.793] -- 0:01:42
244000 -- (-1260.065) (-1254.684) [-1244.955] (-1245.791) * [-1248.899] (-1253.835) (-1250.760) (-1242.054) -- 0:01:45
244500 -- (-1257.540) (-1249.370) (-1244.991) [-1255.131] * (-1248.656) (-1255.610) (-1255.764) [-1244.380] -- 0:01:45
245000 -- (-1255.611) [-1246.610] (-1253.442) (-1247.941) * (-1248.462) (-1254.184) [-1248.805] (-1246.678) -- 0:01:44
Average standard deviation of split frequencies: 0.000000
245500 -- [-1253.028] (-1243.427) (-1243.935) (-1247.736) * (-1250.928) (-1255.643) [-1250.348] (-1244.773) -- 0:01:44
246000 -- (-1249.474) (-1245.327) (-1248.510) [-1251.562] * [-1245.209] (-1247.919) (-1240.114) (-1249.792) -- 0:01:44
246500 -- (-1252.420) (-1251.298) [-1252.267] (-1254.196) * [-1244.334] (-1249.782) (-1245.893) (-1243.759) -- 0:01:43
247000 -- (-1255.861) (-1254.727) (-1249.331) [-1252.650] * (-1249.548) (-1247.818) (-1246.713) [-1245.102] -- 0:01:43
247500 -- (-1248.764) [-1245.544] (-1246.192) (-1246.603) * [-1244.339] (-1249.016) (-1247.803) (-1247.807) -- 0:01:43
248000 -- (-1253.854) (-1249.560) [-1246.763] (-1241.824) * (-1251.563) (-1246.345) (-1251.001) [-1244.001] -- 0:01:43
248500 -- (-1249.380) (-1247.549) (-1245.717) [-1247.815] * (-1248.030) (-1257.923) [-1242.483] (-1251.880) -- 0:01:42
249000 -- (-1251.811) [-1248.546] (-1250.222) (-1248.402) * (-1245.255) (-1248.824) [-1249.081] (-1251.445) -- 0:01:42
249500 -- (-1253.018) (-1248.413) [-1241.059] (-1244.440) * [-1244.596] (-1254.756) (-1247.847) (-1247.232) -- 0:01:42
250000 -- (-1247.160) [-1246.293] (-1244.537) (-1247.622) * (-1250.989) [-1250.887] (-1250.007) (-1244.061) -- 0:01:42
Average standard deviation of split frequencies: 0.000940
250500 -- [-1256.564] (-1248.812) (-1243.427) (-1254.351) * (-1247.770) [-1250.050] (-1252.931) (-1258.271) -- 0:01:41
251000 -- (-1249.156) (-1247.425) [-1242.200] (-1251.667) * [-1243.638] (-1247.791) (-1251.590) (-1246.312) -- 0:01:44
251500 -- (-1249.650) (-1249.920) [-1247.246] (-1249.690) * (-1252.152) (-1251.653) [-1243.275] (-1253.821) -- 0:01:44
252000 -- (-1249.731) (-1245.173) [-1247.748] (-1245.427) * (-1249.715) (-1259.155) (-1244.640) [-1249.050] -- 0:01:43
252500 -- (-1244.888) (-1243.031) (-1249.046) [-1247.091] * [-1246.208] (-1252.010) (-1244.720) (-1245.282) -- 0:01:43
253000 -- (-1248.657) (-1245.737) (-1251.232) [-1243.477] * [-1247.083] (-1246.704) (-1252.004) (-1247.479) -- 0:01:43
253500 -- [-1248.901] (-1251.799) (-1251.837) (-1245.645) * (-1244.165) (-1252.340) [-1245.597] (-1248.094) -- 0:01:43
254000 -- (-1250.376) (-1250.879) [-1249.335] (-1253.092) * [-1245.251] (-1247.828) (-1252.354) (-1247.671) -- 0:01:42
254500 -- (-1252.584) (-1245.978) (-1251.628) [-1246.325] * [-1248.146] (-1245.836) (-1250.103) (-1251.753) -- 0:01:42
255000 -- (-1252.176) (-1250.661) [-1254.942] (-1247.435) * (-1245.720) (-1256.440) (-1247.688) [-1247.609] -- 0:01:42
Average standard deviation of split frequencies: 0.000921
255500 -- [-1248.806] (-1247.505) (-1248.790) (-1244.140) * (-1250.995) [-1248.234] (-1247.614) (-1247.522) -- 0:01:41
256000 -- (-1245.348) (-1247.242) (-1252.523) [-1249.827] * (-1246.915) [-1255.674] (-1248.334) (-1250.333) -- 0:01:41
256500 -- (-1254.152) (-1256.231) (-1244.234) [-1246.198] * (-1253.584) (-1244.009) [-1243.714] (-1247.056) -- 0:01:41
257000 -- (-1251.951) (-1252.092) (-1246.890) [-1243.075] * (-1247.820) (-1242.045) (-1245.080) [-1251.610] -- 0:01:41
257500 -- (-1253.714) [-1251.356] (-1248.722) (-1241.659) * (-1253.963) [-1243.745] (-1244.861) (-1253.161) -- 0:01:40
258000 -- (-1246.226) (-1246.975) (-1244.063) [-1246.355] * (-1254.776) (-1246.852) [-1249.019] (-1249.438) -- 0:01:40
258500 -- (-1254.658) (-1246.126) (-1252.378) [-1245.404] * (-1245.575) (-1243.119) [-1243.836] (-1249.175) -- 0:01:43
259000 -- [-1244.679] (-1253.053) (-1247.905) (-1245.734) * (-1246.132) [-1243.332] (-1247.067) (-1253.247) -- 0:01:42
259500 -- (-1252.244) (-1248.302) (-1243.478) [-1251.660] * [-1247.414] (-1249.107) (-1244.948) (-1254.314) -- 0:01:42
260000 -- (-1251.451) (-1250.872) (-1252.144) [-1252.386] * (-1245.521) [-1247.088] (-1252.210) (-1253.932) -- 0:01:42
Average standard deviation of split frequencies: 0.000904
260500 -- [-1249.331] (-1250.074) (-1252.264) (-1246.264) * [-1247.934] (-1246.315) (-1247.746) (-1253.500) -- 0:01:42
261000 -- (-1250.787) (-1244.769) [-1247.050] (-1242.383) * (-1243.369) [-1247.658] (-1248.928) (-1254.999) -- 0:01:41
261500 -- (-1250.277) (-1246.100) [-1253.299] (-1245.848) * (-1250.227) [-1253.548] (-1252.990) (-1251.790) -- 0:01:41
262000 -- [-1251.562] (-1251.625) (-1249.988) (-1246.971) * (-1245.811) (-1247.692) (-1250.520) [-1249.231] -- 0:01:41
262500 -- (-1258.868) [-1245.263] (-1253.520) (-1246.015) * (-1251.925) (-1246.110) [-1252.469] (-1253.422) -- 0:01:41
263000 -- [-1245.975] (-1249.661) (-1249.975) (-1247.092) * (-1247.719) (-1244.296) (-1246.005) [-1250.231] -- 0:01:40
263500 -- [-1248.963] (-1248.937) (-1249.607) (-1251.745) * (-1245.550) [-1243.578] (-1255.354) (-1258.794) -- 0:01:40
264000 -- (-1250.502) (-1246.925) [-1248.665] (-1243.340) * (-1249.425) [-1242.870] (-1248.864) (-1250.293) -- 0:01:40
264500 -- (-1254.860) (-1252.036) (-1248.941) [-1244.321] * (-1251.713) (-1243.012) (-1243.655) [-1245.810] -- 0:01:40
265000 -- [-1254.467] (-1253.232) (-1256.131) (-1250.867) * [-1247.606] (-1247.764) (-1247.254) (-1251.601) -- 0:01:39
Average standard deviation of split frequencies: 0.000000
265500 -- (-1249.514) (-1256.615) [-1247.928] (-1251.043) * (-1248.345) (-1247.145) [-1247.395] (-1247.899) -- 0:01:39
266000 -- [-1253.168] (-1255.474) (-1247.984) (-1250.103) * [-1251.725] (-1244.338) (-1247.615) (-1244.314) -- 0:01:42
266500 -- (-1249.428) (-1251.980) (-1248.227) [-1252.091] * [-1245.151] (-1242.424) (-1247.374) (-1246.008) -- 0:01:41
267000 -- [-1252.303] (-1250.031) (-1253.381) (-1248.531) * (-1253.764) [-1241.996] (-1249.390) (-1244.671) -- 0:01:41
267500 -- [-1246.969] (-1250.883) (-1246.033) (-1256.907) * [-1247.621] (-1245.895) (-1251.573) (-1248.596) -- 0:01:41
268000 -- [-1249.790] (-1258.318) (-1248.682) (-1246.534) * [-1248.569] (-1248.151) (-1245.430) (-1251.277) -- 0:01:41
268500 -- (-1250.932) (-1247.291) [-1249.132] (-1251.149) * (-1247.184) [-1249.400] (-1245.575) (-1253.333) -- 0:01:40
269000 -- (-1252.453) (-1254.013) (-1252.413) [-1247.948] * (-1247.332) [-1246.066] (-1246.901) (-1258.042) -- 0:01:40
269500 -- (-1249.225) [-1249.130] (-1257.581) (-1251.138) * [-1250.157] (-1242.825) (-1248.821) (-1255.384) -- 0:01:40
270000 -- (-1248.567) (-1250.579) (-1250.188) [-1245.764] * (-1254.808) (-1247.190) (-1250.217) [-1249.472] -- 0:01:40
Average standard deviation of split frequencies: 0.000871
270500 -- (-1252.864) (-1246.026) [-1253.366] (-1246.641) * (-1247.088) [-1245.140] (-1248.235) (-1247.605) -- 0:01:39
271000 -- (-1249.410) [-1249.051] (-1255.440) (-1248.106) * (-1250.004) (-1251.741) (-1255.522) [-1245.255] -- 0:01:39
271500 -- (-1248.638) [-1246.479] (-1248.108) (-1252.270) * (-1250.655) (-1248.553) (-1254.266) [-1250.729] -- 0:01:41
272000 -- (-1245.869) (-1248.940) (-1247.066) [-1250.305] * [-1242.893] (-1252.182) (-1246.751) (-1247.032) -- 0:01:41
272500 -- (-1247.563) [-1250.347] (-1247.637) (-1253.919) * (-1244.942) (-1244.629) (-1247.180) [-1244.645] -- 0:01:41
273000 -- [-1244.556] (-1248.065) (-1245.117) (-1244.373) * (-1255.129) [-1251.071] (-1251.916) (-1250.212) -- 0:01:41
273500 -- (-1250.015) (-1248.576) (-1245.883) [-1245.883] * (-1249.813) [-1250.080] (-1255.477) (-1246.521) -- 0:01:40
274000 -- (-1244.993) (-1252.331) [-1244.616] (-1245.425) * (-1254.876) (-1253.583) [-1249.742] (-1247.386) -- 0:01:40
274500 -- (-1249.583) [-1244.486] (-1243.749) (-1246.699) * (-1246.630) [-1258.076] (-1244.964) (-1255.050) -- 0:01:40
275000 -- (-1246.539) (-1244.503) [-1249.123] (-1247.364) * (-1251.675) (-1255.718) (-1247.156) [-1247.370] -- 0:01:40
Average standard deviation of split frequencies: 0.000854
275500 -- (-1252.317) (-1244.545) [-1245.413] (-1250.890) * [-1243.814] (-1251.925) (-1250.000) (-1249.623) -- 0:01:39
276000 -- (-1244.947) [-1246.743] (-1248.090) (-1248.778) * (-1247.336) (-1251.494) [-1247.902] (-1250.262) -- 0:01:39
276500 -- (-1249.351) (-1244.890) (-1253.583) [-1251.897] * [-1255.195] (-1252.934) (-1246.467) (-1252.295) -- 0:01:42
277000 -- [-1241.687] (-1244.875) (-1248.313) (-1249.941) * [-1257.828] (-1244.495) (-1251.800) (-1254.233) -- 0:01:41
277500 -- [-1246.941] (-1245.160) (-1244.736) (-1253.424) * (-1250.867) (-1245.609) (-1248.370) [-1247.466] -- 0:01:41
278000 -- (-1247.628) (-1245.766) (-1248.193) [-1244.901] * (-1250.874) (-1245.013) (-1248.317) [-1244.341] -- 0:01:41
278500 -- (-1252.498) (-1244.955) [-1246.422] (-1250.241) * [-1252.051] (-1246.904) (-1247.727) (-1246.926) -- 0:01:41
279000 -- (-1246.506) (-1247.734) [-1243.021] (-1250.147) * [-1246.566] (-1248.617) (-1245.006) (-1251.390) -- 0:01:40
279500 -- [-1245.288] (-1245.482) (-1246.695) (-1250.610) * (-1248.895) [-1245.529] (-1251.175) (-1251.269) -- 0:01:40
280000 -- [-1246.812] (-1245.082) (-1251.260) (-1245.272) * (-1247.688) (-1248.916) [-1245.180] (-1251.645) -- 0:01:40
Average standard deviation of split frequencies: 0.000840
280500 -- (-1244.498) (-1248.236) [-1246.089] (-1244.080) * (-1248.242) [-1248.537] (-1248.330) (-1261.521) -- 0:01:40
281000 -- (-1246.768) [-1252.177] (-1246.762) (-1249.991) * (-1250.927) [-1250.765] (-1245.320) (-1249.325) -- 0:01:39
281500 -- (-1241.304) (-1254.618) [-1243.936] (-1257.452) * (-1247.171) (-1247.808) [-1242.652] (-1253.979) -- 0:01:39
282000 -- (-1240.916) (-1250.628) (-1245.734) [-1247.741] * (-1249.555) (-1256.919) [-1251.148] (-1245.813) -- 0:01:39
282500 -- (-1245.267) [-1243.200] (-1245.946) (-1245.808) * (-1249.378) (-1244.862) (-1244.587) [-1246.404] -- 0:01:41
283000 -- (-1249.144) [-1250.036] (-1243.035) (-1255.782) * (-1243.959) (-1244.244) (-1248.544) [-1245.233] -- 0:01:41
283500 -- (-1245.335) (-1251.819) (-1256.996) [-1248.118] * (-1247.208) (-1248.565) (-1251.225) [-1247.414] -- 0:01:41
284000 -- (-1253.205) (-1249.864) (-1250.779) [-1248.671] * (-1250.324) (-1255.258) (-1246.399) [-1251.581] -- 0:01:40
284500 -- (-1244.239) [-1244.422] (-1243.766) (-1251.834) * (-1246.170) (-1258.107) [-1242.992] (-1244.925) -- 0:01:40
285000 -- (-1246.957) (-1245.972) [-1246.508] (-1249.039) * (-1243.219) (-1246.877) [-1250.297] (-1246.240) -- 0:01:40
Average standard deviation of split frequencies: 0.000824
285500 -- (-1247.927) [-1248.957] (-1252.535) (-1242.417) * (-1252.029) (-1248.848) [-1252.436] (-1243.997) -- 0:01:40
286000 -- (-1247.534) [-1244.011] (-1250.665) (-1253.244) * (-1250.350) [-1243.548] (-1247.918) (-1246.722) -- 0:01:39
286500 -- (-1245.916) [-1245.950] (-1250.159) (-1244.428) * (-1249.053) [-1248.784] (-1248.778) (-1246.086) -- 0:01:39
287000 -- (-1245.731) (-1245.492) [-1245.727] (-1245.178) * (-1248.536) (-1245.704) (-1250.482) [-1245.477] -- 0:01:39
287500 -- (-1244.427) (-1243.874) (-1245.695) [-1244.128] * (-1249.385) (-1252.036) (-1249.392) [-1243.112] -- 0:01:39
288000 -- [-1244.084] (-1246.195) (-1249.808) (-1246.108) * (-1246.246) (-1256.068) (-1243.971) [-1246.094] -- 0:01:38
288500 -- (-1241.888) (-1256.024) [-1243.714] (-1243.596) * [-1245.501] (-1258.555) (-1251.598) (-1248.481) -- 0:01:38
289000 -- (-1248.638) (-1251.358) (-1251.556) [-1243.558] * [-1249.457] (-1253.566) (-1255.004) (-1242.352) -- 0:01:38
289500 -- (-1253.716) (-1249.242) [-1249.072] (-1250.166) * (-1243.355) (-1247.854) (-1244.444) [-1249.767] -- 0:01:38
290000 -- (-1246.721) [-1248.242] (-1249.654) (-1248.157) * [-1242.679] (-1247.048) (-1248.082) (-1254.775) -- 0:01:40
Average standard deviation of split frequencies: 0.000811
290500 -- (-1252.409) [-1244.406] (-1250.187) (-1247.726) * (-1242.818) (-1249.305) (-1245.780) [-1246.374] -- 0:01:40
291000 -- (-1249.072) [-1243.996] (-1254.676) (-1248.339) * (-1245.207) (-1248.346) [-1246.908] (-1252.874) -- 0:01:39
291500 -- (-1252.068) [-1244.947] (-1246.812) (-1246.657) * (-1256.444) (-1247.299) [-1245.202] (-1245.264) -- 0:01:39
292000 -- (-1250.538) (-1244.217) (-1252.703) [-1248.355] * (-1249.315) (-1250.883) (-1247.927) [-1246.351] -- 0:01:39
292500 -- (-1247.660) (-1247.503) (-1248.513) [-1245.036] * (-1243.588) (-1245.230) (-1245.585) [-1245.302] -- 0:01:39
293000 -- (-1247.086) (-1248.361) (-1244.816) [-1242.564] * (-1250.539) [-1253.064] (-1245.301) (-1247.886) -- 0:01:38
293500 -- (-1250.775) (-1252.282) (-1243.896) [-1245.468] * (-1247.168) (-1250.474) [-1254.823] (-1246.668) -- 0:01:38
294000 -- (-1251.352) [-1247.878] (-1246.486) (-1246.267) * (-1243.518) (-1251.123) (-1259.794) [-1247.654] -- 0:01:38
294500 -- (-1244.225) [-1243.005] (-1247.747) (-1250.729) * (-1245.126) (-1244.665) (-1248.572) [-1253.838] -- 0:01:38
295000 -- [-1250.779] (-1250.671) (-1249.213) (-1249.757) * (-1243.819) [-1246.086] (-1246.546) (-1251.824) -- 0:01:37
Average standard deviation of split frequencies: 0.000796
295500 -- (-1249.217) (-1246.129) [-1250.024] (-1251.219) * [-1248.134] (-1247.163) (-1248.085) (-1249.044) -- 0:01:37
296000 -- (-1250.717) [-1244.282] (-1252.867) (-1256.965) * (-1250.952) (-1240.996) (-1249.191) [-1247.784] -- 0:01:37
296500 -- (-1244.931) [-1242.970] (-1248.192) (-1246.127) * (-1250.421) (-1244.378) [-1250.733] (-1247.904) -- 0:01:37
297000 -- (-1254.905) (-1243.029) (-1252.783) [-1245.820] * (-1242.074) [-1253.116] (-1247.651) (-1243.376) -- 0:01:37
297500 -- (-1248.542) (-1246.508) [-1253.388] (-1250.952) * [-1243.731] (-1252.806) (-1248.403) (-1246.700) -- 0:01:39
298000 -- [-1246.810] (-1247.365) (-1243.265) (-1249.764) * (-1248.763) (-1256.174) (-1252.221) [-1252.193] -- 0:01:38
298500 -- [-1248.790] (-1245.253) (-1249.253) (-1249.553) * (-1247.200) (-1257.170) [-1252.097] (-1248.156) -- 0:01:38
299000 -- (-1247.238) [-1244.969] (-1247.068) (-1247.460) * (-1249.101) (-1247.306) (-1251.227) [-1246.914] -- 0:01:38
299500 -- (-1249.144) (-1246.574) (-1247.046) [-1248.902] * (-1246.280) (-1248.097) (-1248.484) [-1252.147] -- 0:01:38
300000 -- (-1246.834) (-1247.082) (-1244.073) [-1252.404] * (-1250.583) (-1250.174) (-1242.432) [-1246.102] -- 0:01:37
Average standard deviation of split frequencies: 0.000784
300500 -- (-1247.915) [-1246.921] (-1245.537) (-1247.360) * (-1250.692) [-1244.927] (-1245.792) (-1245.604) -- 0:01:37
301000 -- (-1253.518) (-1248.264) [-1247.133] (-1246.003) * (-1253.685) [-1245.290] (-1248.956) (-1249.402) -- 0:01:37
301500 -- (-1246.818) (-1248.293) (-1244.584) [-1246.785] * (-1249.946) [-1246.214] (-1245.637) (-1251.943) -- 0:01:37
302000 -- [-1250.726] (-1255.671) (-1254.319) (-1248.238) * (-1251.422) (-1249.797) [-1246.317] (-1253.348) -- 0:01:37
302500 -- [-1245.377] (-1253.852) (-1250.512) (-1256.783) * (-1250.146) (-1245.818) [-1249.734] (-1249.489) -- 0:01:36
303000 -- (-1245.561) (-1255.147) (-1247.596) [-1251.968] * (-1253.469) [-1246.039] (-1248.457) (-1248.877) -- 0:01:36
303500 -- (-1251.171) (-1248.303) [-1247.238] (-1248.187) * (-1249.923) (-1249.181) (-1245.348) [-1248.432] -- 0:01:36
304000 -- (-1246.129) (-1250.666) [-1252.336] (-1247.627) * (-1251.900) (-1243.800) (-1246.660) [-1246.128] -- 0:01:36
304500 -- (-1249.810) (-1247.091) (-1246.702) [-1247.425] * (-1243.760) (-1245.836) (-1247.396) [-1243.214] -- 0:01:35
305000 -- (-1251.966) (-1248.321) [-1246.249] (-1254.863) * (-1250.575) [-1248.930] (-1251.770) (-1257.270) -- 0:01:37
Average standard deviation of split frequencies: 0.000770
305500 -- [-1242.927] (-1244.990) (-1250.959) (-1251.052) * (-1248.959) [-1245.246] (-1254.848) (-1253.143) -- 0:01:37
306000 -- (-1247.538) (-1252.451) (-1264.017) [-1248.299] * (-1251.063) (-1246.720) (-1253.728) [-1247.734] -- 0:01:37
306500 -- [-1245.948] (-1249.342) (-1249.098) (-1250.292) * (-1244.075) (-1248.154) (-1249.684) [-1241.338] -- 0:01:37
307000 -- (-1251.816) (-1248.338) [-1245.014] (-1248.027) * (-1245.203) [-1244.192] (-1246.045) (-1250.029) -- 0:01:37
307500 -- (-1249.212) (-1249.973) (-1254.468) [-1245.535] * (-1250.468) [-1249.486] (-1244.260) (-1248.010) -- 0:01:36
308000 -- [-1245.800] (-1244.695) (-1249.796) (-1250.045) * (-1247.899) (-1247.531) (-1247.155) [-1251.001] -- 0:01:36
308500 -- (-1249.311) (-1247.631) [-1251.445] (-1249.678) * (-1245.992) (-1245.045) [-1246.562] (-1249.482) -- 0:01:36
309000 -- [-1247.081] (-1248.590) (-1249.194) (-1255.159) * (-1249.769) (-1246.675) [-1246.711] (-1252.082) -- 0:01:36
309500 -- (-1246.673) (-1244.485) [-1259.311] (-1255.157) * (-1254.002) (-1250.886) [-1247.835] (-1246.869) -- 0:01:35
310000 -- (-1248.671) (-1245.536) (-1250.804) [-1244.751] * (-1254.104) [-1253.267] (-1242.025) (-1247.679) -- 0:01:35
Average standard deviation of split frequencies: 0.002276
310500 -- (-1246.958) (-1245.788) (-1258.425) [-1244.265] * [-1249.520] (-1251.169) (-1248.525) (-1245.722) -- 0:01:35
311000 -- (-1248.176) [-1246.743] (-1250.031) (-1249.699) * (-1252.862) [-1249.936] (-1246.274) (-1243.936) -- 0:01:35
311500 -- (-1247.812) (-1250.198) [-1250.577] (-1253.206) * (-1257.085) (-1250.900) [-1243.659] (-1243.135) -- 0:01:35
312000 -- (-1244.146) (-1248.956) [-1251.718] (-1244.788) * (-1251.429) [-1250.484] (-1244.567) (-1248.861) -- 0:01:37
312500 -- [-1244.686] (-1250.424) (-1248.185) (-1242.290) * (-1256.017) (-1248.428) (-1243.672) [-1250.546] -- 0:01:36
313000 -- (-1249.224) (-1248.779) [-1247.913] (-1250.131) * (-1246.008) (-1244.466) [-1248.478] (-1249.743) -- 0:01:36
313500 -- [-1246.057] (-1246.589) (-1254.030) (-1245.046) * [-1246.153] (-1246.404) (-1245.857) (-1244.133) -- 0:01:36
314000 -- (-1244.142) (-1248.873) [-1251.913] (-1255.150) * (-1244.603) [-1247.480] (-1243.992) (-1244.155) -- 0:01:36
314500 -- (-1254.037) (-1245.342) (-1251.769) [-1253.923] * (-1248.986) (-1254.606) [-1245.901] (-1252.342) -- 0:01:35
315000 -- (-1250.046) (-1246.413) (-1256.189) [-1244.815] * (-1252.137) (-1244.591) (-1248.162) [-1250.605] -- 0:01:35
Average standard deviation of split frequencies: 0.002238
315500 -- (-1250.381) (-1249.596) (-1249.620) [-1247.270] * (-1247.562) [-1244.846] (-1244.504) (-1254.703) -- 0:01:35
316000 -- (-1245.737) (-1249.279) (-1247.058) [-1244.932] * [-1245.468] (-1246.668) (-1248.149) (-1257.361) -- 0:01:35
316500 -- (-1244.783) (-1253.025) [-1248.954] (-1243.332) * [-1246.088] (-1253.167) (-1251.047) (-1247.405) -- 0:01:35
317000 -- (-1248.662) [-1245.521] (-1245.802) (-1253.188) * (-1252.619) (-1249.576) [-1247.121] (-1250.952) -- 0:01:34
317500 -- (-1252.878) [-1242.916] (-1248.508) (-1249.940) * (-1250.545) (-1247.590) (-1250.563) [-1247.537] -- 0:01:34
318000 -- (-1247.676) (-1243.251) [-1247.667] (-1250.764) * (-1247.865) [-1249.596] (-1243.829) (-1249.071) -- 0:01:34
318500 -- (-1248.941) [-1253.526] (-1243.137) (-1250.230) * (-1251.561) (-1248.358) (-1253.299) [-1246.075] -- 0:01:34
319000 -- (-1246.526) (-1253.121) [-1246.729] (-1248.019) * (-1258.139) (-1246.643) [-1244.137] (-1249.533) -- 0:01:33
319500 -- [-1244.776] (-1247.538) (-1250.735) (-1245.892) * (-1244.749) [-1246.633] (-1247.066) (-1239.886) -- 0:01:35
320000 -- (-1244.950) [-1243.967] (-1244.183) (-1245.295) * (-1249.457) (-1258.228) (-1254.496) [-1248.827] -- 0:01:35
Average standard deviation of split frequencies: 0.002205
320500 -- (-1256.856) (-1248.046) [-1242.590] (-1252.469) * (-1250.805) [-1248.356] (-1247.222) (-1243.194) -- 0:01:35
321000 -- (-1246.147) (-1249.651) [-1248.275] (-1248.016) * (-1263.034) [-1247.118] (-1249.250) (-1241.701) -- 0:01:35
321500 -- (-1253.277) [-1246.917] (-1252.080) (-1246.816) * (-1246.099) (-1248.130) [-1253.403] (-1247.196) -- 0:01:34
322000 -- (-1250.658) (-1246.066) [-1252.084] (-1246.567) * (-1249.150) [-1243.845] (-1247.578) (-1251.393) -- 0:01:34
322500 -- [-1243.961] (-1242.728) (-1255.349) (-1244.880) * (-1245.024) [-1248.022] (-1248.061) (-1245.236) -- 0:01:34
323000 -- (-1250.035) (-1251.693) [-1245.699] (-1250.079) * [-1245.248] (-1244.954) (-1244.552) (-1245.419) -- 0:01:34
323500 -- (-1251.019) (-1242.116) [-1246.568] (-1243.018) * (-1245.974) (-1245.911) (-1250.781) [-1243.157] -- 0:01:34
324000 -- (-1245.690) [-1255.066] (-1246.394) (-1247.591) * [-1244.693] (-1246.213) (-1255.737) (-1244.087) -- 0:01:33
324500 -- (-1248.894) [-1249.024] (-1247.534) (-1247.385) * [-1247.730] (-1245.538) (-1250.116) (-1248.861) -- 0:01:33
325000 -- (-1249.262) [-1245.600] (-1243.056) (-1252.305) * [-1247.734] (-1249.080) (-1252.690) (-1248.816) -- 0:01:33
Average standard deviation of split frequencies: 0.002169
325500 -- (-1251.820) [-1249.705] (-1252.642) (-1247.589) * (-1246.254) (-1249.509) [-1249.073] (-1248.335) -- 0:01:33
326000 -- (-1249.110) [-1250.643] (-1245.394) (-1258.080) * (-1252.420) (-1250.563) (-1254.710) [-1246.711] -- 0:01:33
326500 -- [-1249.516] (-1248.963) (-1250.742) (-1251.597) * (-1244.069) [-1248.317] (-1251.957) (-1246.638) -- 0:01:32
327000 -- (-1249.367) (-1246.995) [-1251.730] (-1245.085) * (-1255.136) (-1247.993) [-1248.111] (-1246.871) -- 0:01:34
327500 -- [-1247.443] (-1251.338) (-1256.419) (-1253.550) * [-1243.562] (-1251.279) (-1253.796) (-1249.700) -- 0:01:34
328000 -- (-1247.297) [-1251.287] (-1247.657) (-1251.319) * (-1243.198) [-1246.053] (-1252.935) (-1254.917) -- 0:01:34
328500 -- [-1252.926] (-1248.982) (-1243.204) (-1244.219) * [-1244.533] (-1246.085) (-1249.973) (-1250.845) -- 0:01:34
329000 -- (-1254.116) (-1248.953) (-1246.266) [-1245.495] * (-1246.932) [-1249.029] (-1249.384) (-1250.707) -- 0:01:33
329500 -- (-1251.852) [-1249.890] (-1249.689) (-1248.013) * (-1246.561) [-1248.873] (-1251.889) (-1249.566) -- 0:01:33
330000 -- [-1245.860] (-1242.351) (-1255.075) (-1243.786) * [-1247.990] (-1252.981) (-1253.811) (-1249.512) -- 0:01:33
Average standard deviation of split frequencies: 0.002138
330500 -- (-1247.860) (-1242.187) (-1251.449) [-1247.215] * (-1248.297) [-1246.480] (-1250.834) (-1248.479) -- 0:01:33
331000 -- (-1245.499) (-1243.325) (-1248.417) [-1242.728] * (-1247.413) [-1242.457] (-1249.854) (-1249.789) -- 0:01:32
331500 -- (-1246.755) (-1247.182) (-1244.356) [-1244.090] * (-1247.068) [-1243.469] (-1244.439) (-1248.164) -- 0:01:32
332000 -- (-1247.963) (-1248.881) (-1250.704) [-1247.704] * [-1251.619] (-1248.144) (-1250.704) (-1250.986) -- 0:01:32
332500 -- (-1248.945) [-1244.985] (-1249.393) (-1245.354) * (-1251.121) (-1245.186) [-1252.572] (-1249.718) -- 0:01:32
333000 -- (-1246.132) (-1255.335) [-1244.423] (-1248.739) * [-1247.472] (-1250.543) (-1246.052) (-1253.032) -- 0:01:32
333500 -- (-1244.468) (-1259.582) [-1243.518] (-1246.531) * [-1248.239] (-1244.886) (-1250.045) (-1252.009) -- 0:01:31
334000 -- (-1245.763) (-1251.779) [-1246.008] (-1245.723) * (-1245.484) [-1247.006] (-1246.578) (-1253.139) -- 0:01:31
334500 -- (-1253.389) (-1258.817) (-1249.303) [-1249.200] * (-1245.993) (-1250.597) [-1245.096] (-1250.422) -- 0:01:33
335000 -- (-1251.968) [-1251.805] (-1248.755) (-1254.141) * (-1246.007) [-1252.437] (-1251.650) (-1249.177) -- 0:01:33
Average standard deviation of split frequencies: 0.002104
335500 -- (-1250.004) (-1252.869) [-1249.931] (-1253.844) * (-1245.296) (-1254.856) [-1246.255] (-1246.004) -- 0:01:33
336000 -- (-1248.936) (-1251.143) [-1254.906] (-1249.232) * (-1248.503) (-1254.059) (-1245.380) [-1245.784] -- 0:01:32
336500 -- (-1253.208) [-1250.226] (-1245.040) (-1246.319) * (-1254.349) (-1245.056) [-1247.752] (-1244.546) -- 0:01:32
337000 -- (-1251.611) (-1254.611) (-1243.625) [-1249.029] * (-1243.555) (-1251.900) [-1246.302] (-1250.233) -- 0:01:32
337500 -- (-1245.969) (-1257.448) [-1244.433] (-1244.712) * (-1243.998) (-1251.308) (-1249.197) [-1245.241] -- 0:01:32
338000 -- (-1246.551) (-1245.530) (-1252.248) [-1241.196] * [-1245.162] (-1250.237) (-1245.369) (-1245.983) -- 0:01:32
338500 -- [-1246.881] (-1242.939) (-1244.402) (-1243.178) * (-1247.625) (-1251.028) (-1245.309) [-1246.605] -- 0:01:31
339000 -- (-1247.833) (-1247.985) (-1245.781) [-1246.632] * (-1250.617) (-1247.657) [-1244.414] (-1253.904) -- 0:01:31
339500 -- [-1247.678] (-1252.489) (-1247.107) (-1244.171) * (-1250.870) (-1244.594) [-1251.768] (-1257.404) -- 0:01:31
340000 -- (-1249.939) [-1243.984] (-1253.837) (-1245.760) * [-1243.489] (-1250.353) (-1245.611) (-1253.615) -- 0:01:31
Average standard deviation of split frequencies: 0.002076
340500 -- (-1255.115) (-1251.302) (-1243.329) [-1242.930] * (-1254.197) (-1244.597) (-1256.587) [-1248.279] -- 0:01:31
341000 -- (-1250.549) [-1248.383] (-1249.457) (-1245.556) * (-1245.361) (-1249.167) [-1247.432] (-1245.303) -- 0:01:30
341500 -- (-1257.416) (-1250.083) (-1256.776) [-1246.317] * (-1245.928) [-1248.151] (-1247.918) (-1245.635) -- 0:01:30
342000 -- (-1252.785) (-1251.185) (-1251.569) [-1252.406] * [-1254.903] (-1247.293) (-1248.559) (-1249.916) -- 0:01:32
342500 -- (-1251.483) (-1248.986) (-1248.195) [-1247.225] * (-1247.270) [-1245.118] (-1244.308) (-1248.562) -- 0:01:32
343000 -- (-1245.311) (-1253.302) (-1255.953) [-1241.146] * (-1255.596) (-1245.490) [-1243.114] (-1244.031) -- 0:01:31
343500 -- (-1250.179) (-1248.985) (-1255.873) [-1243.766] * (-1242.550) [-1251.797] (-1241.928) (-1244.691) -- 0:01:31
344000 -- [-1250.121] (-1247.567) (-1254.149) (-1248.114) * (-1246.184) (-1247.850) (-1250.627) [-1250.881] -- 0:01:31
344500 -- (-1251.158) (-1247.161) (-1252.937) [-1245.535] * (-1250.684) [-1250.402] (-1257.909) (-1245.637) -- 0:01:31
345000 -- (-1249.588) [-1247.566] (-1255.376) (-1248.843) * (-1246.411) (-1257.401) (-1249.958) [-1247.658] -- 0:01:31
Average standard deviation of split frequencies: 0.002725
345500 -- (-1243.883) (-1253.880) [-1251.005] (-1246.036) * (-1248.411) (-1255.371) [-1245.452] (-1246.258) -- 0:01:30
346000 -- (-1241.643) [-1248.584] (-1258.360) (-1242.700) * (-1244.740) (-1245.620) (-1252.065) [-1247.770] -- 0:01:30
346500 -- [-1244.142] (-1249.666) (-1248.373) (-1248.720) * (-1249.978) [-1249.532] (-1250.833) (-1241.600) -- 0:01:30
347000 -- (-1246.499) [-1248.670] (-1250.726) (-1252.988) * [-1247.482] (-1251.710) (-1247.806) (-1242.597) -- 0:01:30
347500 -- (-1253.602) (-1247.833) (-1248.118) [-1248.368] * [-1249.422] (-1248.940) (-1248.622) (-1246.665) -- 0:01:30
348000 -- (-1258.388) (-1255.922) (-1248.453) [-1245.337] * (-1247.405) [-1247.784] (-1248.412) (-1247.489) -- 0:01:29
348500 -- (-1254.444) (-1254.022) [-1244.889] (-1248.821) * (-1258.478) (-1248.725) (-1241.680) [-1241.512] -- 0:01:29
349000 -- (-1251.499) (-1246.116) (-1242.613) [-1247.203] * (-1253.154) (-1247.843) [-1249.604] (-1247.296) -- 0:01:29
349500 -- (-1252.563) (-1247.235) [-1245.200] (-1242.722) * (-1244.638) (-1248.796) (-1255.064) [-1242.322] -- 0:01:31
350000 -- (-1249.067) (-1242.148) (-1254.479) [-1244.281] * [-1248.362] (-1245.603) (-1251.039) (-1242.670) -- 0:01:30
Average standard deviation of split frequencies: 0.002689
350500 -- (-1253.763) [-1244.963] (-1245.279) (-1245.532) * (-1251.354) (-1248.884) [-1245.445] (-1248.536) -- 0:01:30
351000 -- (-1246.415) [-1244.923] (-1248.282) (-1246.792) * (-1253.658) [-1254.410] (-1245.470) (-1244.800) -- 0:01:30
351500 -- (-1250.812) (-1248.124) (-1252.495) [-1246.806] * (-1250.912) (-1243.678) [-1245.647] (-1247.405) -- 0:01:30
352000 -- (-1248.818) (-1252.795) [-1249.846] (-1247.439) * (-1249.034) (-1247.998) [-1240.456] (-1246.464) -- 0:01:30
352500 -- (-1243.905) (-1251.637) [-1253.583] (-1244.305) * (-1246.122) [-1244.019] (-1243.619) (-1247.599) -- 0:01:30
353000 -- [-1241.152] (-1248.519) (-1245.872) (-1257.259) * (-1251.313) [-1247.772] (-1249.510) (-1250.077) -- 0:01:29
353500 -- (-1244.501) (-1254.920) [-1249.069] (-1249.637) * [-1249.993] (-1250.666) (-1246.027) (-1251.160) -- 0:01:29
354000 -- (-1246.052) [-1248.933] (-1247.819) (-1244.828) * (-1245.222) [-1251.740] (-1244.040) (-1252.564) -- 0:01:29
354500 -- (-1254.242) (-1253.818) (-1247.596) [-1249.330] * [-1246.666] (-1246.877) (-1243.808) (-1257.973) -- 0:01:29
355000 -- (-1245.029) (-1253.507) [-1245.541] (-1247.059) * (-1253.347) [-1245.199] (-1249.730) (-1252.611) -- 0:01:29
Average standard deviation of split frequencies: 0.003310
355500 -- (-1244.587) [-1255.565] (-1250.433) (-1246.093) * [-1243.495] (-1250.122) (-1254.192) (-1247.132) -- 0:01:28
356000 -- [-1242.980] (-1247.506) (-1242.807) (-1245.152) * (-1246.042) (-1248.447) [-1249.967] (-1252.323) -- 0:01:28
356500 -- [-1248.289] (-1244.086) (-1247.784) (-1251.033) * (-1244.662) (-1248.084) (-1249.068) [-1249.690] -- 0:01:28
357000 -- (-1247.625) [-1251.692] (-1249.670) (-1245.088) * (-1251.036) (-1247.629) [-1247.195] (-1245.712) -- 0:01:30
357500 -- (-1250.454) (-1244.044) [-1245.046] (-1249.764) * (-1251.551) (-1247.772) [-1244.200] (-1254.125) -- 0:01:29
358000 -- (-1244.144) [-1245.607] (-1248.046) (-1252.751) * (-1246.744) (-1247.068) [-1244.042] (-1243.690) -- 0:01:29
358500 -- [-1245.187] (-1248.315) (-1254.390) (-1250.610) * (-1253.463) [-1245.905] (-1247.124) (-1243.531) -- 0:01:29
359000 -- (-1249.547) (-1242.839) [-1245.302] (-1253.010) * (-1251.196) (-1253.626) [-1249.608] (-1245.103) -- 0:01:29
359500 -- (-1251.068) (-1250.994) (-1248.912) [-1246.224] * (-1251.881) (-1244.632) [-1244.666] (-1249.873) -- 0:01:29
360000 -- (-1247.693) (-1251.364) [-1247.007] (-1249.072) * (-1250.570) (-1248.703) (-1247.304) [-1248.935] -- 0:01:28
Average standard deviation of split frequencies: 0.003268
360500 -- [-1252.518] (-1246.222) (-1241.875) (-1244.535) * (-1245.113) [-1251.888] (-1247.829) (-1247.115) -- 0:01:28
361000 -- [-1252.758] (-1245.186) (-1251.829) (-1240.691) * (-1252.656) (-1240.478) [-1248.838] (-1248.588) -- 0:01:28
361500 -- (-1256.774) (-1242.514) (-1248.076) [-1247.700] * (-1246.340) [-1241.592] (-1255.356) (-1247.863) -- 0:01:28
362000 -- (-1249.001) (-1252.107) (-1247.849) [-1245.043] * (-1248.928) [-1248.759] (-1246.876) (-1250.955) -- 0:01:28
362500 -- (-1249.632) [-1247.913] (-1256.400) (-1249.751) * [-1245.727] (-1248.248) (-1245.527) (-1255.744) -- 0:01:27
363000 -- (-1257.470) [-1248.620] (-1248.805) (-1243.581) * (-1250.870) (-1245.195) (-1250.526) [-1250.948] -- 0:01:27
363500 -- (-1246.005) [-1249.571] (-1250.303) (-1253.616) * (-1250.274) (-1255.637) [-1240.304] (-1252.394) -- 0:01:27
364000 -- (-1249.339) (-1247.295) (-1249.064) [-1248.887] * (-1255.870) (-1249.067) (-1247.596) [-1247.118] -- 0:01:29
364500 -- (-1246.717) (-1245.069) (-1251.949) [-1244.612] * (-1246.617) (-1249.810) (-1242.400) [-1241.741] -- 0:01:28
365000 -- [-1244.825] (-1252.048) (-1243.661) (-1246.040) * (-1247.245) (-1243.989) (-1249.241) [-1244.866] -- 0:01:28
Average standard deviation of split frequencies: 0.002576
365500 -- (-1248.662) (-1242.747) (-1241.372) [-1253.203] * (-1249.923) (-1245.335) (-1246.652) [-1246.410] -- 0:01:28
366000 -- (-1249.676) (-1242.101) (-1256.186) [-1245.195] * [-1244.535] (-1247.511) (-1254.569) (-1256.800) -- 0:01:28
366500 -- (-1247.426) (-1244.202) (-1245.562) [-1244.630] * (-1251.606) (-1245.355) [-1245.418] (-1251.562) -- 0:01:28
367000 -- (-1251.784) (-1244.143) [-1250.744] (-1247.630) * [-1246.091] (-1251.850) (-1244.299) (-1249.558) -- 0:01:27
367500 -- [-1247.002] (-1244.479) (-1246.781) (-1249.407) * (-1252.234) [-1246.001] (-1247.651) (-1246.726) -- 0:01:27
368000 -- (-1242.713) (-1245.048) [-1247.805] (-1245.253) * (-1253.395) (-1248.915) [-1249.910] (-1252.727) -- 0:01:27
368500 -- (-1246.282) (-1258.514) [-1249.845] (-1249.297) * (-1249.712) [-1246.740] (-1247.111) (-1250.015) -- 0:01:27
369000 -- (-1256.908) [-1244.706] (-1254.276) (-1250.703) * [-1249.386] (-1249.054) (-1250.912) (-1249.366) -- 0:01:27
369500 -- [-1248.408] (-1251.562) (-1253.051) (-1253.700) * (-1251.933) (-1249.419) [-1244.025] (-1252.456) -- 0:01:27
370000 -- [-1244.380] (-1254.399) (-1245.552) (-1250.967) * (-1247.623) (-1246.458) [-1247.532] (-1253.598) -- 0:01:26
Average standard deviation of split frequencies: 0.002544
370500 -- (-1245.540) (-1257.397) [-1248.649] (-1245.048) * (-1243.359) [-1248.750] (-1251.275) (-1251.067) -- 0:01:26
371000 -- (-1247.392) [-1249.668] (-1247.997) (-1245.353) * (-1253.139) (-1253.349) [-1245.443] (-1253.373) -- 0:01:26
371500 -- [-1250.141] (-1247.184) (-1244.782) (-1251.113) * (-1252.771) (-1251.067) (-1246.359) [-1252.071] -- 0:01:27
372000 -- (-1250.654) [-1249.583] (-1247.004) (-1247.161) * (-1255.338) (-1252.551) (-1240.849) [-1244.137] -- 0:01:27
372500 -- (-1251.779) (-1249.655) [-1245.880] (-1247.255) * (-1243.860) (-1252.978) (-1245.428) [-1241.032] -- 0:01:27
373000 -- (-1252.217) (-1246.400) [-1254.067] (-1248.273) * (-1246.061) (-1252.178) (-1254.755) [-1247.759] -- 0:01:27
373500 -- (-1253.838) (-1256.157) [-1257.427] (-1253.808) * (-1247.303) (-1249.025) (-1244.139) [-1243.821] -- 0:01:27
374000 -- (-1254.332) (-1244.104) [-1246.638] (-1249.878) * (-1246.572) (-1249.455) (-1246.993) [-1247.283] -- 0:01:27
374500 -- (-1251.581) (-1254.542) [-1251.912] (-1252.809) * (-1245.512) (-1250.699) [-1249.038] (-1244.967) -- 0:01:26
375000 -- (-1259.531) (-1242.113) (-1247.581) [-1251.303] * (-1250.043) (-1246.429) (-1255.378) [-1241.898] -- 0:01:26
Average standard deviation of split frequencies: 0.002507
375500 -- (-1255.449) [-1246.981] (-1247.966) (-1248.094) * (-1245.615) (-1247.934) (-1255.455) [-1249.318] -- 0:01:26
376000 -- (-1255.817) (-1244.914) (-1251.301) [-1246.776] * [-1247.367] (-1247.155) (-1257.761) (-1249.614) -- 0:01:26
376500 -- (-1243.124) [-1245.939] (-1247.466) (-1249.339) * (-1250.151) [-1241.415] (-1251.520) (-1250.862) -- 0:01:26
377000 -- (-1246.901) (-1247.699) (-1247.654) [-1249.465] * [-1249.119] (-1249.241) (-1250.443) (-1246.935) -- 0:01:25
377500 -- (-1247.258) (-1245.398) [-1249.505] (-1251.331) * (-1254.943) [-1246.737] (-1255.591) (-1246.490) -- 0:01:25
378000 -- (-1251.910) (-1246.299) [-1247.302] (-1248.146) * [-1245.676] (-1249.970) (-1255.042) (-1250.192) -- 0:01:25
378500 -- (-1252.770) (-1253.545) (-1247.040) [-1247.394] * (-1244.110) (-1260.351) (-1250.246) [-1246.071] -- 0:01:25
379000 -- (-1249.213) (-1253.348) (-1243.645) [-1244.693] * (-1243.917) (-1250.315) [-1247.459] (-1250.177) -- 0:01:26
379500 -- [-1251.611] (-1250.719) (-1248.411) (-1247.227) * (-1250.171) (-1245.223) [-1250.478] (-1246.128) -- 0:01:26
380000 -- (-1246.729) (-1253.664) [-1247.715] (-1247.734) * [-1250.551] (-1245.489) (-1254.220) (-1242.773) -- 0:01:26
Average standard deviation of split frequencies: 0.002477
380500 -- [-1253.010] (-1256.843) (-1251.044) (-1252.600) * (-1246.206) (-1247.864) [-1246.681] (-1245.030) -- 0:01:26
381000 -- (-1253.922) (-1247.236) (-1252.845) [-1244.281] * (-1251.694) [-1243.107] (-1252.331) (-1247.034) -- 0:01:26
381500 -- (-1252.735) (-1253.606) (-1249.557) [-1246.544] * (-1244.981) [-1249.775] (-1247.646) (-1243.079) -- 0:01:25
382000 -- (-1253.902) (-1250.909) (-1249.097) [-1246.652] * (-1246.833) (-1244.577) [-1246.761] (-1244.566) -- 0:01:25
382500 -- (-1250.870) (-1247.434) [-1245.765] (-1252.677) * (-1248.595) (-1246.221) [-1244.425] (-1247.289) -- 0:01:25
383000 -- [-1250.254] (-1245.007) (-1249.100) (-1248.103) * (-1242.662) [-1244.374] (-1249.683) (-1249.445) -- 0:01:25
383500 -- (-1248.318) (-1246.550) [-1246.403] (-1245.524) * [-1249.595] (-1246.060) (-1244.308) (-1246.389) -- 0:01:25
384000 -- (-1252.457) [-1244.137] (-1246.344) (-1245.707) * [-1242.155] (-1247.164) (-1246.612) (-1251.319) -- 0:01:25
384500 -- (-1252.934) [-1247.252] (-1244.497) (-1249.326) * (-1262.283) [-1243.790] (-1249.121) (-1243.245) -- 0:01:24
385000 -- (-1256.373) [-1243.886] (-1246.756) (-1246.181) * (-1253.806) (-1245.931) [-1247.488] (-1246.846) -- 0:01:24
Average standard deviation of split frequencies: 0.002443
385500 -- (-1254.086) [-1246.735] (-1242.007) (-1248.650) * (-1249.076) (-1242.262) (-1247.819) [-1249.219] -- 0:01:24
386000 -- (-1253.432) (-1246.855) (-1249.222) [-1248.522] * (-1248.201) [-1240.286] (-1245.026) (-1247.139) -- 0:01:24
386500 -- (-1251.266) (-1246.598) (-1246.344) [-1248.895] * (-1249.993) [-1245.810] (-1245.658) (-1246.131) -- 0:01:25
387000 -- [-1249.455] (-1252.468) (-1250.327) (-1250.227) * (-1250.769) (-1242.036) [-1243.297] (-1247.001) -- 0:01:25
387500 -- (-1253.729) (-1246.160) [-1250.662] (-1247.577) * (-1256.238) (-1252.235) (-1246.955) [-1244.955] -- 0:01:25
388000 -- [-1252.874] (-1246.085) (-1250.558) (-1246.694) * (-1252.505) (-1249.843) [-1247.291] (-1245.228) -- 0:01:25
388500 -- (-1247.213) [-1247.697] (-1247.879) (-1250.730) * (-1251.265) (-1254.896) (-1244.349) [-1246.978] -- 0:01:24
389000 -- (-1251.329) (-1252.607) [-1246.072] (-1246.143) * [-1251.517] (-1253.299) (-1245.124) (-1247.979) -- 0:01:24
389500 -- (-1247.426) (-1243.199) [-1245.505] (-1253.523) * (-1254.406) (-1255.084) (-1244.351) [-1249.611] -- 0:01:24
390000 -- (-1247.147) (-1249.328) (-1249.972) [-1249.282] * (-1247.131) (-1253.333) (-1252.065) [-1245.516] -- 0:01:24
Average standard deviation of split frequencies: 0.001810
390500 -- (-1249.066) (-1245.888) [-1247.416] (-1248.035) * (-1252.554) (-1252.536) [-1249.782] (-1251.919) -- 0:01:24
391000 -- [-1242.147] (-1249.051) (-1248.928) (-1250.469) * (-1252.344) [-1251.372] (-1245.646) (-1251.287) -- 0:01:24
391500 -- (-1243.470) [-1247.930] (-1248.682) (-1248.385) * (-1252.077) [-1247.371] (-1247.025) (-1245.437) -- 0:01:23
392000 -- [-1247.271] (-1245.936) (-1251.576) (-1249.079) * [-1242.930] (-1246.456) (-1246.661) (-1254.663) -- 0:01:23
392500 -- (-1249.304) [-1245.656] (-1249.734) (-1246.244) * [-1244.222] (-1244.462) (-1247.395) (-1245.732) -- 0:01:23
393000 -- (-1247.809) [-1245.846] (-1248.747) (-1253.669) * [-1246.441] (-1245.661) (-1244.075) (-1247.497) -- 0:01:23
393500 -- [-1244.445] (-1247.466) (-1249.984) (-1243.969) * [-1249.671] (-1248.253) (-1242.674) (-1247.321) -- 0:01:23
394000 -- (-1246.339) (-1252.900) [-1247.527] (-1250.364) * (-1248.341) [-1246.535] (-1246.792) (-1246.154) -- 0:01:24
394500 -- (-1253.980) [-1243.800] (-1245.735) (-1249.103) * [-1243.900] (-1248.169) (-1250.779) (-1246.850) -- 0:01:24
395000 -- (-1249.565) [-1245.249] (-1248.472) (-1245.774) * (-1246.638) [-1252.520] (-1249.625) (-1249.437) -- 0:01:24
Average standard deviation of split frequencies: 0.001786
395500 -- (-1250.309) (-1247.988) [-1246.237] (-1246.511) * (-1241.433) [-1246.648] (-1245.976) (-1247.016) -- 0:01:24
396000 -- (-1253.174) (-1244.149) (-1248.836) [-1244.861] * [-1251.191] (-1253.189) (-1247.577) (-1243.608) -- 0:01:23
396500 -- [-1251.799] (-1244.267) (-1246.745) (-1248.015) * [-1243.871] (-1250.679) (-1246.462) (-1244.878) -- 0:01:23
397000 -- [-1246.925] (-1242.304) (-1253.432) (-1248.012) * (-1245.721) (-1242.665) (-1245.703) [-1243.548] -- 0:01:23
397500 -- (-1255.912) (-1245.637) [-1248.039] (-1248.832) * [-1244.778] (-1242.639) (-1252.917) (-1252.553) -- 0:01:23
398000 -- (-1248.891) [-1244.454] (-1250.763) (-1249.671) * (-1244.000) [-1245.070] (-1257.854) (-1251.072) -- 0:01:23
398500 -- (-1247.117) [-1248.719] (-1251.684) (-1248.974) * (-1245.775) [-1246.218] (-1245.083) (-1248.403) -- 0:01:23
399000 -- (-1249.579) (-1246.873) (-1256.433) [-1247.654] * (-1253.033) (-1247.467) (-1248.437) [-1247.198] -- 0:01:22
399500 -- (-1251.918) (-1252.402) (-1249.223) [-1247.296] * (-1255.059) [-1247.183] (-1249.090) (-1248.083) -- 0:01:22
400000 -- (-1244.874) (-1247.572) [-1251.251] (-1245.117) * (-1248.540) (-1251.270) (-1250.108) [-1249.921] -- 0:01:22
Average standard deviation of split frequencies: 0.001765
400500 -- (-1251.470) [-1242.408] (-1246.365) (-1247.269) * (-1249.290) (-1242.558) [-1247.251] (-1244.608) -- 0:01:22
401000 -- (-1249.246) (-1245.900) [-1246.914] (-1249.323) * (-1246.219) [-1247.148] (-1247.666) (-1244.675) -- 0:01:22
401500 -- (-1251.897) (-1250.387) [-1245.916] (-1247.168) * (-1249.291) (-1249.401) (-1253.713) [-1243.543] -- 0:01:23
402000 -- (-1251.058) (-1253.067) (-1244.236) [-1245.453] * (-1250.062) (-1246.839) [-1247.919] (-1256.017) -- 0:01:23
402500 -- (-1254.627) (-1247.183) [-1249.609] (-1247.379) * (-1257.491) (-1252.082) (-1247.550) [-1245.788] -- 0:01:23
403000 -- [-1258.690] (-1246.788) (-1256.197) (-1251.787) * (-1250.087) (-1255.322) (-1247.562) [-1242.432] -- 0:01:22
403500 -- (-1247.336) (-1247.773) [-1247.303] (-1241.446) * (-1246.180) [-1247.255] (-1245.325) (-1250.784) -- 0:01:22
404000 -- (-1252.954) (-1242.664) [-1254.829] (-1245.224) * [-1247.167] (-1248.589) (-1246.171) (-1245.440) -- 0:01:22
404500 -- [-1248.425] (-1242.068) (-1250.690) (-1245.833) * (-1242.873) (-1252.863) [-1241.689] (-1249.809) -- 0:01:22
405000 -- [-1248.195] (-1248.707) (-1246.615) (-1250.748) * (-1254.922) (-1252.380) (-1246.986) [-1250.311] -- 0:01:22
Average standard deviation of split frequencies: 0.001161
405500 -- (-1250.918) [-1241.593] (-1245.503) (-1244.313) * (-1252.679) [-1250.595] (-1256.766) (-1252.737) -- 0:01:22
406000 -- [-1252.485] (-1248.214) (-1248.841) (-1250.355) * (-1249.984) [-1249.748] (-1249.072) (-1251.899) -- 0:01:21
406500 -- (-1249.567) [-1250.011] (-1250.024) (-1251.417) * (-1250.487) (-1245.275) [-1247.273] (-1250.335) -- 0:01:21
407000 -- (-1252.403) [-1243.432] (-1250.355) (-1251.279) * [-1253.468] (-1250.452) (-1247.332) (-1247.855) -- 0:01:21
407500 -- (-1250.718) [-1244.135] (-1246.855) (-1247.674) * [-1252.060] (-1252.019) (-1248.151) (-1246.077) -- 0:01:21
408000 -- (-1250.597) (-1245.446) (-1252.967) [-1242.101] * [-1251.333] (-1252.328) (-1246.711) (-1252.838) -- 0:01:21
408500 -- [-1251.892] (-1247.638) (-1253.664) (-1243.149) * [-1245.866] (-1257.109) (-1250.556) (-1250.045) -- 0:01:22
409000 -- (-1250.601) (-1244.973) (-1249.880) [-1245.763] * (-1247.361) (-1254.420) (-1248.966) [-1249.117] -- 0:01:22
409500 -- (-1258.578) (-1244.941) (-1247.678) [-1249.494] * [-1248.598] (-1255.029) (-1247.586) (-1247.664) -- 0:01:22
410000 -- (-1249.165) (-1245.046) (-1248.949) [-1249.601] * (-1248.813) (-1255.307) [-1246.869] (-1250.398) -- 0:01:22
Average standard deviation of split frequencies: 0.001148
410500 -- [-1249.413] (-1247.102) (-1248.672) (-1248.129) * (-1249.795) (-1253.834) (-1242.583) [-1254.467] -- 0:01:21
411000 -- [-1247.005] (-1256.607) (-1248.258) (-1252.256) * [-1242.436] (-1259.473) (-1254.671) (-1248.984) -- 0:01:21
411500 -- (-1251.031) (-1248.582) [-1258.242] (-1246.225) * (-1245.511) (-1251.079) [-1243.482] (-1247.655) -- 0:01:21
412000 -- [-1244.055] (-1253.198) (-1250.148) (-1249.763) * (-1253.114) (-1243.944) [-1243.232] (-1245.502) -- 0:01:21
412500 -- (-1249.413) (-1250.553) [-1247.953] (-1251.633) * (-1253.534) (-1248.075) [-1245.691] (-1251.775) -- 0:01:21
413000 -- [-1244.279] (-1246.157) (-1244.996) (-1250.078) * (-1244.103) (-1253.086) (-1246.036) [-1248.641] -- 0:01:21
413500 -- (-1245.492) [-1245.977] (-1250.520) (-1249.718) * (-1242.839) (-1252.106) (-1243.560) [-1245.740] -- 0:01:20
414000 -- (-1245.063) (-1247.700) (-1251.942) [-1247.904] * (-1251.138) (-1247.194) (-1255.731) [-1245.094] -- 0:01:20
414500 -- [-1248.774] (-1247.730) (-1245.288) (-1249.026) * (-1250.117) (-1249.078) [-1245.607] (-1252.259) -- 0:01:20
415000 -- (-1243.317) (-1250.929) [-1243.612] (-1251.351) * [-1251.312] (-1247.876) (-1246.000) (-1246.646) -- 0:01:20
Average standard deviation of split frequencies: 0.001133
415500 -- (-1250.969) (-1247.416) [-1242.753] (-1248.554) * [-1244.639] (-1246.564) (-1248.077) (-1248.985) -- 0:01:20
416000 -- [-1248.618] (-1252.494) (-1245.313) (-1246.023) * [-1244.184] (-1247.902) (-1250.600) (-1244.604) -- 0:01:21
416500 -- [-1243.085] (-1249.498) (-1248.540) (-1255.412) * (-1243.155) [-1251.159] (-1248.030) (-1251.368) -- 0:01:21
417000 -- (-1253.601) [-1243.180] (-1241.927) (-1249.309) * [-1243.288] (-1248.734) (-1253.284) (-1244.661) -- 0:01:21
417500 -- (-1249.894) (-1245.838) [-1247.253] (-1252.753) * (-1245.599) (-1252.982) [-1244.465] (-1244.249) -- 0:01:20
418000 -- (-1246.099) [-1244.181] (-1250.605) (-1251.947) * (-1251.012) (-1248.534) (-1247.973) [-1246.917] -- 0:01:20
418500 -- (-1244.495) [-1243.117] (-1255.629) (-1250.986) * (-1252.864) (-1248.932) [-1249.837] (-1244.799) -- 0:01:20
419000 -- (-1249.682) (-1246.117) [-1244.717] (-1248.855) * (-1246.807) (-1251.093) [-1242.540] (-1246.958) -- 0:01:20
419500 -- [-1245.902] (-1242.351) (-1250.478) (-1254.870) * (-1250.941) (-1249.786) (-1245.507) [-1243.389] -- 0:01:20
420000 -- [-1248.334] (-1248.217) (-1252.844) (-1265.471) * [-1245.590] (-1248.093) (-1242.117) (-1247.447) -- 0:01:20
Average standard deviation of split frequencies: 0.001121
420500 -- [-1250.087] (-1248.272) (-1251.705) (-1250.734) * [-1247.617] (-1252.759) (-1242.950) (-1249.695) -- 0:01:19
421000 -- (-1249.329) [-1252.474] (-1247.198) (-1247.458) * (-1244.171) (-1247.920) (-1245.680) [-1248.681] -- 0:01:19
421500 -- (-1254.221) [-1247.833] (-1251.711) (-1246.690) * [-1245.909] (-1244.070) (-1246.528) (-1244.456) -- 0:01:19
422000 -- (-1246.485) (-1254.649) [-1244.054] (-1247.236) * (-1245.729) [-1247.989] (-1249.732) (-1247.273) -- 0:01:19
422500 -- [-1245.790] (-1246.099) (-1248.840) (-1250.269) * (-1244.912) [-1242.458] (-1246.734) (-1246.465) -- 0:01:19
423000 -- (-1243.218) (-1251.506) [-1245.448] (-1249.129) * (-1247.420) [-1241.186] (-1249.563) (-1243.278) -- 0:01:19
423500 -- (-1252.621) [-1246.769] (-1244.166) (-1246.281) * (-1247.143) [-1246.406] (-1253.781) (-1253.620) -- 0:01:18
424000 -- (-1243.514) (-1246.644) (-1252.292) [-1249.909] * (-1251.773) (-1249.886) (-1246.057) [-1248.563] -- 0:01:20
424500 -- (-1248.496) [-1244.026] (-1252.669) (-1244.690) * (-1249.455) (-1245.051) (-1248.024) [-1243.530] -- 0:01:19
425000 -- (-1245.350) (-1247.475) (-1248.574) [-1247.269] * (-1248.184) (-1244.947) [-1243.756] (-1250.254) -- 0:01:19
Average standard deviation of split frequencies: 0.000553
425500 -- (-1245.910) (-1243.031) (-1255.112) [-1242.814] * (-1249.904) (-1245.547) [-1243.970] (-1246.330) -- 0:01:19
426000 -- (-1250.809) [-1248.042] (-1248.261) (-1248.033) * (-1248.958) [-1249.068] (-1246.671) (-1249.112) -- 0:01:19
426500 -- (-1248.230) (-1245.978) [-1251.697] (-1244.813) * (-1243.234) (-1250.679) (-1242.836) [-1247.838] -- 0:01:19
427000 -- (-1245.897) (-1248.325) (-1254.231) [-1248.266] * [-1246.931] (-1241.731) (-1245.411) (-1245.312) -- 0:01:19
427500 -- (-1241.136) [-1244.447] (-1249.180) (-1250.304) * [-1248.997] (-1246.366) (-1248.300) (-1248.591) -- 0:01:19
428000 -- (-1241.669) (-1248.023) (-1252.104) [-1251.396] * (-1246.893) [-1247.507] (-1254.478) (-1247.286) -- 0:01:18
428500 -- (-1243.747) (-1245.467) [-1241.806] (-1247.141) * [-1246.808] (-1256.529) (-1253.958) (-1248.890) -- 0:01:18
429000 -- [-1248.693] (-1243.411) (-1245.837) (-1246.564) * (-1252.970) (-1245.303) (-1253.592) [-1252.166] -- 0:01:18
429500 -- (-1245.629) (-1245.863) [-1250.341] (-1254.803) * [-1243.984] (-1245.765) (-1251.701) (-1256.307) -- 0:01:18
430000 -- (-1244.468) (-1242.103) [-1250.425] (-1251.582) * (-1246.890) (-1249.720) [-1250.202] (-1253.688) -- 0:01:18
Average standard deviation of split frequencies: 0.000547
430500 -- (-1245.220) (-1247.355) [-1244.648] (-1248.710) * (-1244.593) [-1250.052] (-1247.671) (-1244.035) -- 0:01:18
431000 -- [-1247.628] (-1254.342) (-1251.303) (-1248.787) * (-1249.636) (-1249.823) (-1244.790) [-1248.324] -- 0:01:17
431500 -- [-1246.660] (-1257.731) (-1243.003) (-1250.160) * (-1244.129) (-1245.660) [-1245.653] (-1255.367) -- 0:01:19
432000 -- [-1248.072] (-1248.402) (-1246.506) (-1248.768) * (-1248.232) (-1241.356) (-1243.916) [-1249.150] -- 0:01:18
432500 -- (-1250.476) (-1247.422) (-1247.463) [-1243.421] * (-1252.071) (-1248.194) (-1243.460) [-1250.272] -- 0:01:18
433000 -- (-1251.359) (-1248.525) (-1245.773) [-1246.369] * (-1255.480) [-1243.575] (-1254.173) (-1243.877) -- 0:01:18
433500 -- (-1254.214) [-1247.465] (-1245.294) (-1244.158) * (-1248.757) [-1243.393] (-1247.710) (-1250.451) -- 0:01:18
434000 -- (-1250.103) (-1248.742) [-1245.256] (-1250.532) * (-1249.872) [-1252.605] (-1246.767) (-1248.998) -- 0:01:18
434500 -- [-1249.132] (-1249.141) (-1245.273) (-1245.681) * (-1250.707) (-1245.438) (-1248.046) [-1249.025] -- 0:01:18
435000 -- (-1247.040) (-1248.413) (-1251.841) [-1244.982] * (-1243.156) [-1243.387] (-1247.380) (-1249.494) -- 0:01:17
Average standard deviation of split frequencies: 0.000541
435500 -- [-1253.796] (-1247.149) (-1256.210) (-1255.319) * (-1253.148) [-1248.239] (-1250.039) (-1252.900) -- 0:01:17
436000 -- [-1245.240] (-1245.766) (-1250.364) (-1250.427) * (-1247.251) [-1247.111] (-1248.504) (-1245.925) -- 0:01:17
436500 -- (-1249.535) (-1248.016) (-1251.114) [-1244.203] * (-1254.849) (-1248.627) (-1248.259) [-1244.577] -- 0:01:17
437000 -- [-1244.265] (-1253.208) (-1249.705) (-1245.106) * (-1247.654) (-1249.409) [-1247.633] (-1247.024) -- 0:01:17
437500 -- (-1249.001) [-1249.569] (-1247.431) (-1247.673) * [-1242.392] (-1251.988) (-1249.441) (-1244.718) -- 0:01:17
438000 -- (-1254.169) [-1240.822] (-1249.956) (-1247.478) * (-1247.599) [-1248.767] (-1251.444) (-1249.624) -- 0:01:16
438500 -- [-1249.265] (-1245.153) (-1245.309) (-1250.048) * [-1245.575] (-1244.419) (-1252.482) (-1246.985) -- 0:01:16
439000 -- (-1249.923) (-1255.201) [-1248.743] (-1251.429) * (-1248.342) (-1250.028) (-1243.800) [-1246.533] -- 0:01:17
439500 -- [-1244.530] (-1247.271) (-1248.277) (-1253.160) * (-1254.068) (-1251.692) [-1246.615] (-1243.795) -- 0:01:17
440000 -- (-1246.242) (-1252.476) [-1245.949] (-1250.604) * (-1247.920) (-1245.382) (-1254.103) [-1250.490] -- 0:01:17
Average standard deviation of split frequencies: 0.000535
440500 -- [-1244.452] (-1245.676) (-1252.319) (-1253.445) * [-1244.979] (-1250.225) (-1247.911) (-1248.622) -- 0:01:17
441000 -- [-1244.229] (-1252.269) (-1245.627) (-1259.668) * [-1248.366] (-1253.664) (-1246.375) (-1246.275) -- 0:01:17
441500 -- (-1243.645) [-1249.446] (-1241.941) (-1248.584) * (-1246.915) (-1247.215) [-1247.058] (-1245.470) -- 0:01:17
442000 -- (-1246.085) (-1246.639) [-1245.618] (-1249.542) * [-1246.858] (-1261.768) (-1248.600) (-1250.280) -- 0:01:17
442500 -- [-1253.867] (-1246.081) (-1252.517) (-1245.039) * (-1251.707) (-1251.192) (-1247.403) [-1246.119] -- 0:01:16
443000 -- [-1244.207] (-1249.400) (-1245.233) (-1249.632) * (-1251.328) (-1242.476) [-1247.966] (-1244.758) -- 0:01:16
443500 -- (-1245.679) (-1253.412) (-1245.430) [-1244.030] * (-1250.636) (-1245.124) (-1248.193) [-1244.418] -- 0:01:16
444000 -- [-1241.937] (-1252.689) (-1245.567) (-1246.959) * (-1252.580) (-1246.125) [-1245.903] (-1243.981) -- 0:01:16
444500 -- (-1247.451) (-1246.444) (-1250.130) [-1248.656] * (-1255.274) [-1243.629] (-1245.882) (-1243.502) -- 0:01:16
445000 -- (-1244.908) [-1243.492] (-1252.208) (-1244.470) * (-1247.183) (-1245.246) [-1246.299] (-1248.352) -- 0:01:16
Average standard deviation of split frequencies: 0.000528
445500 -- (-1243.753) [-1245.833] (-1256.241) (-1245.524) * (-1249.129) (-1247.704) (-1244.521) [-1247.782] -- 0:01:15
446000 -- [-1244.831] (-1249.065) (-1248.075) (-1251.421) * [-1246.985] (-1244.028) (-1243.045) (-1247.885) -- 0:01:17
446500 -- (-1249.482) (-1245.639) (-1258.012) [-1243.660] * [-1240.582] (-1253.990) (-1248.386) (-1248.267) -- 0:01:16
447000 -- (-1251.714) [-1247.434] (-1248.115) (-1247.873) * [-1243.998] (-1248.152) (-1244.661) (-1244.692) -- 0:01:16
447500 -- (-1250.266) (-1252.176) (-1252.007) [-1244.935] * [-1247.995] (-1254.507) (-1246.579) (-1248.546) -- 0:01:16
448000 -- (-1254.438) (-1247.508) [-1249.613] (-1253.439) * (-1243.634) (-1248.148) [-1244.179] (-1246.917) -- 0:01:16
448500 -- (-1252.074) [-1253.246] (-1249.873) (-1243.475) * (-1246.071) [-1248.441] (-1247.165) (-1247.483) -- 0:01:16
449000 -- (-1245.033) (-1250.211) (-1247.811) [-1247.034] * (-1246.180) (-1256.628) [-1247.583] (-1255.073) -- 0:01:16
449500 -- (-1247.800) (-1251.739) [-1252.316] (-1251.524) * (-1245.281) (-1251.184) (-1251.807) [-1253.040] -- 0:01:15
450000 -- (-1255.331) (-1245.821) (-1254.420) [-1249.751] * (-1244.120) (-1250.258) [-1252.032] (-1248.524) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
450500 -- (-1246.895) (-1249.536) (-1246.861) [-1252.865] * [-1243.578] (-1252.432) (-1242.585) (-1246.044) -- 0:01:15
451000 -- (-1252.328) (-1246.327) (-1247.545) [-1248.382] * (-1258.901) (-1250.278) (-1244.548) [-1248.566] -- 0:01:15
451500 -- (-1248.441) [-1254.273] (-1247.170) (-1253.330) * (-1251.034) [-1249.153] (-1253.784) (-1241.524) -- 0:01:15
452000 -- (-1248.437) (-1251.028) (-1256.003) [-1251.459] * [-1249.272] (-1254.214) (-1257.884) (-1246.508) -- 0:01:15
452500 -- [-1249.055] (-1250.600) (-1249.673) (-1246.146) * [-1246.868] (-1249.466) (-1245.571) (-1243.112) -- 0:01:15
453000 -- (-1251.013) (-1247.484) (-1249.321) [-1246.166] * (-1250.273) (-1249.918) (-1245.297) [-1246.055] -- 0:01:14
453500 -- [-1247.973] (-1246.162) (-1252.879) (-1250.193) * [-1244.907] (-1250.705) (-1245.945) (-1254.459) -- 0:01:15
454000 -- [-1250.274] (-1249.989) (-1248.620) (-1243.246) * (-1256.143) (-1249.563) (-1250.383) [-1243.924] -- 0:01:15
454500 -- [-1247.999] (-1245.933) (-1251.106) (-1247.491) * (-1248.189) [-1247.858] (-1255.989) (-1244.905) -- 0:01:15
455000 -- [-1250.907] (-1248.388) (-1258.448) (-1250.189) * (-1252.219) [-1248.292] (-1252.924) (-1245.952) -- 0:01:15
Average standard deviation of split frequencies: 0.000000
455500 -- (-1251.581) (-1250.248) [-1245.095] (-1256.030) * (-1247.867) [-1251.740] (-1243.586) (-1247.597) -- 0:01:15
456000 -- (-1243.905) (-1243.084) [-1244.027] (-1247.149) * (-1256.697) (-1248.592) [-1248.091] (-1246.686) -- 0:01:15
456500 -- (-1246.853) [-1244.348] (-1251.314) (-1253.444) * [-1243.765] (-1247.028) (-1249.351) (-1251.134) -- 0:01:15
457000 -- (-1247.174) (-1248.187) (-1246.636) [-1244.795] * (-1250.019) (-1250.920) (-1250.036) [-1242.612] -- 0:01:14
457500 -- (-1248.858) [-1245.553] (-1243.110) (-1244.868) * (-1248.788) (-1244.952) [-1246.447] (-1249.009) -- 0:01:14
458000 -- (-1250.375) [-1250.473] (-1246.392) (-1251.084) * [-1249.240] (-1253.162) (-1246.513) (-1249.499) -- 0:01:14
458500 -- (-1248.430) (-1247.971) [-1249.087] (-1247.943) * (-1250.267) [-1249.437] (-1251.271) (-1244.565) -- 0:01:14
459000 -- (-1249.988) [-1244.489] (-1246.453) (-1247.359) * (-1252.308) (-1251.630) [-1248.211] (-1247.723) -- 0:01:14
459500 -- [-1243.333] (-1248.953) (-1247.223) (-1244.810) * (-1249.516) (-1253.031) (-1251.491) [-1241.183] -- 0:01:14
460000 -- (-1252.805) [-1247.896] (-1247.016) (-1256.595) * (-1252.689) (-1253.683) [-1249.194] (-1253.527) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
460500 -- (-1250.802) (-1244.990) [-1250.421] (-1248.829) * (-1256.624) (-1252.849) (-1249.147) [-1243.415] -- 0:01:13
461000 -- [-1244.724] (-1247.039) (-1252.045) (-1246.528) * (-1251.757) (-1249.282) (-1247.440) [-1243.925] -- 0:01:14
461500 -- [-1243.264] (-1245.168) (-1246.849) (-1246.573) * (-1249.525) [-1253.498] (-1249.459) (-1245.003) -- 0:01:14
462000 -- (-1243.465) (-1244.169) [-1246.408] (-1246.479) * [-1247.921] (-1252.086) (-1247.080) (-1251.862) -- 0:01:14
462500 -- (-1247.976) (-1244.387) [-1248.900] (-1245.967) * (-1250.059) [-1243.844] (-1243.957) (-1245.766) -- 0:01:14
463000 -- (-1253.609) [-1251.700] (-1250.533) (-1249.525) * [-1247.671] (-1244.735) (-1254.441) (-1249.129) -- 0:01:14
463500 -- [-1251.744] (-1242.777) (-1248.750) (-1256.492) * (-1252.267) (-1248.907) [-1248.720] (-1251.834) -- 0:01:14
464000 -- [-1243.832] (-1247.178) (-1247.913) (-1247.315) * (-1254.849) (-1243.529) [-1245.226] (-1256.526) -- 0:01:13
464500 -- [-1244.942] (-1245.750) (-1254.983) (-1243.665) * (-1254.980) (-1249.425) (-1245.832) [-1251.935] -- 0:01:13
465000 -- [-1241.794] (-1248.298) (-1259.679) (-1252.175) * [-1245.344] (-1243.515) (-1244.808) (-1252.938) -- 0:01:13
Average standard deviation of split frequencies: 0.000000
465500 -- (-1244.687) (-1247.148) [-1248.127] (-1245.872) * (-1253.940) [-1247.811] (-1243.886) (-1250.100) -- 0:01:13
466000 -- [-1244.373] (-1248.654) (-1252.428) (-1245.879) * (-1248.718) [-1246.205] (-1250.702) (-1251.369) -- 0:01:13
466500 -- [-1244.398] (-1244.215) (-1251.136) (-1243.883) * (-1250.941) [-1248.049] (-1245.373) (-1244.451) -- 0:01:13
467000 -- (-1251.776) (-1244.877) [-1246.022] (-1246.812) * [-1244.506] (-1251.505) (-1251.466) (-1246.547) -- 0:01:13
467500 -- (-1253.060) [-1248.513] (-1254.761) (-1250.636) * (-1246.540) (-1248.407) [-1246.960] (-1251.774) -- 0:01:12
468000 -- (-1256.921) (-1244.443) (-1243.944) [-1243.299] * (-1245.458) [-1243.601] (-1253.594) (-1247.711) -- 0:01:13
468500 -- (-1247.405) [-1247.144] (-1250.542) (-1244.241) * [-1243.070] (-1248.577) (-1252.124) (-1246.497) -- 0:01:13
469000 -- [-1246.296] (-1263.004) (-1244.318) (-1244.333) * [-1242.706] (-1244.697) (-1258.520) (-1243.355) -- 0:01:13
469500 -- (-1248.035) (-1250.086) [-1243.862] (-1253.251) * [-1246.904] (-1247.654) (-1268.749) (-1245.618) -- 0:01:13
470000 -- (-1247.104) (-1246.409) [-1247.223] (-1253.167) * (-1243.369) (-1246.228) (-1250.285) [-1245.842] -- 0:01:13
Average standard deviation of split frequencies: 0.000000
470500 -- (-1251.767) (-1250.142) [-1244.682] (-1248.683) * [-1244.574] (-1248.331) (-1252.733) (-1245.094) -- 0:01:13
471000 -- (-1253.880) (-1251.555) [-1249.356] (-1247.872) * (-1246.996) [-1248.014] (-1257.975) (-1243.490) -- 0:01:13
471500 -- (-1249.316) (-1252.539) (-1253.249) [-1251.815] * [-1247.225] (-1249.532) (-1257.258) (-1246.759) -- 0:01:12
472000 -- (-1253.423) [-1248.056] (-1250.323) (-1252.217) * (-1246.462) (-1249.433) [-1249.528] (-1246.444) -- 0:01:12
472500 -- (-1250.608) (-1249.064) (-1250.718) [-1251.284] * [-1249.077] (-1254.052) (-1258.340) (-1252.179) -- 0:01:12
473000 -- [-1247.724] (-1250.144) (-1243.424) (-1262.569) * (-1249.104) (-1246.558) [-1254.444] (-1251.500) -- 0:01:12
473500 -- (-1246.213) (-1250.210) (-1246.922) [-1244.834] * (-1245.038) [-1246.280] (-1255.445) (-1254.566) -- 0:01:12
474000 -- (-1245.922) (-1257.435) [-1251.393] (-1246.694) * [-1242.413] (-1246.864) (-1257.033) (-1246.569) -- 0:01:12
474500 -- (-1242.772) [-1246.103] (-1252.356) (-1258.323) * (-1243.611) (-1248.503) [-1250.333] (-1249.088) -- 0:01:11
475000 -- (-1242.575) (-1247.545) [-1243.605] (-1245.521) * (-1246.397) [-1247.571] (-1252.701) (-1249.964) -- 0:01:11
Average standard deviation of split frequencies: 0.000000
475500 -- (-1246.621) [-1250.078] (-1246.512) (-1248.848) * (-1245.099) (-1249.200) (-1261.945) [-1244.917] -- 0:01:12
476000 -- (-1250.384) (-1244.961) (-1244.829) [-1253.563] * (-1247.309) (-1247.475) [-1254.816] (-1246.690) -- 0:01:12
476500 -- (-1247.591) [-1244.819] (-1249.667) (-1249.737) * (-1254.770) [-1244.975] (-1253.080) (-1247.398) -- 0:01:12
477000 -- (-1252.906) (-1246.217) (-1250.150) [-1244.992] * (-1251.361) (-1246.669) [-1250.620] (-1251.479) -- 0:01:12
477500 -- (-1246.724) (-1246.038) [-1248.290] (-1245.095) * (-1250.192) (-1245.285) [-1249.849] (-1247.098) -- 0:01:12
478000 -- [-1247.003] (-1242.675) (-1254.356) (-1247.080) * [-1246.570] (-1249.737) (-1246.905) (-1253.590) -- 0:01:12
478500 -- (-1249.929) (-1245.029) (-1249.808) [-1248.341] * (-1249.944) (-1249.274) [-1252.129] (-1257.207) -- 0:01:11
479000 -- (-1251.926) (-1246.807) (-1253.417) [-1246.656] * (-1249.102) [-1243.532] (-1248.951) (-1250.975) -- 0:01:11
479500 -- (-1246.962) [-1249.021] (-1252.885) (-1248.482) * (-1245.503) [-1244.214] (-1250.722) (-1248.628) -- 0:01:11
480000 -- (-1249.187) (-1242.771) (-1250.619) [-1251.772] * (-1247.453) (-1243.472) (-1251.438) [-1246.967] -- 0:01:11
Average standard deviation of split frequencies: 0.000000
480500 -- [-1244.294] (-1248.859) (-1256.952) (-1254.530) * (-1245.454) (-1249.781) (-1250.513) [-1248.574] -- 0:01:11
481000 -- (-1247.437) (-1253.826) (-1245.415) [-1248.420] * (-1249.334) (-1245.442) [-1248.992] (-1245.331) -- 0:01:11
481500 -- (-1258.239) (-1251.342) (-1246.693) [-1250.072] * (-1250.809) (-1248.025) (-1248.577) [-1246.163] -- 0:01:11
482000 -- (-1247.090) (-1254.913) [-1242.963] (-1250.502) * [-1249.786] (-1246.458) (-1255.947) (-1242.910) -- 0:01:10
482500 -- (-1248.368) (-1245.298) (-1249.339) [-1246.002] * (-1247.465) (-1252.114) (-1248.448) [-1251.120] -- 0:01:10
483000 -- (-1247.421) [-1247.214] (-1250.329) (-1247.626) * (-1245.660) (-1255.517) [-1244.455] (-1248.264) -- 0:01:11
483500 -- [-1246.790] (-1247.616) (-1241.979) (-1260.387) * (-1242.613) (-1248.559) (-1244.577) [-1249.163] -- 0:01:11
484000 -- (-1252.141) [-1250.921] (-1251.530) (-1251.062) * [-1247.239] (-1250.823) (-1249.590) (-1243.679) -- 0:01:11
484500 -- (-1252.387) (-1250.307) (-1251.694) [-1250.059] * [-1245.605] (-1244.228) (-1247.007) (-1250.010) -- 0:01:11
485000 -- (-1249.649) (-1243.490) [-1245.889] (-1251.432) * (-1243.600) (-1248.420) (-1254.074) [-1250.429] -- 0:01:11
Average standard deviation of split frequencies: 0.000000
485500 -- [-1246.586] (-1251.055) (-1245.199) (-1257.262) * (-1255.229) (-1246.305) [-1243.522] (-1243.684) -- 0:01:11
486000 -- (-1248.611) (-1247.898) (-1245.537) [-1253.578] * [-1245.397] (-1246.562) (-1241.564) (-1249.047) -- 0:01:10
486500 -- (-1249.213) (-1244.657) (-1250.658) [-1247.308] * (-1251.728) (-1251.529) (-1248.661) [-1243.867] -- 0:01:10
487000 -- (-1249.670) [-1249.133] (-1244.746) (-1247.289) * (-1247.948) (-1250.699) [-1244.203] (-1245.053) -- 0:01:10
487500 -- (-1248.218) (-1250.997) [-1245.801] (-1250.827) * [-1249.984] (-1250.108) (-1247.453) (-1244.674) -- 0:01:10
488000 -- (-1253.405) (-1251.747) [-1245.865] (-1247.823) * (-1246.834) (-1255.634) (-1248.454) [-1245.942] -- 0:01:10
488500 -- (-1252.821) (-1257.774) (-1247.265) [-1247.754] * [-1251.083] (-1253.954) (-1256.240) (-1249.486) -- 0:01:10
489000 -- (-1248.888) (-1246.774) (-1243.434) [-1246.748] * (-1247.356) (-1244.883) (-1256.709) [-1250.020] -- 0:01:10
489500 -- (-1246.416) (-1245.511) (-1249.443) [-1254.165] * (-1256.997) (-1245.437) (-1250.614) [-1250.943] -- 0:01:09
490000 -- (-1250.840) (-1251.991) [-1245.067] (-1250.561) * [-1249.498] (-1245.423) (-1255.117) (-1246.410) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
490500 -- [-1244.562] (-1249.538) (-1247.462) (-1250.041) * (-1251.481) [-1248.494] (-1256.176) (-1252.614) -- 0:01:10
491000 -- (-1246.229) (-1252.079) [-1242.519] (-1252.313) * [-1249.841] (-1247.906) (-1249.700) (-1251.260) -- 0:01:10
491500 -- (-1245.823) [-1247.359] (-1244.744) (-1252.568) * (-1256.211) (-1248.763) [-1247.445] (-1248.056) -- 0:01:10
492000 -- [-1245.502] (-1249.483) (-1247.062) (-1251.064) * (-1253.536) (-1249.140) (-1250.450) [-1245.815] -- 0:01:10
492500 -- (-1245.262) (-1244.648) (-1250.947) [-1243.703] * (-1249.219) (-1254.252) [-1250.768] (-1247.392) -- 0:01:10
493000 -- [-1247.907] (-1242.010) (-1254.655) (-1244.091) * (-1257.137) (-1247.913) [-1245.754] (-1251.445) -- 0:01:09
493500 -- (-1255.473) [-1241.472] (-1255.722) (-1248.211) * (-1245.222) (-1256.012) (-1246.466) [-1248.801] -- 0:01:09
494000 -- (-1244.331) [-1250.441] (-1249.186) (-1245.196) * (-1247.469) [-1244.922] (-1244.468) (-1250.555) -- 0:01:09
494500 -- (-1256.425) [-1244.266] (-1246.544) (-1245.101) * [-1244.266] (-1247.810) (-1247.635) (-1253.280) -- 0:01:09
495000 -- (-1257.785) (-1243.231) (-1254.235) [-1245.224] * [-1248.395] (-1254.132) (-1245.766) (-1247.486) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
495500 -- (-1253.432) (-1243.191) [-1249.642] (-1245.568) * (-1244.092) [-1247.083] (-1252.205) (-1247.518) -- 0:01:09
496000 -- (-1246.159) [-1246.621] (-1250.914) (-1251.728) * [-1244.641] (-1244.143) (-1258.243) (-1252.248) -- 0:01:09
496500 -- (-1245.347) (-1243.396) (-1248.877) [-1251.504] * (-1250.321) [-1243.842] (-1251.987) (-1251.718) -- 0:01:08
497000 -- (-1250.173) (-1244.511) [-1246.782] (-1244.658) * (-1254.162) [-1248.116] (-1254.213) (-1252.267) -- 0:01:08
497500 -- (-1248.385) (-1248.927) [-1248.970] (-1245.679) * (-1251.787) (-1243.735) [-1262.457] (-1252.002) -- 0:01:08
498000 -- (-1244.645) [-1243.392] (-1247.686) (-1247.623) * (-1250.291) [-1251.094] (-1258.705) (-1248.839) -- 0:01:09
498500 -- (-1243.507) (-1243.301) [-1246.070] (-1244.233) * [-1251.444] (-1248.762) (-1261.161) (-1248.371) -- 0:01:09
499000 -- (-1248.181) (-1248.840) (-1245.910) [-1246.827] * [-1248.099] (-1250.333) (-1251.208) (-1252.052) -- 0:01:09
499500 -- [-1247.228] (-1248.143) (-1245.980) (-1247.236) * (-1254.436) [-1241.899] (-1257.111) (-1246.614) -- 0:01:09
500000 -- (-1246.151) (-1252.842) [-1247.373] (-1246.263) * [-1248.487] (-1245.769) (-1248.069) (-1245.898) -- 0:01:09
Average standard deviation of split frequencies: 0.000000
500500 -- [-1255.091] (-1249.195) (-1248.976) (-1244.786) * (-1254.412) (-1243.482) (-1259.868) [-1249.488] -- 0:01:08
501000 -- [-1247.597] (-1248.232) (-1254.378) (-1246.025) * (-1251.119) [-1246.323] (-1252.150) (-1250.935) -- 0:01:08
501500 -- (-1245.481) [-1252.802] (-1251.276) (-1249.052) * [-1252.198] (-1244.686) (-1253.502) (-1256.225) -- 0:01:08
502000 -- (-1247.743) (-1249.950) [-1245.109] (-1252.689) * (-1245.582) (-1244.857) (-1257.143) [-1245.929] -- 0:01:08
502500 -- [-1243.365] (-1251.253) (-1247.203) (-1248.047) * (-1245.523) (-1244.636) [-1253.997] (-1246.800) -- 0:01:08
503000 -- (-1244.155) (-1247.891) [-1246.439] (-1247.756) * [-1247.787] (-1249.701) (-1252.634) (-1244.817) -- 0:01:08
503500 -- (-1246.625) (-1249.473) [-1246.621] (-1251.158) * [-1246.725] (-1248.988) (-1257.518) (-1249.097) -- 0:01:08
504000 -- [-1242.071] (-1248.763) (-1247.597) (-1249.612) * (-1255.889) (-1244.920) (-1251.210) [-1249.050] -- 0:01:07
504500 -- (-1254.289) [-1248.763] (-1252.521) (-1249.269) * (-1243.642) [-1246.498] (-1252.072) (-1245.487) -- 0:01:07
505000 -- (-1250.676) (-1249.563) [-1246.605] (-1247.349) * [-1247.602] (-1246.178) (-1251.031) (-1252.204) -- 0:01:07
Average standard deviation of split frequencies: 0.000000
505500 -- (-1252.463) (-1258.972) [-1247.089] (-1259.703) * [-1244.410] (-1243.661) (-1250.744) (-1255.557) -- 0:01:08
506000 -- (-1249.384) [-1248.869] (-1250.131) (-1245.688) * [-1245.857] (-1245.527) (-1250.403) (-1250.385) -- 0:01:08
506500 -- [-1249.155] (-1250.685) (-1247.905) (-1250.510) * (-1247.678) (-1243.972) (-1253.218) [-1246.936] -- 0:01:08
507000 -- (-1250.632) (-1249.019) (-1246.864) [-1252.906] * (-1248.600) (-1244.763) (-1252.912) [-1244.848] -- 0:01:08
507500 -- (-1252.395) (-1246.927) (-1251.076) [-1250.534] * (-1245.935) [-1243.264] (-1253.771) (-1245.111) -- 0:01:07
508000 -- (-1256.156) [-1248.630] (-1248.425) (-1252.576) * (-1248.649) (-1244.803) (-1254.578) [-1247.351] -- 0:01:07
508500 -- [-1247.963] (-1254.117) (-1248.475) (-1249.260) * (-1246.771) (-1242.884) (-1251.972) [-1243.033] -- 0:01:07
509000 -- (-1252.169) (-1247.551) [-1245.034] (-1250.051) * (-1245.803) [-1242.632] (-1247.821) (-1249.467) -- 0:01:07
509500 -- (-1255.060) [-1248.355] (-1246.579) (-1251.142) * [-1247.749] (-1251.414) (-1242.166) (-1248.613) -- 0:01:07
510000 -- [-1250.965] (-1248.209) (-1247.120) (-1245.403) * (-1256.362) (-1254.583) [-1249.162] (-1254.716) -- 0:01:07
Average standard deviation of split frequencies: 0.000000
510500 -- (-1255.533) (-1251.125) [-1252.531] (-1250.163) * (-1248.733) (-1249.447) (-1248.844) [-1251.969] -- 0:01:07
511000 -- (-1251.092) [-1245.690] (-1246.182) (-1248.321) * (-1251.794) (-1252.003) [-1242.032] (-1250.538) -- 0:01:06
511500 -- [-1254.795] (-1248.688) (-1248.655) (-1247.029) * (-1247.517) (-1254.253) (-1244.833) [-1251.894] -- 0:01:06
512000 -- (-1260.223) (-1245.505) [-1248.208] (-1244.179) * (-1243.307) (-1244.603) [-1243.450] (-1250.379) -- 0:01:06
512500 -- [-1242.396] (-1247.450) (-1254.973) (-1246.360) * (-1244.952) [-1244.346] (-1253.535) (-1248.454) -- 0:01:06
513000 -- [-1244.867] (-1244.933) (-1246.699) (-1248.738) * (-1248.002) [-1245.845] (-1246.118) (-1251.436) -- 0:01:07
513500 -- (-1246.538) (-1246.470) [-1244.241] (-1245.556) * [-1245.578] (-1246.799) (-1246.213) (-1254.232) -- 0:01:07
514000 -- (-1246.353) [-1244.964] (-1252.751) (-1246.308) * (-1246.313) [-1253.474] (-1243.420) (-1257.075) -- 0:01:07
514500 -- (-1251.418) (-1250.255) [-1249.336] (-1246.550) * [-1246.886] (-1252.429) (-1247.270) (-1249.442) -- 0:01:06
515000 -- (-1248.647) (-1245.324) [-1242.468] (-1250.860) * [-1242.546] (-1250.117) (-1256.374) (-1250.538) -- 0:01:06
Average standard deviation of split frequencies: 0.000000
515500 -- (-1251.739) (-1249.175) [-1243.674] (-1256.428) * (-1244.660) (-1253.593) [-1247.715] (-1245.079) -- 0:01:06
516000 -- (-1261.265) (-1245.692) [-1244.280] (-1244.062) * (-1246.711) (-1250.424) [-1248.349] (-1244.564) -- 0:01:06
516500 -- (-1247.781) (-1246.080) (-1249.013) [-1245.854] * (-1244.710) (-1246.115) (-1244.543) [-1244.260] -- 0:01:06
517000 -- (-1248.901) (-1242.838) (-1246.357) [-1249.592] * (-1254.073) (-1245.476) [-1248.247] (-1249.590) -- 0:01:06
517500 -- (-1243.200) [-1248.871] (-1247.649) (-1253.263) * (-1245.864) (-1247.430) (-1246.912) [-1246.027] -- 0:01:06
518000 -- [-1249.537] (-1247.984) (-1249.446) (-1252.015) * (-1245.290) (-1245.423) (-1251.342) [-1246.593] -- 0:01:06
518500 -- (-1248.928) (-1246.420) (-1250.295) [-1248.857] * (-1249.910) (-1243.231) (-1246.458) [-1243.883] -- 0:01:05
519000 -- [-1245.849] (-1245.810) (-1248.501) (-1247.351) * (-1245.919) (-1245.780) (-1252.010) [-1243.027] -- 0:01:05
519500 -- (-1241.649) [-1249.064] (-1255.710) (-1245.572) * (-1246.360) [-1246.563] (-1251.427) (-1245.451) -- 0:01:05
520000 -- (-1258.625) (-1247.370) [-1250.838] (-1243.961) * [-1250.028] (-1251.233) (-1240.771) (-1245.276) -- 0:01:05
Average standard deviation of split frequencies: 0.000000
520500 -- (-1253.797) (-1245.482) (-1251.391) [-1247.234] * (-1247.664) (-1248.614) (-1246.699) [-1246.033] -- 0:01:06
521000 -- (-1252.046) (-1247.261) (-1254.554) [-1243.161] * [-1250.408] (-1245.197) (-1253.913) (-1244.994) -- 0:01:06
521500 -- (-1249.045) (-1240.325) [-1250.450] (-1246.229) * (-1248.035) (-1251.049) [-1244.478] (-1247.523) -- 0:01:06
522000 -- [-1244.906] (-1249.406) (-1249.268) (-1249.458) * (-1250.073) [-1245.492] (-1248.206) (-1246.309) -- 0:01:05
522500 -- (-1245.684) (-1243.639) [-1247.541] (-1252.752) * (-1246.144) (-1250.010) (-1246.682) [-1243.590] -- 0:01:05
523000 -- [-1243.014] (-1246.373) (-1248.748) (-1248.975) * (-1245.258) [-1246.300] (-1245.705) (-1244.136) -- 0:01:05
523500 -- (-1249.174) (-1245.846) [-1251.015] (-1245.584) * (-1245.219) (-1246.244) (-1247.986) [-1245.342] -- 0:01:05
524000 -- (-1249.226) (-1241.000) (-1251.025) [-1244.895] * [-1242.817] (-1248.392) (-1246.741) (-1246.942) -- 0:01:05
524500 -- (-1248.144) [-1246.638] (-1251.375) (-1245.496) * [-1243.005] (-1256.489) (-1244.888) (-1246.725) -- 0:01:05
525000 -- [-1244.611] (-1244.324) (-1258.232) (-1248.161) * (-1250.720) (-1249.753) (-1251.225) [-1242.661] -- 0:01:05
Average standard deviation of split frequencies: 0.000000
525500 -- (-1251.925) (-1242.464) [-1249.099] (-1244.081) * (-1247.695) (-1255.633) (-1250.715) [-1246.797] -- 0:01:05
526000 -- (-1249.893) [-1243.096] (-1253.360) (-1250.732) * (-1251.145) (-1248.490) (-1247.937) [-1248.506] -- 0:01:04
526500 -- [-1243.761] (-1245.259) (-1242.820) (-1246.705) * (-1251.971) (-1247.225) (-1248.633) [-1251.336] -- 0:01:04
527000 -- (-1247.459) [-1245.829] (-1242.911) (-1248.940) * (-1251.389) (-1252.754) [-1244.677] (-1242.352) -- 0:01:04
527500 -- (-1248.890) (-1247.212) (-1248.851) [-1246.244] * (-1253.161) (-1253.511) (-1248.156) [-1247.326] -- 0:01:04
528000 -- (-1254.749) (-1253.028) [-1246.115] (-1244.552) * [-1254.384] (-1246.843) (-1252.790) (-1247.298) -- 0:01:05
528500 -- (-1252.793) (-1248.278) (-1248.204) [-1243.343] * [-1247.859] (-1250.010) (-1248.246) (-1246.725) -- 0:01:05
529000 -- (-1247.292) (-1256.984) [-1253.486] (-1248.095) * (-1246.524) (-1249.532) [-1246.182] (-1254.237) -- 0:01:04
529500 -- (-1255.519) (-1245.885) (-1248.377) [-1246.663] * (-1249.020) (-1251.737) [-1249.340] (-1250.639) -- 0:01:04
530000 -- (-1248.183) [-1246.517] (-1254.404) (-1246.622) * (-1249.026) [-1246.159] (-1245.291) (-1251.510) -- 0:01:04
Average standard deviation of split frequencies: 0.000000
530500 -- [-1246.089] (-1244.868) (-1250.040) (-1245.276) * [-1244.096] (-1251.466) (-1244.055) (-1247.117) -- 0:01:04
531000 -- (-1243.938) (-1247.413) [-1245.763] (-1249.884) * (-1246.233) (-1246.460) (-1246.831) [-1247.299] -- 0:01:04
531500 -- (-1252.625) [-1250.624] (-1248.470) (-1250.169) * [-1244.531] (-1254.414) (-1248.294) (-1244.110) -- 0:01:04
532000 -- (-1248.302) (-1254.911) [-1244.617] (-1256.687) * (-1244.099) (-1255.537) [-1247.596] (-1249.097) -- 0:01:04
532500 -- (-1252.549) (-1255.776) (-1249.449) [-1244.888] * (-1242.665) (-1245.209) [-1250.727] (-1252.646) -- 0:01:04
533000 -- [-1246.336] (-1254.952) (-1253.108) (-1251.681) * (-1248.081) (-1254.179) [-1246.912] (-1252.125) -- 0:01:03
533500 -- (-1240.879) [-1257.432] (-1263.087) (-1257.963) * [-1252.662] (-1247.648) (-1253.710) (-1252.653) -- 0:01:03
534000 -- (-1255.387) (-1246.367) (-1250.895) [-1250.395] * [-1243.414] (-1245.998) (-1249.462) (-1248.995) -- 0:01:03
534500 -- (-1253.379) (-1250.177) (-1246.082) [-1253.701] * (-1245.939) (-1245.870) [-1250.698] (-1244.641) -- 0:01:03
535000 -- [-1243.644] (-1249.725) (-1250.911) (-1256.320) * (-1251.462) (-1249.824) (-1241.282) [-1245.878] -- 0:01:04
Average standard deviation of split frequencies: 0.000440
535500 -- (-1247.745) (-1247.080) (-1243.333) [-1246.706] * (-1254.478) (-1247.229) [-1244.906] (-1249.680) -- 0:01:04
536000 -- (-1248.304) [-1247.056] (-1247.162) (-1246.792) * [-1251.666] (-1248.461) (-1248.100) (-1251.676) -- 0:01:04
536500 -- [-1246.296] (-1249.767) (-1250.721) (-1245.210) * (-1247.696) (-1245.838) [-1246.827] (-1249.991) -- 0:01:03
537000 -- (-1246.797) (-1243.421) (-1248.790) [-1243.154] * (-1251.792) [-1250.127] (-1247.853) (-1247.693) -- 0:01:03
537500 -- [-1248.134] (-1250.912) (-1247.845) (-1243.441) * (-1246.138) (-1251.755) [-1242.260] (-1251.802) -- 0:01:03
538000 -- (-1250.220) (-1248.901) (-1244.012) [-1250.309] * (-1248.409) (-1244.900) (-1247.867) [-1249.455] -- 0:01:03
538500 -- [-1246.368] (-1245.626) (-1246.933) (-1246.210) * (-1250.313) (-1245.764) [-1245.248] (-1247.166) -- 0:01:03
539000 -- (-1241.606) (-1252.510) (-1252.840) [-1247.522] * (-1249.377) (-1246.406) [-1245.682] (-1249.092) -- 0:01:03
539500 -- (-1246.569) (-1250.482) [-1249.547] (-1245.454) * (-1248.490) (-1247.617) (-1253.823) [-1245.694] -- 0:01:03
540000 -- (-1249.028) (-1253.285) (-1243.075) [-1246.929] * (-1250.155) (-1247.653) [-1244.239] (-1254.621) -- 0:01:03
Average standard deviation of split frequencies: 0.000000
540500 -- [-1247.563] (-1245.119) (-1248.670) (-1255.209) * (-1252.222) (-1251.595) [-1246.031] (-1249.407) -- 0:01:02
541000 -- [-1241.929] (-1251.887) (-1251.274) (-1249.651) * [-1247.360] (-1250.961) (-1246.418) (-1248.137) -- 0:01:02
541500 -- [-1243.336] (-1250.420) (-1249.669) (-1251.103) * (-1251.424) (-1250.696) [-1242.595] (-1250.423) -- 0:01:02
542000 -- (-1247.010) [-1249.443] (-1249.349) (-1252.132) * (-1243.827) (-1252.606) (-1248.490) [-1247.308] -- 0:01:02
542500 -- (-1253.857) [-1245.042] (-1252.257) (-1247.810) * [-1244.101] (-1254.802) (-1249.698) (-1242.679) -- 0:01:03
543000 -- [-1243.638] (-1256.109) (-1248.406) (-1249.561) * (-1247.295) [-1246.003] (-1251.891) (-1245.251) -- 0:01:03
543500 -- (-1247.843) (-1248.812) (-1246.377) [-1246.306] * [-1243.724] (-1248.792) (-1250.660) (-1251.579) -- 0:01:02
544000 -- (-1250.593) (-1250.124) [-1246.317] (-1245.812) * [-1246.964] (-1254.115) (-1247.398) (-1247.690) -- 0:01:02
544500 -- [-1248.302] (-1253.610) (-1242.741) (-1251.051) * (-1247.019) [-1245.476] (-1247.196) (-1249.783) -- 0:01:02
545000 -- (-1248.291) (-1248.336) [-1246.523] (-1250.137) * [-1244.651] (-1254.432) (-1248.349) (-1244.362) -- 0:01:02
Average standard deviation of split frequencies: 0.000000
545500 -- (-1245.267) (-1247.837) (-1246.793) [-1244.488] * (-1257.987) [-1250.670] (-1253.354) (-1248.017) -- 0:01:02
546000 -- [-1242.752] (-1248.556) (-1249.359) (-1242.577) * [-1251.568] (-1249.939) (-1249.876) (-1247.805) -- 0:01:02
546500 -- (-1253.318) (-1242.652) (-1247.109) [-1246.565] * (-1251.334) (-1252.907) [-1248.672] (-1246.605) -- 0:01:02
547000 -- [-1251.209] (-1250.378) (-1256.896) (-1250.802) * (-1252.102) (-1251.427) [-1246.681] (-1245.320) -- 0:01:02
547500 -- [-1248.362] (-1252.377) (-1248.331) (-1246.798) * [-1253.784] (-1251.729) (-1244.383) (-1244.515) -- 0:01:01
548000 -- [-1250.761] (-1247.263) (-1246.637) (-1248.416) * [-1245.124] (-1247.797) (-1242.177) (-1243.315) -- 0:01:01
548500 -- (-1248.965) (-1245.894) (-1251.042) [-1244.411] * (-1250.354) [-1246.512] (-1247.078) (-1246.599) -- 0:01:01
549000 -- (-1245.690) [-1242.989] (-1250.192) (-1248.107) * (-1250.076) (-1246.287) [-1247.271] (-1244.959) -- 0:01:01
549500 -- (-1245.184) (-1246.052) [-1245.974] (-1251.702) * (-1247.992) (-1253.469) [-1240.972] (-1251.569) -- 0:01:01
550000 -- (-1249.586) (-1243.596) [-1244.330] (-1248.614) * (-1247.148) (-1248.790) [-1244.712] (-1247.084) -- 0:01:02
Average standard deviation of split frequencies: 0.000428
550500 -- (-1248.272) (-1251.614) (-1246.366) [-1250.879] * (-1247.464) [-1244.945] (-1247.566) (-1251.433) -- 0:01:02
551000 -- (-1251.855) (-1245.645) (-1255.855) [-1247.395] * (-1248.347) (-1245.606) (-1250.529) [-1247.704] -- 0:01:01
551500 -- [-1252.192] (-1245.021) (-1246.608) (-1245.534) * [-1247.031] (-1250.433) (-1243.900) (-1246.764) -- 0:01:01
552000 -- (-1248.569) (-1245.773) (-1250.369) [-1243.971] * (-1253.499) (-1246.981) [-1246.831] (-1247.210) -- 0:01:01
552500 -- (-1244.767) [-1249.478] (-1246.721) (-1247.385) * [-1246.286] (-1244.045) (-1244.696) (-1245.941) -- 0:01:01
553000 -- (-1253.927) (-1245.975) [-1246.319] (-1256.027) * (-1250.459) (-1249.405) (-1245.724) [-1248.313] -- 0:01:01
553500 -- (-1256.820) (-1250.329) [-1251.029] (-1245.583) * (-1251.169) (-1250.934) [-1251.653] (-1249.058) -- 0:01:01
554000 -- (-1245.535) (-1251.042) [-1244.653] (-1246.572) * (-1249.734) [-1245.806] (-1248.096) (-1250.702) -- 0:01:01
554500 -- [-1245.873] (-1250.254) (-1247.154) (-1245.973) * (-1255.948) (-1249.649) [-1245.046] (-1252.256) -- 0:01:01
555000 -- (-1250.033) (-1251.512) [-1248.561] (-1245.004) * (-1249.908) (-1248.933) (-1247.401) [-1249.257] -- 0:01:00
Average standard deviation of split frequencies: 0.000848
555500 -- (-1245.613) (-1248.285) [-1244.013] (-1246.460) * (-1244.187) [-1251.580] (-1253.469) (-1249.336) -- 0:01:00
556000 -- (-1257.641) (-1248.621) [-1243.393] (-1253.453) * (-1250.403) (-1253.832) (-1251.017) [-1248.943] -- 0:01:00
556500 -- (-1247.872) [-1244.822] (-1246.474) (-1254.586) * (-1251.616) (-1249.973) (-1253.277) [-1246.902] -- 0:01:00
557000 -- [-1249.883] (-1250.558) (-1249.092) (-1247.819) * [-1246.600] (-1248.269) (-1253.316) (-1249.753) -- 0:01:00
557500 -- (-1248.271) (-1249.384) (-1244.097) [-1246.846] * (-1253.894) (-1255.907) (-1244.657) [-1248.194] -- 0:01:00
558000 -- (-1248.833) (-1248.472) (-1248.474) [-1247.842] * [-1249.666] (-1248.937) (-1245.923) (-1249.225) -- 0:01:00
558500 -- (-1249.592) (-1258.147) [-1249.607] (-1243.280) * (-1248.976) (-1251.934) [-1245.354] (-1252.174) -- 0:01:00
559000 -- (-1245.655) (-1249.024) (-1247.481) [-1250.105] * (-1252.224) (-1249.180) (-1244.819) [-1248.523] -- 0:01:00
559500 -- (-1253.568) (-1248.279) (-1249.938) [-1246.244] * (-1247.135) (-1251.866) [-1246.320] (-1242.974) -- 0:01:00
560000 -- [-1245.572] (-1247.686) (-1250.358) (-1250.319) * (-1258.300) (-1254.780) [-1251.315] (-1243.400) -- 0:01:00
Average standard deviation of split frequencies: 0.000841
560500 -- (-1242.616) (-1246.017) [-1247.109] (-1248.577) * (-1248.956) [-1252.430] (-1244.573) (-1247.091) -- 0:01:00
561000 -- (-1242.914) (-1244.061) (-1249.454) [-1252.545] * [-1246.748] (-1247.802) (-1246.067) (-1252.182) -- 0:01:00
561500 -- (-1251.292) [-1251.468] (-1249.751) (-1256.938) * (-1249.068) (-1245.804) (-1256.065) [-1250.024] -- 0:01:00
562000 -- (-1246.467) [-1247.088] (-1254.790) (-1246.125) * (-1247.931) [-1250.968] (-1247.886) (-1245.881) -- 0:01:00
562500 -- (-1248.433) (-1243.597) (-1253.078) [-1245.694] * (-1243.966) (-1249.185) (-1252.430) [-1244.289] -- 0:00:59
563000 -- (-1254.769) (-1245.908) (-1260.093) [-1247.761] * (-1245.809) (-1253.773) (-1244.968) [-1245.814] -- 0:00:59
563500 -- (-1248.083) (-1247.377) [-1246.019] (-1251.112) * (-1248.750) [-1249.665] (-1250.962) (-1246.032) -- 0:00:59
564000 -- (-1250.936) (-1245.985) [-1246.453] (-1248.186) * (-1243.832) (-1255.348) (-1246.934) [-1243.430] -- 0:00:59
564500 -- (-1242.086) (-1253.188) [-1245.136] (-1250.794) * [-1246.081] (-1250.671) (-1255.029) (-1248.114) -- 0:00:59
565000 -- (-1246.956) [-1245.613] (-1245.433) (-1248.527) * (-1248.901) (-1247.665) (-1252.199) [-1249.773] -- 0:00:59
Average standard deviation of split frequencies: 0.000833
565500 -- (-1244.895) (-1256.233) [-1244.001] (-1249.988) * [-1247.182] (-1250.284) (-1247.221) (-1256.145) -- 0:00:59
566000 -- (-1245.703) [-1251.265] (-1244.472) (-1247.583) * (-1245.108) (-1253.148) (-1254.530) [-1247.673] -- 0:00:59
566500 -- [-1251.066] (-1253.580) (-1249.744) (-1251.792) * [-1243.702] (-1259.367) (-1248.955) (-1245.024) -- 0:00:59
567000 -- (-1251.215) (-1250.379) [-1248.404] (-1244.789) * (-1247.358) (-1255.148) (-1247.141) [-1244.024] -- 0:00:59
567500 -- (-1257.020) [-1249.762] (-1248.594) (-1246.312) * (-1252.197) (-1261.496) (-1244.842) [-1246.741] -- 0:00:59
568000 -- [-1253.848] (-1245.864) (-1253.930) (-1245.623) * (-1249.697) (-1253.810) (-1248.564) [-1249.083] -- 0:00:59
568500 -- (-1259.104) (-1256.339) [-1251.504] (-1245.576) * (-1244.788) [-1251.933] (-1249.081) (-1250.847) -- 0:00:59
569000 -- (-1259.002) (-1249.793) [-1242.521] (-1249.933) * (-1249.878) (-1252.064) [-1246.352] (-1245.646) -- 0:00:59
569500 -- (-1253.768) [-1247.830] (-1247.551) (-1249.994) * [-1249.800] (-1256.647) (-1252.324) (-1249.128) -- 0:00:58
570000 -- [-1245.335] (-1251.769) (-1243.341) (-1247.030) * [-1246.688] (-1249.404) (-1256.410) (-1255.460) -- 0:00:58
Average standard deviation of split frequencies: 0.000826
570500 -- (-1249.006) [-1249.490] (-1248.799) (-1249.766) * [-1254.220] (-1248.623) (-1249.023) (-1251.550) -- 0:00:58
571000 -- (-1249.184) (-1248.530) [-1246.009] (-1247.888) * (-1252.750) (-1248.961) [-1249.107] (-1254.239) -- 0:00:58
571500 -- (-1243.245) (-1251.941) (-1250.370) [-1241.707] * (-1247.583) (-1251.433) (-1251.549) [-1247.230] -- 0:00:58
572000 -- [-1243.815] (-1251.236) (-1248.290) (-1248.573) * [-1246.902] (-1250.228) (-1250.732) (-1245.482) -- 0:00:58
572500 -- [-1242.427] (-1245.447) (-1248.190) (-1247.485) * [-1246.500] (-1247.786) (-1254.326) (-1248.790) -- 0:00:58
573000 -- (-1242.537) (-1247.134) (-1254.296) [-1249.927] * (-1250.006) [-1247.443] (-1248.825) (-1255.217) -- 0:00:58
573500 -- (-1246.454) [-1251.923] (-1248.991) (-1248.937) * (-1246.148) [-1243.940] (-1250.769) (-1254.105) -- 0:00:58
574000 -- (-1252.563) (-1260.600) (-1249.313) [-1246.858] * (-1248.782) [-1247.954] (-1251.372) (-1252.997) -- 0:00:58
574500 -- [-1248.690] (-1253.974) (-1244.668) (-1243.395) * (-1252.104) (-1253.159) (-1246.504) [-1247.820] -- 0:00:58
575000 -- [-1249.411] (-1251.055) (-1246.488) (-1248.174) * (-1250.320) (-1253.122) [-1246.847] (-1252.040) -- 0:00:58
Average standard deviation of split frequencies: 0.001637
575500 -- [-1248.249] (-1245.800) (-1248.410) (-1249.690) * [-1249.947] (-1250.388) (-1249.173) (-1245.476) -- 0:00:58
576000 -- (-1245.912) (-1248.284) [-1247.554] (-1245.885) * (-1252.374) (-1248.681) [-1247.340] (-1252.588) -- 0:00:58
576500 -- (-1244.175) (-1250.329) [-1247.949] (-1249.352) * (-1253.464) (-1252.946) (-1250.338) [-1244.483] -- 0:00:58
577000 -- (-1251.019) (-1252.753) (-1251.875) [-1249.961] * (-1250.973) (-1249.975) (-1247.567) [-1254.620] -- 0:00:57
577500 -- (-1247.924) (-1253.576) (-1248.778) [-1249.909] * (-1247.118) (-1244.558) (-1249.262) [-1243.990] -- 0:00:57
578000 -- [-1246.873] (-1251.673) (-1251.611) (-1250.000) * [-1243.832] (-1254.027) (-1251.510) (-1241.463) -- 0:00:57
578500 -- (-1251.454) (-1251.790) (-1249.087) [-1251.289] * (-1247.152) (-1246.222) (-1251.788) [-1250.849] -- 0:00:57
579000 -- (-1246.393) (-1253.296) (-1249.143) [-1251.387] * (-1249.046) (-1246.180) [-1249.396] (-1249.081) -- 0:00:57
579500 -- [-1250.467] (-1252.771) (-1253.636) (-1251.035) * (-1249.219) (-1246.526) (-1252.160) [-1246.755] -- 0:00:57
580000 -- [-1250.961] (-1249.010) (-1247.995) (-1248.163) * [-1247.549] (-1249.131) (-1250.454) (-1252.354) -- 0:00:57
Average standard deviation of split frequencies: 0.001624
580500 -- [-1248.968] (-1248.336) (-1245.992) (-1241.806) * [-1246.362] (-1248.982) (-1247.038) (-1253.057) -- 0:00:57
581000 -- (-1254.277) (-1245.276) (-1254.070) [-1250.261] * (-1249.953) (-1246.525) (-1244.452) [-1252.248] -- 0:00:57
581500 -- (-1243.299) (-1244.722) (-1249.467) [-1243.201] * [-1244.639] (-1250.425) (-1248.978) (-1243.016) -- 0:00:57
582000 -- (-1245.231) (-1253.277) (-1252.901) [-1249.245] * [-1245.083] (-1249.857) (-1256.918) (-1248.875) -- 0:00:57
582500 -- (-1248.299) [-1243.916] (-1243.292) (-1254.362) * [-1246.857] (-1251.242) (-1244.143) (-1243.567) -- 0:00:57
583000 -- (-1247.643) (-1245.438) [-1242.250] (-1244.590) * (-1246.891) (-1250.095) [-1249.134] (-1248.851) -- 0:00:57
583500 -- (-1246.154) [-1244.809] (-1248.450) (-1246.083) * [-1251.349] (-1245.489) (-1251.305) (-1251.223) -- 0:00:57
584000 -- (-1251.600) (-1247.543) (-1247.920) [-1245.200] * (-1251.017) [-1255.896] (-1248.183) (-1249.434) -- 0:00:56
584500 -- [-1241.924] (-1248.803) (-1255.238) (-1248.046) * (-1245.313) (-1251.110) [-1246.524] (-1250.488) -- 0:00:56
585000 -- (-1247.321) (-1251.198) [-1251.234] (-1246.848) * [-1252.334] (-1248.687) (-1249.243) (-1248.902) -- 0:00:56
Average standard deviation of split frequencies: 0.001609
585500 -- (-1249.260) [-1247.369] (-1247.412) (-1253.983) * (-1251.590) (-1246.846) (-1248.286) [-1243.609] -- 0:00:56
586000 -- (-1240.911) (-1247.600) [-1248.451] (-1249.845) * (-1251.734) (-1246.699) [-1245.950] (-1248.261) -- 0:00:56
586500 -- (-1247.631) (-1252.592) [-1247.247] (-1243.412) * (-1249.751) [-1243.629] (-1254.257) (-1247.543) -- 0:00:56
587000 -- (-1248.875) [-1251.208] (-1251.851) (-1253.838) * (-1246.686) [-1240.460] (-1246.185) (-1244.578) -- 0:00:56
587500 -- [-1248.850] (-1256.573) (-1248.954) (-1245.458) * [-1245.013] (-1246.009) (-1247.982) (-1252.085) -- 0:00:56
588000 -- (-1248.381) (-1248.500) [-1248.503] (-1250.912) * [-1243.254] (-1253.706) (-1248.815) (-1246.306) -- 0:00:56
588500 -- (-1251.709) [-1242.023] (-1245.500) (-1247.600) * (-1245.295) [-1253.822] (-1248.087) (-1252.030) -- 0:00:56
589000 -- [-1244.162] (-1251.620) (-1254.158) (-1259.177) * (-1255.408) (-1248.881) (-1248.673) [-1247.453] -- 0:00:56
589500 -- [-1249.724] (-1243.925) (-1247.593) (-1246.866) * [-1250.593] (-1246.805) (-1244.364) (-1242.423) -- 0:00:56
590000 -- (-1250.469) (-1247.434) [-1246.642] (-1253.833) * (-1249.574) [-1247.272] (-1248.443) (-1247.164) -- 0:00:56
Average standard deviation of split frequencies: 0.001596
590500 -- [-1245.449] (-1243.949) (-1243.870) (-1253.777) * (-1243.548) (-1251.314) (-1244.505) [-1244.696] -- 0:00:56
591000 -- (-1248.302) (-1247.933) (-1244.638) [-1246.682] * (-1246.846) (-1244.691) [-1251.413] (-1247.403) -- 0:00:56
591500 -- (-1252.019) [-1245.312] (-1245.386) (-1248.486) * (-1252.785) (-1242.983) [-1245.666] (-1253.683) -- 0:00:55
592000 -- (-1244.959) [-1242.215] (-1246.304) (-1244.956) * (-1248.698) [-1244.060] (-1250.551) (-1249.831) -- 0:00:55
592500 -- (-1242.282) [-1242.024] (-1243.850) (-1251.480) * (-1245.865) (-1245.023) [-1252.093] (-1247.138) -- 0:00:55
593000 -- (-1245.091) [-1250.146] (-1244.152) (-1252.193) * (-1249.082) (-1250.807) (-1248.016) [-1248.248] -- 0:00:55
593500 -- [-1244.900] (-1257.243) (-1245.733) (-1245.566) * (-1248.083) [-1247.982] (-1249.025) (-1250.646) -- 0:00:55
594000 -- (-1252.809) [-1240.927] (-1249.163) (-1245.613) * [-1248.518] (-1243.126) (-1257.144) (-1253.475) -- 0:00:55
594500 -- (-1245.373) (-1246.327) [-1248.722] (-1245.513) * (-1251.081) [-1248.348] (-1251.540) (-1248.710) -- 0:00:55
595000 -- (-1258.940) [-1242.847] (-1247.313) (-1244.989) * (-1246.897) (-1246.705) [-1245.912] (-1248.578) -- 0:00:55
Average standard deviation of split frequencies: 0.001186
595500 -- (-1255.999) [-1243.440] (-1247.827) (-1252.052) * [-1244.982] (-1249.170) (-1249.409) (-1253.342) -- 0:00:55
596000 -- (-1254.087) (-1248.165) [-1252.471] (-1254.155) * [-1243.510] (-1246.877) (-1250.985) (-1250.980) -- 0:00:55
596500 -- (-1249.357) (-1249.220) [-1247.876] (-1250.863) * (-1246.522) [-1243.248] (-1251.011) (-1250.039) -- 0:00:55
597000 -- [-1250.412] (-1249.732) (-1257.658) (-1248.682) * (-1243.613) (-1248.637) [-1245.781] (-1250.283) -- 0:00:55
597500 -- (-1248.526) (-1249.294) (-1250.701) [-1251.285] * (-1245.299) (-1245.855) [-1253.452] (-1250.540) -- 0:00:55
598000 -- [-1247.873] (-1250.327) (-1245.826) (-1244.437) * [-1246.471] (-1245.931) (-1247.000) (-1246.693) -- 0:00:55
598500 -- (-1249.735) (-1242.868) (-1252.319) [-1253.156] * (-1251.387) [-1244.483] (-1244.211) (-1252.204) -- 0:00:55
599000 -- (-1248.632) [-1247.271] (-1243.519) (-1248.856) * (-1244.899) (-1251.829) (-1249.698) [-1247.093] -- 0:00:54
599500 -- (-1248.392) (-1245.442) (-1248.151) [-1251.272] * [-1251.065] (-1246.049) (-1250.566) (-1248.552) -- 0:00:54
600000 -- (-1250.203) (-1250.566) [-1251.887] (-1248.141) * (-1256.148) (-1246.503) (-1245.208) [-1246.624] -- 0:00:54
Average standard deviation of split frequencies: 0.001177
600500 -- [-1248.595] (-1246.510) (-1245.379) (-1251.672) * (-1249.177) [-1244.167] (-1253.340) (-1250.272) -- 0:00:54
601000 -- (-1249.345) (-1246.956) (-1248.019) [-1250.162] * (-1247.464) [-1246.108] (-1245.680) (-1243.561) -- 0:00:54
601500 -- (-1248.015) [-1251.894] (-1247.928) (-1247.167) * (-1248.721) (-1248.923) [-1246.509] (-1255.476) -- 0:00:54
602000 -- (-1253.912) [-1243.947] (-1246.255) (-1250.798) * (-1243.149) [-1249.222] (-1254.260) (-1252.362) -- 0:00:54
602500 -- (-1247.559) [-1246.321] (-1247.117) (-1244.246) * [-1245.487] (-1259.475) (-1247.929) (-1245.247) -- 0:00:54
603000 -- [-1243.139] (-1249.853) (-1249.176) (-1250.662) * (-1245.605) [-1247.402] (-1250.209) (-1245.449) -- 0:00:54
603500 -- [-1248.241] (-1248.891) (-1246.181) (-1245.450) * [-1248.938] (-1245.275) (-1254.094) (-1244.334) -- 0:00:54
604000 -- (-1257.676) [-1244.851] (-1247.175) (-1245.681) * (-1249.472) (-1251.150) (-1251.472) [-1247.430] -- 0:00:54
604500 -- (-1248.598) [-1245.798] (-1247.022) (-1250.958) * (-1242.712) (-1250.579) (-1246.280) [-1242.780] -- 0:00:54
605000 -- (-1251.245) [-1248.424] (-1247.214) (-1252.763) * [-1244.540] (-1246.312) (-1249.377) (-1252.125) -- 0:00:54
Average standard deviation of split frequencies: 0.001167
605500 -- (-1248.317) (-1247.431) (-1251.488) [-1254.643] * (-1245.172) [-1242.037] (-1263.245) (-1244.460) -- 0:00:54
606000 -- (-1247.909) (-1242.491) (-1249.427) [-1251.108] * [-1250.019] (-1249.549) (-1253.204) (-1251.545) -- 0:00:53
606500 -- (-1249.574) (-1260.960) [-1259.407] (-1250.108) * (-1242.384) (-1249.387) (-1248.037) [-1248.191] -- 0:00:53
607000 -- (-1245.600) [-1248.951] (-1244.701) (-1248.006) * (-1245.868) (-1248.035) [-1248.792] (-1254.901) -- 0:00:53
607500 -- (-1247.119) (-1248.695) [-1248.421] (-1245.476) * (-1243.799) (-1245.709) [-1247.669] (-1253.431) -- 0:00:53
608000 -- (-1251.365) (-1249.400) (-1247.917) [-1246.870] * (-1247.298) (-1242.154) (-1249.261) [-1244.031] -- 0:00:53
608500 -- (-1251.729) [-1247.792] (-1249.135) (-1248.793) * (-1249.206) (-1252.269) [-1251.533] (-1258.449) -- 0:00:53
609000 -- (-1246.568) [-1252.292] (-1247.464) (-1247.491) * (-1247.084) [-1245.303] (-1244.285) (-1253.628) -- 0:00:53
609500 -- (-1249.046) (-1243.665) (-1246.461) [-1249.781] * (-1246.500) (-1243.519) [-1251.201] (-1251.532) -- 0:00:53
610000 -- (-1254.133) (-1243.905) (-1243.597) [-1247.938] * (-1249.035) [-1243.988] (-1251.752) (-1244.335) -- 0:00:53
Average standard deviation of split frequencies: 0.001158
610500 -- (-1249.036) [-1249.085] (-1248.080) (-1247.317) * [-1242.065] (-1256.138) (-1245.062) (-1243.315) -- 0:00:53
611000 -- (-1246.270) (-1247.064) (-1251.152) [-1248.550] * (-1253.622) (-1248.420) [-1246.085] (-1246.770) -- 0:00:53
611500 -- [-1250.489] (-1245.994) (-1252.277) (-1251.657) * (-1251.750) [-1246.599] (-1246.941) (-1253.382) -- 0:00:53
612000 -- [-1248.612] (-1250.928) (-1250.542) (-1249.081) * (-1247.158) [-1249.311] (-1243.660) (-1253.563) -- 0:00:53
612500 -- (-1246.031) (-1249.337) (-1255.642) [-1247.169] * [-1245.456] (-1247.775) (-1247.747) (-1247.606) -- 0:00:53
613000 -- (-1246.459) (-1246.669) (-1250.890) [-1249.398] * [-1251.391] (-1248.175) (-1247.124) (-1245.857) -- 0:00:53
613500 -- (-1249.959) (-1247.232) [-1250.828] (-1251.192) * (-1250.099) [-1249.721] (-1250.745) (-1250.516) -- 0:00:52
614000 -- [-1250.048] (-1246.373) (-1247.878) (-1245.294) * (-1247.913) (-1243.184) [-1246.203] (-1251.997) -- 0:00:52
614500 -- (-1248.108) [-1248.284] (-1249.130) (-1257.675) * (-1245.536) (-1255.903) [-1244.071] (-1257.437) -- 0:00:52
615000 -- [-1245.016] (-1245.971) (-1247.817) (-1248.808) * (-1250.338) (-1242.792) (-1251.273) [-1253.340] -- 0:00:52
Average standard deviation of split frequencies: 0.001148
615500 -- (-1247.320) [-1246.176] (-1245.923) (-1249.687) * (-1245.408) [-1243.745] (-1248.822) (-1252.492) -- 0:00:52
616000 -- [-1244.200] (-1247.143) (-1242.418) (-1246.222) * (-1248.230) (-1251.101) [-1250.708] (-1246.779) -- 0:00:52
616500 -- (-1246.250) (-1250.581) [-1243.188] (-1252.574) * (-1256.366) (-1248.838) [-1247.041] (-1245.997) -- 0:00:52
617000 -- (-1246.760) (-1250.987) (-1249.307) [-1242.942] * (-1249.539) (-1250.862) [-1240.716] (-1245.583) -- 0:00:52
617500 -- (-1246.610) (-1244.857) (-1244.572) [-1242.769] * (-1249.157) (-1244.042) [-1244.871] (-1244.151) -- 0:00:52
618000 -- (-1251.774) [-1249.850] (-1250.330) (-1249.314) * (-1248.047) (-1243.676) (-1253.792) [-1246.064] -- 0:00:52
618500 -- (-1249.740) [-1246.397] (-1243.739) (-1252.410) * (-1251.713) (-1242.906) (-1247.885) [-1245.434] -- 0:00:52
619000 -- (-1253.262) [-1245.821] (-1246.506) (-1245.250) * [-1248.820] (-1252.273) (-1247.878) (-1247.235) -- 0:00:52
619500 -- (-1247.411) [-1245.274] (-1244.290) (-1244.484) * (-1246.156) [-1251.410] (-1254.551) (-1248.571) -- 0:00:52
620000 -- (-1250.624) (-1246.152) [-1249.163] (-1248.262) * [-1250.112] (-1247.936) (-1265.770) (-1243.474) -- 0:00:52
Average standard deviation of split frequencies: 0.001139
620500 -- (-1250.846) (-1249.433) [-1245.163] (-1253.772) * (-1245.235) (-1242.077) (-1248.617) [-1250.473] -- 0:00:51
621000 -- (-1248.584) (-1249.254) [-1248.730] (-1246.779) * (-1244.101) (-1246.645) (-1251.981) [-1244.510] -- 0:00:51
621500 -- (-1248.758) [-1244.895] (-1253.632) (-1246.699) * (-1245.726) (-1244.026) (-1249.800) [-1243.448] -- 0:00:51
622000 -- (-1250.529) [-1244.696] (-1250.872) (-1249.416) * (-1247.028) (-1244.698) (-1243.612) [-1246.062] -- 0:00:51
622500 -- (-1248.297) [-1246.268] (-1247.901) (-1247.894) * (-1242.034) (-1252.259) (-1254.683) [-1246.554] -- 0:00:51
623000 -- (-1245.201) (-1250.051) [-1247.080] (-1247.636) * (-1246.517) (-1243.577) (-1242.845) [-1248.992] -- 0:00:51
623500 -- (-1250.084) (-1253.832) (-1253.279) [-1243.940] * [-1245.073] (-1246.256) (-1248.860) (-1246.219) -- 0:00:51
624000 -- (-1244.188) (-1249.295) (-1253.373) [-1246.090] * [-1244.963] (-1250.434) (-1250.360) (-1247.739) -- 0:00:51
624500 -- (-1249.238) (-1248.880) (-1251.922) [-1248.138] * [-1247.861] (-1244.845) (-1245.375) (-1249.120) -- 0:00:51
625000 -- (-1246.644) (-1250.733) (-1255.153) [-1242.668] * (-1243.470) (-1252.645) (-1245.725) [-1245.144] -- 0:00:51
Average standard deviation of split frequencies: 0.001130
625500 -- (-1248.119) [-1245.876] (-1246.647) (-1247.873) * (-1248.750) (-1248.606) (-1245.983) [-1248.307] -- 0:00:51
626000 -- (-1248.413) [-1246.409] (-1254.302) (-1246.631) * [-1245.770] (-1250.240) (-1244.121) (-1244.840) -- 0:00:51
626500 -- [-1244.711] (-1247.446) (-1242.877) (-1247.327) * (-1246.430) (-1253.343) [-1245.946] (-1255.924) -- 0:00:51
627000 -- [-1248.005] (-1247.862) (-1246.679) (-1244.997) * (-1249.386) [-1247.509] (-1244.520) (-1247.886) -- 0:00:51
627500 -- (-1248.771) (-1244.627) [-1250.178] (-1245.768) * (-1246.462) (-1250.623) [-1247.557] (-1247.320) -- 0:00:51
628000 -- (-1248.522) (-1247.120) (-1248.637) [-1248.785] * (-1249.580) [-1245.771] (-1246.311) (-1251.020) -- 0:00:50
628500 -- (-1243.105) [-1242.450] (-1244.755) (-1249.235) * (-1244.456) [-1249.293] (-1244.406) (-1254.102) -- 0:00:50
629000 -- (-1250.042) (-1246.723) [-1247.757] (-1252.808) * (-1244.365) (-1250.915) [-1249.959] (-1250.905) -- 0:00:50
629500 -- [-1247.939] (-1252.562) (-1244.066) (-1252.923) * (-1248.265) (-1254.173) [-1251.678] (-1248.348) -- 0:00:50
630000 -- [-1249.911] (-1254.836) (-1249.126) (-1248.162) * (-1250.906) (-1253.349) (-1243.236) [-1249.466] -- 0:00:50
Average standard deviation of split frequencies: 0.001121
630500 -- (-1249.417) [-1245.759] (-1246.720) (-1261.095) * [-1247.491] (-1245.762) (-1249.377) (-1243.095) -- 0:00:50
631000 -- (-1243.100) (-1258.801) (-1245.298) [-1244.484] * [-1246.603] (-1244.669) (-1245.239) (-1245.452) -- 0:00:50
631500 -- (-1250.510) [-1247.919] (-1250.724) (-1245.669) * (-1252.088) (-1252.130) [-1248.851] (-1246.376) -- 0:00:50
632000 -- [-1247.476] (-1251.663) (-1251.423) (-1251.080) * [-1250.415] (-1252.376) (-1251.725) (-1251.277) -- 0:00:50
632500 -- [-1250.338] (-1251.920) (-1247.000) (-1253.778) * (-1247.553) (-1246.818) (-1245.494) [-1251.188] -- 0:00:50
633000 -- (-1251.601) [-1248.669] (-1250.023) (-1251.823) * (-1253.186) (-1255.553) (-1245.198) [-1246.199] -- 0:00:50
633500 -- (-1244.617) [-1248.830] (-1244.393) (-1244.759) * (-1244.393) [-1251.492] (-1246.737) (-1247.563) -- 0:00:50
634000 -- [-1244.768] (-1248.189) (-1254.459) (-1251.474) * (-1247.159) (-1249.458) [-1253.121] (-1246.638) -- 0:00:50
634500 -- [-1249.875] (-1249.865) (-1248.290) (-1247.172) * (-1248.819) (-1252.396) [-1251.611] (-1252.262) -- 0:00:50
635000 -- (-1245.798) (-1248.455) (-1244.431) [-1242.948] * (-1255.216) (-1246.305) (-1256.009) [-1251.302] -- 0:00:50
Average standard deviation of split frequencies: 0.001112
635500 -- (-1253.919) [-1247.402] (-1247.643) (-1248.460) * (-1249.829) [-1240.491] (-1255.307) (-1251.023) -- 0:00:49
636000 -- (-1244.082) [-1244.797] (-1256.421) (-1250.267) * (-1253.414) (-1244.624) [-1245.275] (-1254.707) -- 0:00:49
636500 -- (-1240.591) [-1245.603] (-1252.200) (-1245.067) * (-1247.523) (-1253.208) [-1246.599] (-1256.523) -- 0:00:49
637000 -- (-1246.502) (-1246.718) (-1252.015) [-1249.082] * (-1243.703) (-1252.037) (-1246.740) [-1249.265] -- 0:00:49
637500 -- (-1251.973) [-1243.925] (-1249.893) (-1251.845) * (-1246.619) (-1245.161) [-1249.698] (-1244.492) -- 0:00:49
638000 -- (-1248.463) [-1243.857] (-1249.792) (-1253.778) * (-1248.612) (-1245.792) [-1246.810] (-1243.963) -- 0:00:49
638500 -- (-1242.841) [-1248.160] (-1242.631) (-1249.354) * [-1244.919] (-1246.437) (-1251.336) (-1252.084) -- 0:00:49
639000 -- (-1249.172) (-1244.356) (-1256.190) [-1251.086] * [-1247.465] (-1247.911) (-1245.478) (-1247.310) -- 0:00:49
639500 -- (-1255.126) (-1243.207) (-1255.629) [-1254.679] * (-1250.159) (-1244.912) (-1250.944) [-1246.964] -- 0:00:49
640000 -- (-1250.676) (-1243.541) (-1256.753) [-1244.703] * [-1244.308] (-1249.044) (-1245.232) (-1248.562) -- 0:00:49
Average standard deviation of split frequencies: 0.001104
640500 -- (-1255.557) [-1249.880] (-1243.017) (-1252.149) * (-1248.344) [-1247.971] (-1243.470) (-1250.559) -- 0:00:49
641000 -- (-1258.616) [-1247.081] (-1248.293) (-1249.334) * (-1247.494) (-1248.386) (-1248.566) [-1246.540] -- 0:00:49
641500 -- (-1246.611) (-1248.369) [-1246.243] (-1244.403) * (-1255.645) (-1248.341) [-1244.362] (-1246.300) -- 0:00:49
642000 -- (-1247.835) [-1247.965] (-1245.253) (-1247.667) * (-1246.154) (-1250.883) [-1242.026] (-1249.203) -- 0:00:49
642500 -- (-1247.320) (-1256.570) [-1244.504] (-1250.655) * (-1248.929) (-1248.934) (-1245.122) [-1243.809] -- 0:00:48
643000 -- (-1241.392) (-1251.492) [-1250.915] (-1250.255) * (-1245.843) (-1244.372) (-1250.223) [-1244.858] -- 0:00:48
643500 -- (-1247.328) [-1250.480] (-1247.744) (-1253.258) * [-1246.220] (-1249.205) (-1247.344) (-1243.825) -- 0:00:48
644000 -- (-1245.866) [-1244.623] (-1245.612) (-1244.344) * [-1251.706] (-1246.210) (-1242.968) (-1246.450) -- 0:00:48
644500 -- (-1252.460) (-1256.021) (-1242.407) [-1240.881] * (-1259.666) (-1247.478) [-1249.296] (-1246.605) -- 0:00:48
645000 -- (-1240.794) (-1246.499) [-1246.640] (-1245.515) * [-1246.619] (-1246.734) (-1242.187) (-1254.585) -- 0:00:48
Average standard deviation of split frequencies: 0.001095
645500 -- (-1253.222) [-1243.761] (-1254.579) (-1258.747) * (-1251.689) [-1248.204] (-1248.338) (-1259.443) -- 0:00:48
646000 -- (-1247.667) (-1248.026) (-1249.115) [-1250.542] * (-1247.917) (-1256.375) [-1242.004] (-1252.976) -- 0:00:48
646500 -- (-1247.422) [-1244.951] (-1257.057) (-1246.948) * [-1252.223] (-1254.755) (-1246.591) (-1254.921) -- 0:00:48
647000 -- (-1247.298) (-1245.417) [-1253.221] (-1243.448) * [-1249.245] (-1252.533) (-1243.903) (-1252.474) -- 0:00:48
647500 -- (-1244.554) (-1247.632) (-1248.254) [-1242.743] * (-1247.174) (-1248.092) [-1243.570] (-1256.483) -- 0:00:48
648000 -- (-1248.716) (-1249.033) (-1243.769) [-1248.184] * (-1251.721) (-1248.795) [-1246.549] (-1254.467) -- 0:00:48
648500 -- (-1243.952) (-1251.240) (-1243.540) [-1243.485] * (-1250.153) (-1259.642) (-1248.505) [-1248.899] -- 0:00:48
649000 -- [-1244.012] (-1243.560) (-1247.085) (-1251.853) * (-1248.131) [-1249.145] (-1247.438) (-1251.067) -- 0:00:48
649500 -- (-1246.782) (-1247.540) (-1244.351) [-1248.925] * (-1246.856) (-1249.307) [-1246.163] (-1247.720) -- 0:00:48
650000 -- (-1251.529) (-1247.576) [-1250.630] (-1247.667) * (-1250.597) (-1247.063) [-1243.283] (-1252.110) -- 0:00:47
Average standard deviation of split frequencies: 0.001087
650500 -- (-1246.925) [-1244.938] (-1252.179) (-1251.077) * [-1247.193] (-1252.653) (-1247.715) (-1247.984) -- 0:00:47
651000 -- [-1244.588] (-1248.863) (-1246.436) (-1250.391) * (-1245.535) (-1249.390) [-1247.650] (-1248.668) -- 0:00:47
651500 -- (-1245.797) [-1251.255] (-1246.244) (-1252.960) * (-1248.398) (-1253.189) (-1245.914) [-1245.245] -- 0:00:47
652000 -- [-1248.203] (-1245.832) (-1250.648) (-1255.243) * (-1252.292) (-1248.067) [-1243.756] (-1247.082) -- 0:00:47
652500 -- [-1245.521] (-1250.986) (-1245.945) (-1245.253) * (-1251.752) (-1245.282) (-1244.885) [-1245.989] -- 0:00:47
653000 -- (-1253.318) (-1245.423) [-1245.792] (-1245.807) * (-1250.775) [-1244.654] (-1252.947) (-1245.985) -- 0:00:47
653500 -- (-1246.975) (-1247.177) (-1251.684) [-1241.702] * (-1255.957) [-1245.290] (-1246.696) (-1255.695) -- 0:00:47
654000 -- (-1253.202) [-1244.578] (-1251.242) (-1247.693) * (-1248.603) (-1245.504) [-1244.501] (-1251.542) -- 0:00:47
654500 -- (-1262.148) [-1243.837] (-1250.158) (-1250.083) * (-1244.285) (-1247.309) [-1248.106] (-1253.520) -- 0:00:46
655000 -- (-1254.835) [-1245.030] (-1246.167) (-1246.575) * [-1242.512] (-1248.992) (-1247.874) (-1249.882) -- 0:00:47
Average standard deviation of split frequencies: 0.001078
655500 -- (-1249.999) [-1245.886] (-1249.303) (-1253.921) * (-1251.019) (-1264.855) [-1245.199] (-1246.035) -- 0:00:47
656000 -- (-1250.154) (-1254.134) (-1253.774) [-1241.167] * [-1246.725] (-1264.525) (-1249.381) (-1244.091) -- 0:00:47
656500 -- (-1246.668) (-1253.956) [-1250.393] (-1254.877) * (-1247.690) (-1251.400) (-1249.358) [-1248.543] -- 0:00:47
657000 -- (-1253.782) (-1247.904) (-1245.694) [-1249.752] * (-1245.909) (-1255.556) (-1242.352) [-1249.272] -- 0:00:46
657500 -- (-1254.793) (-1251.425) (-1244.727) [-1244.081] * (-1250.460) (-1248.793) (-1247.912) [-1255.610] -- 0:00:46
658000 -- (-1250.062) (-1251.450) [-1244.952] (-1248.312) * (-1250.867) (-1253.088) [-1247.504] (-1247.883) -- 0:00:46
658500 -- [-1249.984] (-1253.403) (-1250.357) (-1248.737) * [-1249.015] (-1247.856) (-1245.937) (-1253.689) -- 0:00:46
659000 -- (-1254.332) [-1255.489] (-1245.337) (-1247.903) * (-1253.432) [-1249.732] (-1243.428) (-1256.769) -- 0:00:46
659500 -- (-1246.053) (-1249.176) (-1245.408) [-1245.152] * (-1249.296) [-1242.168] (-1246.954) (-1253.076) -- 0:00:46
660000 -- (-1253.210) (-1250.668) [-1243.836] (-1247.957) * [-1248.937] (-1243.986) (-1255.290) (-1256.501) -- 0:00:46
Average standard deviation of split frequencies: 0.001070
660500 -- (-1247.746) (-1247.794) (-1252.276) [-1247.169] * [-1250.205] (-1243.175) (-1245.569) (-1255.315) -- 0:00:46
661000 -- (-1249.350) (-1252.237) (-1247.380) [-1243.587] * (-1251.264) (-1245.957) [-1244.624] (-1251.859) -- 0:00:46
661500 -- (-1247.274) (-1244.667) (-1256.924) [-1245.169] * (-1251.848) (-1251.503) (-1244.275) [-1246.459] -- 0:00:46
662000 -- (-1253.146) (-1249.903) (-1256.354) [-1245.492] * (-1254.953) (-1247.126) [-1241.134] (-1253.594) -- 0:00:46
662500 -- (-1249.491) [-1246.277] (-1249.135) (-1246.316) * [-1251.945] (-1245.136) (-1244.034) (-1256.196) -- 0:00:46
663000 -- (-1251.854) (-1244.083) [-1247.345] (-1253.171) * [-1251.060] (-1244.992) (-1242.919) (-1250.032) -- 0:00:46
663500 -- (-1255.661) [-1247.293] (-1250.751) (-1246.953) * (-1249.449) [-1250.197] (-1242.662) (-1250.426) -- 0:00:46
664000 -- (-1250.095) (-1245.399) [-1247.895] (-1245.424) * (-1252.982) [-1244.577] (-1246.822) (-1248.141) -- 0:00:46
664500 -- (-1245.353) [-1247.272] (-1251.368) (-1252.362) * (-1248.222) [-1243.438] (-1244.625) (-1251.094) -- 0:00:45
665000 -- (-1251.192) [-1244.977] (-1246.899) (-1252.868) * [-1247.686] (-1252.750) (-1244.860) (-1254.993) -- 0:00:45
Average standard deviation of split frequencies: 0.001062
665500 -- (-1244.819) (-1255.220) [-1242.359] (-1250.933) * (-1253.189) (-1257.273) [-1243.860] (-1251.855) -- 0:00:45
666000 -- (-1246.546) (-1248.196) (-1250.770) [-1247.002] * [-1254.361] (-1265.080) (-1243.410) (-1259.282) -- 0:00:45
666500 -- [-1243.180] (-1247.260) (-1246.428) (-1246.184) * (-1245.979) [-1252.983] (-1245.317) (-1254.721) -- 0:00:45
667000 -- (-1250.052) (-1247.903) [-1248.711] (-1253.599) * (-1247.165) (-1248.929) [-1241.980] (-1247.417) -- 0:00:45
667500 -- [-1253.806] (-1255.686) (-1248.852) (-1250.202) * (-1247.784) (-1249.663) (-1243.971) [-1245.001] -- 0:00:45
668000 -- (-1245.692) (-1247.278) (-1255.969) [-1249.110] * (-1255.545) (-1251.598) [-1246.692] (-1247.514) -- 0:00:45
668500 -- (-1249.697) [-1250.096] (-1247.066) (-1250.268) * (-1248.702) [-1246.386] (-1245.293) (-1243.036) -- 0:00:45
669000 -- (-1245.634) (-1253.180) (-1244.544) [-1248.402] * (-1247.308) (-1247.212) [-1248.658] (-1261.714) -- 0:00:45
669500 -- [-1245.320] (-1249.360) (-1249.702) (-1247.082) * (-1247.333) (-1247.060) [-1248.275] (-1251.129) -- 0:00:44
670000 -- (-1250.370) (-1253.329) [-1253.791] (-1249.785) * [-1243.733] (-1247.300) (-1249.730) (-1255.455) -- 0:00:45
Average standard deviation of split frequencies: 0.001054
670500 -- (-1245.117) [-1247.152] (-1248.015) (-1246.473) * (-1247.919) (-1244.728) (-1243.055) [-1248.123] -- 0:00:45
671000 -- (-1244.988) (-1256.780) (-1254.829) [-1246.909] * [-1245.013] (-1248.053) (-1244.437) (-1245.366) -- 0:00:45
671500 -- (-1245.581) (-1251.278) (-1250.183) [-1244.025] * (-1249.833) [-1242.352] (-1245.376) (-1248.583) -- 0:00:45
672000 -- (-1245.572) (-1240.545) (-1244.774) [-1242.208] * [-1244.562] (-1247.636) (-1253.618) (-1247.715) -- 0:00:44
672500 -- (-1257.250) (-1242.110) [-1251.991] (-1245.498) * [-1247.032] (-1248.002) (-1251.639) (-1248.955) -- 0:00:44
673000 -- [-1243.718] (-1248.574) (-1246.781) (-1249.792) * [-1245.153] (-1257.491) (-1248.989) (-1253.975) -- 0:00:44
673500 -- (-1245.283) [-1248.421] (-1247.734) (-1247.738) * (-1250.691) [-1248.422] (-1251.274) (-1252.118) -- 0:00:44
674000 -- (-1248.851) (-1247.753) (-1246.441) [-1243.387] * (-1254.696) [-1250.238] (-1244.119) (-1251.245) -- 0:00:44
674500 -- (-1247.205) (-1245.898) [-1249.390] (-1255.717) * [-1250.698] (-1248.449) (-1245.719) (-1251.845) -- 0:00:44
675000 -- (-1249.607) [-1245.493] (-1247.996) (-1251.006) * [-1255.520] (-1254.756) (-1245.178) (-1248.460) -- 0:00:44
Average standard deviation of split frequencies: 0.001046
675500 -- (-1249.097) (-1247.994) [-1247.258] (-1249.020) * (-1243.977) (-1250.342) (-1246.759) [-1246.958] -- 0:00:44
676000 -- [-1245.046] (-1253.014) (-1244.311) (-1247.856) * (-1244.808) (-1246.672) (-1252.040) [-1247.114] -- 0:00:44
676500 -- (-1247.248) [-1244.933] (-1247.125) (-1248.016) * (-1250.072) (-1246.593) (-1253.158) [-1245.447] -- 0:00:43
677000 -- (-1251.341) (-1250.303) [-1252.877] (-1246.727) * (-1242.993) (-1252.723) (-1252.434) [-1245.132] -- 0:00:43
677500 -- [-1248.199] (-1244.837) (-1252.540) (-1249.326) * (-1244.647) [-1249.973] (-1251.377) (-1253.718) -- 0:00:44
678000 -- (-1249.941) (-1253.822) (-1245.070) [-1251.977] * (-1251.524) [-1248.542] (-1253.731) (-1252.479) -- 0:00:44
678500 -- [-1244.081] (-1252.711) (-1247.818) (-1245.217) * (-1253.609) (-1253.770) (-1253.898) [-1253.230] -- 0:00:44
679000 -- [-1252.821] (-1248.600) (-1247.452) (-1252.105) * (-1252.027) (-1251.698) (-1254.211) [-1247.741] -- 0:00:43
679500 -- (-1247.667) (-1250.673) [-1245.666] (-1246.867) * [-1244.127] (-1254.582) (-1254.539) (-1250.780) -- 0:00:43
680000 -- [-1247.325] (-1244.986) (-1251.391) (-1244.090) * (-1242.762) [-1249.475] (-1254.979) (-1246.052) -- 0:00:43
Average standard deviation of split frequencies: 0.000693
680500 -- (-1250.770) [-1242.494] (-1252.615) (-1247.936) * (-1249.657) (-1249.871) [-1250.155] (-1242.949) -- 0:00:43
681000 -- [-1248.154] (-1250.355) (-1246.488) (-1248.192) * (-1253.618) (-1247.110) [-1247.427] (-1248.436) -- 0:00:43
681500 -- (-1246.785) (-1251.594) (-1247.611) [-1244.823] * (-1255.500) [-1246.521] (-1251.976) (-1254.121) -- 0:00:43
682000 -- (-1244.592) (-1243.377) (-1257.686) [-1243.445] * [-1243.195] (-1246.507) (-1252.254) (-1254.642) -- 0:00:43
682500 -- (-1248.351) [-1243.728] (-1244.721) (-1249.723) * [-1247.840] (-1254.040) (-1246.599) (-1248.954) -- 0:00:43
683000 -- (-1245.453) [-1245.775] (-1247.120) (-1247.244) * [-1248.678] (-1250.061) (-1249.569) (-1247.358) -- 0:00:43
683500 -- [-1243.550] (-1241.926) (-1253.243) (-1255.645) * (-1246.003) (-1249.094) (-1243.771) [-1247.335] -- 0:00:43
684000 -- [-1245.217] (-1243.153) (-1247.611) (-1244.470) * (-1249.510) (-1252.482) [-1245.265] (-1243.564) -- 0:00:42
684500 -- (-1244.244) [-1243.157] (-1247.062) (-1245.559) * (-1252.258) (-1248.489) (-1243.821) [-1247.872] -- 0:00:43
685000 -- (-1256.508) (-1249.626) (-1249.091) [-1241.650] * (-1252.829) (-1250.331) [-1245.902] (-1245.192) -- 0:00:43
Average standard deviation of split frequencies: 0.000687
685500 -- (-1246.020) (-1250.155) (-1248.897) [-1249.094] * [-1251.615] (-1255.536) (-1245.333) (-1252.531) -- 0:00:43
686000 -- [-1253.331] (-1246.567) (-1242.478) (-1247.514) * (-1255.755) (-1250.300) [-1243.421] (-1247.947) -- 0:00:43
686500 -- [-1245.422] (-1249.133) (-1247.979) (-1246.813) * (-1247.860) (-1251.080) (-1245.643) [-1244.992] -- 0:00:42
687000 -- (-1250.740) (-1253.343) [-1250.407] (-1250.181) * [-1247.250] (-1244.786) (-1244.818) (-1247.467) -- 0:00:42
687500 -- (-1248.008) (-1248.063) (-1251.624) [-1251.842] * (-1249.718) (-1244.632) (-1246.173) [-1245.179] -- 0:00:42
688000 -- (-1252.859) (-1243.176) (-1246.944) [-1245.616] * (-1248.438) (-1252.634) (-1245.442) [-1242.720] -- 0:00:42
688500 -- (-1245.713) (-1246.372) (-1246.613) [-1247.548] * (-1251.902) (-1247.802) [-1247.745] (-1245.146) -- 0:00:42
689000 -- (-1248.396) (-1244.191) (-1246.141) [-1246.018] * (-1248.829) (-1251.620) (-1251.060) [-1247.989] -- 0:00:42
689500 -- (-1247.160) (-1247.899) [-1249.164] (-1244.425) * [-1244.083] (-1253.099) (-1250.268) (-1246.142) -- 0:00:42
690000 -- (-1247.551) (-1248.620) (-1245.357) [-1243.036] * [-1246.439] (-1255.310) (-1249.629) (-1246.447) -- 0:00:42
Average standard deviation of split frequencies: 0.001024
690500 -- [-1246.333] (-1246.367) (-1248.919) (-1245.645) * (-1242.564) (-1250.952) [-1246.555] (-1250.754) -- 0:00:42
691000 -- (-1248.273) [-1245.077] (-1248.588) (-1244.340) * [-1246.208] (-1251.806) (-1253.237) (-1249.564) -- 0:00:42
691500 -- (-1246.242) (-1248.968) (-1252.501) [-1247.005] * (-1241.344) (-1251.041) (-1250.305) [-1246.085] -- 0:00:42
692000 -- (-1246.110) (-1251.049) (-1253.899) [-1244.616] * [-1249.869] (-1252.474) (-1248.872) (-1242.882) -- 0:00:42
692500 -- [-1244.512] (-1250.842) (-1243.385) (-1253.088) * (-1245.308) (-1247.225) (-1255.127) [-1242.720] -- 0:00:42
693000 -- (-1247.030) (-1247.441) [-1244.132] (-1253.134) * (-1254.142) (-1250.742) (-1249.129) [-1249.300] -- 0:00:42
693500 -- (-1247.678) [-1243.894] (-1247.502) (-1253.619) * (-1244.026) (-1254.571) (-1255.361) [-1246.242] -- 0:00:41
694000 -- (-1247.852) (-1243.973) [-1245.704] (-1242.749) * [-1243.036] (-1254.596) (-1262.753) (-1245.128) -- 0:00:41
694500 -- [-1247.140] (-1249.250) (-1248.059) (-1246.350) * (-1247.681) [-1250.175] (-1250.975) (-1245.665) -- 0:00:41
695000 -- [-1245.754] (-1248.407) (-1247.218) (-1246.693) * (-1252.800) [-1246.357] (-1254.181) (-1245.480) -- 0:00:41
Average standard deviation of split frequencies: 0.001016
695500 -- (-1251.471) [-1243.986] (-1252.703) (-1247.823) * (-1249.771) (-1244.604) (-1254.191) [-1252.251] -- 0:00:41
696000 -- [-1252.361] (-1246.342) (-1249.575) (-1253.663) * (-1249.105) (-1248.425) (-1256.452) [-1244.000] -- 0:00:41
696500 -- [-1251.937] (-1261.036) (-1251.356) (-1247.331) * (-1249.255) [-1241.484] (-1249.278) (-1247.872) -- 0:00:41
697000 -- [-1244.035] (-1248.913) (-1252.132) (-1247.779) * (-1250.433) (-1243.233) (-1253.894) [-1245.533] -- 0:00:41
697500 -- (-1248.455) (-1251.571) [-1249.265] (-1249.441) * (-1244.869) [-1248.508] (-1244.493) (-1247.027) -- 0:00:41
698000 -- [-1250.412] (-1240.843) (-1255.751) (-1248.364) * [-1246.102] (-1248.902) (-1245.255) (-1248.918) -- 0:00:41
698500 -- (-1248.640) (-1246.884) (-1253.147) [-1245.511] * [-1244.839] (-1248.562) (-1245.950) (-1249.097) -- 0:00:41
699000 -- (-1248.510) [-1247.969] (-1253.545) (-1246.148) * (-1241.560) [-1243.528] (-1250.057) (-1248.288) -- 0:00:41
699500 -- [-1247.068] (-1249.052) (-1248.100) (-1246.979) * [-1245.026] (-1247.084) (-1247.710) (-1249.229) -- 0:00:41
700000 -- (-1244.640) (-1244.651) [-1248.968] (-1246.819) * (-1253.926) [-1246.822] (-1254.641) (-1251.691) -- 0:00:41
Average standard deviation of split frequencies: 0.000673
700500 -- (-1248.915) [-1244.593] (-1250.045) (-1255.465) * (-1244.804) [-1244.181] (-1243.873) (-1248.587) -- 0:00:41
701000 -- (-1251.047) (-1243.087) [-1244.828] (-1244.035) * (-1250.456) (-1251.568) [-1242.960] (-1256.422) -- 0:00:40
701500 -- (-1245.120) [-1253.116] (-1255.583) (-1245.633) * (-1249.194) (-1250.283) [-1249.198] (-1255.856) -- 0:00:40
702000 -- (-1254.066) (-1249.003) (-1249.954) [-1242.152] * (-1256.001) (-1250.361) [-1244.864] (-1249.915) -- 0:00:40
702500 -- (-1252.323) (-1245.216) [-1249.263] (-1245.085) * [-1250.019] (-1246.688) (-1249.608) (-1255.943) -- 0:00:40
703000 -- [-1250.733] (-1245.493) (-1248.114) (-1249.806) * [-1243.072] (-1247.845) (-1247.089) (-1261.293) -- 0:00:40
703500 -- [-1246.259] (-1243.911) (-1243.815) (-1249.505) * (-1243.055) (-1246.152) [-1249.685] (-1249.044) -- 0:00:40
704000 -- (-1247.997) (-1248.186) (-1245.890) [-1251.041] * [-1245.515] (-1252.127) (-1252.880) (-1246.867) -- 0:00:40
704500 -- (-1246.534) [-1249.230] (-1246.115) (-1249.151) * (-1242.745) (-1241.534) [-1248.194] (-1250.227) -- 0:00:40
705000 -- (-1253.640) [-1248.502] (-1247.543) (-1250.574) * (-1243.948) (-1244.526) (-1242.764) [-1248.745] -- 0:00:40
Average standard deviation of split frequencies: 0.001002
705500 -- (-1247.727) (-1247.181) (-1255.685) [-1244.227] * (-1257.363) [-1251.205] (-1244.893) (-1249.195) -- 0:00:40
706000 -- (-1249.566) (-1247.870) (-1242.146) [-1247.361] * (-1250.111) (-1250.830) (-1245.549) [-1247.655] -- 0:00:39
706500 -- (-1248.520) (-1249.166) [-1245.963] (-1250.400) * (-1246.264) (-1247.435) (-1247.131) [-1246.443] -- 0:00:40
707000 -- [-1247.466] (-1246.682) (-1246.551) (-1254.276) * (-1247.479) [-1245.991] (-1246.593) (-1260.198) -- 0:00:40
707500 -- [-1250.794] (-1251.192) (-1245.047) (-1244.989) * [-1246.487] (-1251.940) (-1247.318) (-1249.097) -- 0:00:40
708000 -- [-1252.751] (-1249.406) (-1253.365) (-1248.069) * (-1251.200) [-1250.572] (-1261.303) (-1247.954) -- 0:00:40
708500 -- (-1249.717) (-1248.944) (-1253.723) [-1243.225] * (-1249.098) (-1246.735) [-1252.604] (-1248.390) -- 0:00:39
709000 -- (-1246.293) [-1246.406] (-1248.909) (-1245.448) * [-1252.610] (-1244.751) (-1251.778) (-1247.014) -- 0:00:39
709500 -- (-1246.725) (-1245.412) (-1250.864) [-1245.891] * [-1249.191] (-1257.762) (-1250.736) (-1243.546) -- 0:00:39
710000 -- [-1248.852] (-1248.624) (-1244.892) (-1248.576) * (-1249.071) (-1254.561) [-1254.721] (-1246.936) -- 0:00:39
Average standard deviation of split frequencies: 0.000995
710500 -- (-1243.915) (-1247.066) (-1247.533) [-1242.880] * [-1250.884] (-1247.445) (-1252.496) (-1247.486) -- 0:00:39
711000 -- (-1244.811) (-1246.814) (-1243.234) [-1247.258] * (-1254.132) [-1246.766] (-1242.712) (-1244.284) -- 0:00:39
711500 -- [-1250.459] (-1246.790) (-1245.642) (-1242.617) * [-1248.534] (-1257.570) (-1246.691) (-1248.803) -- 0:00:39
712000 -- (-1247.040) (-1247.311) [-1245.853] (-1244.110) * (-1250.943) (-1243.289) [-1242.055] (-1247.501) -- 0:00:39
712500 -- (-1252.485) (-1247.269) (-1247.234) [-1249.524] * (-1250.106) [-1248.020] (-1245.782) (-1245.797) -- 0:00:39
713000 -- (-1250.862) [-1253.502] (-1245.381) (-1250.883) * (-1244.885) [-1242.685] (-1250.715) (-1253.109) -- 0:00:39
713500 -- [-1249.248] (-1248.958) (-1242.883) (-1252.332) * (-1245.022) (-1245.862) [-1248.426] (-1250.773) -- 0:00:39
714000 -- (-1246.437) (-1244.552) (-1250.772) [-1248.372] * [-1244.736] (-1252.727) (-1247.212) (-1247.448) -- 0:00:39
714500 -- (-1246.360) [-1247.176] (-1247.336) (-1244.437) * [-1242.559] (-1250.263) (-1249.822) (-1243.062) -- 0:00:39
715000 -- (-1246.007) [-1248.280] (-1245.902) (-1248.513) * (-1244.820) (-1245.228) (-1256.551) [-1244.756] -- 0:00:39
Average standard deviation of split frequencies: 0.000329
715500 -- [-1247.060] (-1249.909) (-1246.002) (-1246.316) * (-1250.048) [-1244.266] (-1245.005) (-1244.320) -- 0:00:38
716000 -- (-1245.584) (-1252.850) [-1254.584] (-1243.896) * (-1246.149) (-1247.534) [-1253.432] (-1244.909) -- 0:00:38
716500 -- (-1249.318) (-1256.804) (-1247.602) [-1246.066] * (-1252.167) (-1245.385) (-1244.653) [-1251.388] -- 0:00:38
717000 -- [-1246.794] (-1257.712) (-1250.597) (-1252.226) * [-1244.707] (-1251.177) (-1248.062) (-1242.666) -- 0:00:38
717500 -- (-1241.979) [-1245.992] (-1249.087) (-1258.235) * [-1245.796] (-1246.865) (-1246.436) (-1245.011) -- 0:00:38
718000 -- (-1247.078) (-1253.928) [-1243.044] (-1250.859) * [-1244.075] (-1244.028) (-1251.716) (-1243.341) -- 0:00:38
718500 -- (-1245.335) [-1246.096] (-1244.421) (-1249.393) * (-1245.055) (-1246.245) (-1254.011) [-1243.778] -- 0:00:38
719000 -- (-1245.189) (-1246.746) [-1245.873] (-1251.778) * [-1241.836] (-1252.649) (-1246.539) (-1259.813) -- 0:00:38
719500 -- [-1248.110] (-1249.750) (-1251.083) (-1250.979) * (-1249.387) (-1249.118) [-1248.405] (-1248.924) -- 0:00:38
720000 -- (-1243.463) [-1248.754] (-1246.346) (-1253.567) * (-1245.971) (-1256.397) (-1246.414) [-1247.989] -- 0:00:38
Average standard deviation of split frequencies: 0.000327
720500 -- (-1249.912) (-1255.644) (-1248.550) [-1247.108] * (-1248.604) (-1250.443) [-1240.304] (-1249.663) -- 0:00:38
721000 -- (-1246.518) (-1249.189) [-1245.224] (-1251.106) * [-1250.532] (-1250.658) (-1249.251) (-1248.734) -- 0:00:38
721500 -- (-1248.628) [-1247.265] (-1250.332) (-1251.543) * (-1252.427) (-1256.780) [-1251.091] (-1246.696) -- 0:00:38
722000 -- (-1250.435) [-1253.176] (-1246.175) (-1251.131) * [-1249.295] (-1254.183) (-1249.728) (-1248.279) -- 0:00:38
722500 -- (-1248.232) (-1247.141) [-1248.564] (-1248.525) * (-1245.428) [-1245.567] (-1246.868) (-1253.967) -- 0:00:38
723000 -- (-1248.976) (-1250.701) [-1245.454] (-1249.076) * [-1246.368] (-1250.538) (-1247.611) (-1253.154) -- 0:00:37
723500 -- (-1248.861) (-1244.290) (-1246.510) [-1252.093] * (-1247.275) [-1247.073] (-1245.259) (-1248.753) -- 0:00:37
724000 -- (-1247.258) (-1246.415) (-1246.290) [-1250.842] * (-1244.283) (-1249.825) (-1250.901) [-1250.721] -- 0:00:37
724500 -- [-1250.097] (-1250.257) (-1244.441) (-1249.804) * [-1246.800] (-1246.049) (-1251.747) (-1246.812) -- 0:00:37
725000 -- (-1248.816) (-1246.629) [-1242.131] (-1245.836) * (-1248.115) (-1250.686) [-1245.116] (-1245.089) -- 0:00:37
Average standard deviation of split frequencies: 0.000325
725500 -- (-1249.327) [-1245.304] (-1246.121) (-1246.431) * (-1249.181) (-1253.734) [-1246.667] (-1246.719) -- 0:00:37
726000 -- (-1244.232) [-1245.428] (-1251.866) (-1265.732) * (-1249.189) [-1248.909] (-1247.122) (-1248.783) -- 0:00:37
726500 -- (-1249.792) (-1246.334) (-1247.714) [-1248.842] * (-1249.262) (-1247.496) (-1246.736) [-1248.631] -- 0:00:37
727000 -- (-1246.681) (-1243.959) [-1243.397] (-1247.910) * (-1245.967) (-1243.391) (-1246.028) [-1245.787] -- 0:00:37
727500 -- (-1247.691) [-1247.132] (-1244.557) (-1251.956) * (-1255.817) (-1247.606) [-1243.861] (-1249.777) -- 0:00:37
728000 -- (-1247.812) (-1256.306) [-1244.496] (-1247.276) * [-1249.509] (-1244.822) (-1254.656) (-1250.176) -- 0:00:37
728500 -- [-1246.067] (-1249.206) (-1242.650) (-1251.796) * (-1248.297) (-1246.531) (-1247.491) [-1245.306] -- 0:00:37
729000 -- [-1250.642] (-1245.035) (-1245.605) (-1248.468) * [-1248.925] (-1255.396) (-1244.317) (-1250.217) -- 0:00:37
729500 -- (-1249.636) [-1252.386] (-1240.594) (-1250.101) * [-1246.383] (-1247.920) (-1245.578) (-1248.496) -- 0:00:37
730000 -- (-1248.666) (-1247.850) [-1249.118] (-1248.689) * (-1248.527) (-1255.445) (-1244.232) [-1248.039] -- 0:00:36
Average standard deviation of split frequencies: 0.000323
730500 -- (-1247.490) (-1250.810) (-1251.740) [-1254.681] * [-1252.023] (-1250.213) (-1246.186) (-1251.028) -- 0:00:36
731000 -- (-1245.034) (-1255.780) (-1248.402) [-1251.143] * [-1252.025] (-1245.760) (-1250.592) (-1245.007) -- 0:00:36
731500 -- (-1248.846) (-1243.210) (-1253.652) [-1249.270] * (-1245.059) [-1246.026] (-1248.772) (-1256.153) -- 0:00:37
732000 -- [-1249.718] (-1249.278) (-1247.614) (-1248.827) * (-1250.522) [-1246.650] (-1248.048) (-1244.387) -- 0:00:36
732500 -- (-1248.267) [-1253.838] (-1247.864) (-1251.137) * (-1246.214) (-1252.104) [-1241.925] (-1249.890) -- 0:00:36
733000 -- (-1247.734) [-1247.131] (-1246.830) (-1247.189) * (-1253.025) (-1253.208) [-1248.738] (-1250.151) -- 0:00:36
733500 -- [-1245.213] (-1249.122) (-1248.180) (-1249.680) * [-1251.204] (-1246.508) (-1251.057) (-1250.640) -- 0:00:36
734000 -- (-1243.736) (-1250.478) (-1247.227) [-1248.608] * (-1248.699) [-1245.175] (-1247.590) (-1251.348) -- 0:00:36
734500 -- [-1244.780] (-1248.355) (-1254.961) (-1256.879) * (-1250.092) (-1249.397) [-1244.420] (-1250.174) -- 0:00:36
735000 -- [-1243.382] (-1246.001) (-1250.265) (-1250.496) * (-1252.402) (-1246.463) [-1248.090] (-1249.941) -- 0:00:36
Average standard deviation of split frequencies: 0.000320
735500 -- (-1243.869) [-1243.138] (-1247.174) (-1243.987) * (-1249.323) (-1247.296) (-1251.012) [-1248.510] -- 0:00:36
736000 -- [-1241.960] (-1242.925) (-1247.283) (-1251.091) * [-1246.820] (-1248.187) (-1244.600) (-1247.169) -- 0:00:36
736500 -- (-1244.988) (-1247.298) [-1246.135] (-1247.017) * (-1254.466) (-1246.484) (-1246.089) [-1243.378] -- 0:00:36
737000 -- (-1246.170) [-1248.600] (-1247.548) (-1245.467) * [-1248.060] (-1244.076) (-1244.878) (-1250.243) -- 0:00:36
737500 -- (-1250.497) (-1252.010) (-1253.893) [-1246.906] * (-1253.790) [-1248.775] (-1248.374) (-1246.257) -- 0:00:36
738000 -- (-1256.637) [-1246.578] (-1251.910) (-1249.514) * (-1254.842) (-1251.184) (-1254.742) [-1245.669] -- 0:00:36
738500 -- (-1246.340) [-1244.041] (-1242.909) (-1248.180) * [-1246.735] (-1249.575) (-1253.489) (-1248.573) -- 0:00:36
739000 -- (-1251.736) [-1246.167] (-1244.378) (-1243.540) * [-1247.857] (-1251.062) (-1251.214) (-1242.307) -- 0:00:36
739500 -- (-1252.678) (-1245.399) [-1243.682] (-1247.009) * (-1245.306) (-1250.286) [-1244.068] (-1245.802) -- 0:00:35
740000 -- (-1246.856) (-1243.951) [-1242.643] (-1247.248) * [-1254.477] (-1241.511) (-1250.264) (-1251.247) -- 0:00:35
Average standard deviation of split frequencies: 0.000636
740500 -- (-1246.339) (-1246.780) [-1249.074] (-1244.034) * (-1251.053) (-1249.144) (-1246.179) [-1244.409] -- 0:00:35
741000 -- (-1252.308) (-1243.854) [-1248.715] (-1245.506) * (-1250.365) (-1248.688) [-1245.247] (-1250.544) -- 0:00:35
741500 -- [-1248.516] (-1243.112) (-1248.095) (-1253.365) * (-1245.925) (-1246.516) (-1246.886) [-1244.140] -- 0:00:35
742000 -- (-1249.103) (-1243.916) (-1254.498) [-1246.156] * (-1248.179) (-1243.750) [-1248.739] (-1248.261) -- 0:00:35
742500 -- (-1249.144) [-1247.820] (-1245.746) (-1255.299) * (-1245.366) [-1245.320] (-1249.714) (-1250.760) -- 0:00:35
743000 -- (-1252.752) [-1245.749] (-1249.532) (-1248.913) * (-1246.843) (-1245.117) (-1246.041) [-1241.400] -- 0:00:35
743500 -- (-1247.993) [-1243.771] (-1245.955) (-1253.613) * [-1250.070] (-1245.234) (-1252.749) (-1244.266) -- 0:00:35
744000 -- [-1246.426] (-1251.621) (-1250.916) (-1244.275) * (-1249.418) (-1249.400) (-1247.079) [-1247.399] -- 0:00:35
744500 -- (-1251.896) (-1242.068) [-1248.232] (-1254.903) * (-1248.642) (-1250.607) [-1247.108] (-1246.919) -- 0:00:35
745000 -- (-1251.901) (-1248.039) [-1247.341] (-1249.133) * (-1247.974) (-1254.555) (-1254.929) [-1253.831] -- 0:00:35
Average standard deviation of split frequencies: 0.000632
745500 -- (-1253.280) [-1242.968] (-1245.638) (-1246.685) * (-1247.695) (-1250.952) (-1247.964) [-1254.891] -- 0:00:35
746000 -- (-1253.558) [-1246.183] (-1244.811) (-1249.803) * (-1242.964) [-1248.812] (-1247.928) (-1252.437) -- 0:00:35
746500 -- (-1253.290) (-1248.783) (-1248.572) [-1248.263] * (-1247.751) (-1247.257) [-1246.163] (-1253.448) -- 0:00:34
747000 -- (-1247.385) (-1247.209) (-1244.605) [-1246.525] * (-1249.522) (-1256.854) (-1247.908) [-1248.980] -- 0:00:34
747500 -- (-1242.963) [-1247.931] (-1251.380) (-1250.642) * (-1242.715) [-1248.694] (-1250.879) (-1247.881) -- 0:00:34
748000 -- (-1242.475) (-1247.876) [-1244.297] (-1248.204) * [-1247.263] (-1252.537) (-1258.514) (-1244.976) -- 0:00:34
748500 -- (-1248.665) (-1250.115) (-1249.606) [-1246.845] * [-1242.361] (-1249.885) (-1256.191) (-1249.827) -- 0:00:34
749000 -- [-1248.509] (-1252.799) (-1251.126) (-1245.544) * [-1248.896] (-1247.633) (-1251.537) (-1247.961) -- 0:00:34
749500 -- (-1255.653) (-1250.906) [-1244.803] (-1244.666) * (-1254.096) (-1247.634) [-1250.382] (-1250.427) -- 0:00:34
750000 -- (-1258.707) (-1245.911) [-1248.135] (-1251.251) * (-1251.481) (-1246.676) (-1249.390) [-1254.966] -- 0:00:34
Average standard deviation of split frequencies: 0.000628
750500 -- (-1249.748) (-1252.432) (-1251.943) [-1252.596] * (-1257.368) (-1247.632) [-1249.767] (-1255.025) -- 0:00:34
751000 -- (-1245.136) [-1251.619] (-1251.132) (-1250.744) * (-1250.218) (-1258.819) [-1249.800] (-1249.048) -- 0:00:34
751500 -- (-1248.727) (-1248.364) [-1250.966] (-1246.156) * (-1249.616) [-1250.067] (-1247.625) (-1249.307) -- 0:00:34
752000 -- [-1243.505] (-1247.213) (-1249.090) (-1245.351) * [-1252.451] (-1242.463) (-1244.111) (-1249.192) -- 0:00:34
752500 -- (-1249.774) [-1245.897] (-1249.224) (-1250.382) * (-1246.970) (-1245.857) [-1247.694] (-1251.734) -- 0:00:34
753000 -- [-1247.149] (-1249.696) (-1253.250) (-1248.329) * (-1251.816) (-1249.868) (-1254.778) [-1248.243] -- 0:00:34
753500 -- (-1247.927) (-1247.481) (-1250.474) [-1246.318] * [-1247.253] (-1250.881) (-1258.600) (-1247.656) -- 0:00:34
754000 -- (-1244.740) (-1253.267) (-1245.202) [-1248.082] * (-1242.986) (-1248.884) [-1252.517] (-1248.742) -- 0:00:33
754500 -- (-1252.975) (-1253.677) (-1248.594) [-1247.226] * [-1247.133] (-1254.457) (-1258.643) (-1255.618) -- 0:00:33
755000 -- (-1246.743) (-1243.887) [-1246.167] (-1246.951) * (-1246.621) (-1250.703) (-1249.784) [-1247.847] -- 0:00:33
Average standard deviation of split frequencies: 0.000312
755500 -- (-1248.476) (-1243.937) (-1253.411) [-1250.952] * [-1245.067] (-1260.494) (-1252.347) (-1248.807) -- 0:00:33
756000 -- (-1249.833) [-1245.775] (-1247.246) (-1249.642) * (-1244.224) [-1245.647] (-1243.217) (-1250.749) -- 0:00:33
756500 -- (-1263.295) (-1249.063) (-1246.311) [-1252.780] * (-1245.107) [-1245.232] (-1244.371) (-1255.031) -- 0:00:33
757000 -- (-1252.821) (-1248.364) [-1247.343] (-1247.943) * (-1245.299) (-1250.630) [-1248.694] (-1242.334) -- 0:00:33
757500 -- (-1253.961) [-1242.576] (-1247.260) (-1248.337) * [-1244.196] (-1246.935) (-1248.176) (-1247.781) -- 0:00:33
758000 -- (-1252.788) [-1245.719] (-1245.807) (-1247.257) * (-1249.253) [-1250.730] (-1247.922) (-1255.116) -- 0:00:33
758500 -- (-1255.492) (-1254.321) [-1251.477] (-1249.002) * (-1250.932) (-1250.175) (-1245.134) [-1245.208] -- 0:00:33
759000 -- (-1247.630) [-1243.317] (-1252.385) (-1248.653) * (-1249.942) (-1246.201) (-1246.539) [-1245.649] -- 0:00:33
759500 -- (-1248.890) (-1246.068) [-1246.878] (-1246.992) * [-1249.112] (-1247.103) (-1247.623) (-1251.844) -- 0:00:33
760000 -- (-1250.019) (-1252.214) [-1244.626] (-1249.766) * (-1251.163) [-1243.844] (-1248.281) (-1245.333) -- 0:00:33
Average standard deviation of split frequencies: 0.000310
760500 -- (-1250.860) (-1247.572) [-1243.383] (-1251.765) * (-1247.614) (-1247.318) [-1241.083] (-1246.813) -- 0:00:33
761000 -- (-1251.324) (-1250.369) [-1242.711] (-1249.418) * (-1251.138) [-1244.822] (-1249.995) (-1246.791) -- 0:00:32
761500 -- (-1251.274) [-1246.591] (-1252.565) (-1248.583) * (-1246.539) [-1245.689] (-1250.877) (-1247.021) -- 0:00:32
762000 -- (-1250.578) (-1245.860) (-1245.021) [-1248.187] * (-1245.008) [-1248.519] (-1246.816) (-1251.238) -- 0:00:32
762500 -- (-1252.068) (-1249.919) (-1247.529) [-1246.816] * (-1247.490) (-1249.456) [-1250.321] (-1249.623) -- 0:00:32
763000 -- (-1251.064) (-1247.936) [-1250.018] (-1248.896) * [-1244.193] (-1253.274) (-1249.400) (-1252.919) -- 0:00:32
763500 -- (-1254.764) (-1248.743) (-1248.988) [-1250.012] * (-1245.744) [-1247.756] (-1249.151) (-1248.832) -- 0:00:32
764000 -- (-1244.919) (-1248.534) [-1248.823] (-1246.541) * (-1246.636) [-1250.701] (-1252.561) (-1251.908) -- 0:00:32
764500 -- (-1248.706) (-1245.920) [-1249.852] (-1256.392) * (-1248.745) (-1247.201) (-1251.354) [-1250.858] -- 0:00:32
765000 -- (-1256.869) [-1243.143] (-1243.907) (-1247.879) * (-1255.579) (-1248.972) [-1247.993] (-1256.968) -- 0:00:32
Average standard deviation of split frequencies: 0.000308
765500 -- (-1253.426) [-1244.918] (-1251.446) (-1254.873) * [-1250.245] (-1248.078) (-1247.060) (-1245.510) -- 0:00:32
766000 -- (-1248.525) (-1253.595) [-1243.659] (-1261.133) * [-1250.704] (-1250.619) (-1247.151) (-1247.376) -- 0:00:32
766500 -- (-1248.533) [-1248.439] (-1248.416) (-1249.617) * (-1247.951) (-1244.608) [-1246.341] (-1249.171) -- 0:00:32
767000 -- [-1247.676] (-1246.501) (-1248.638) (-1252.439) * (-1244.997) (-1245.262) [-1249.435] (-1249.381) -- 0:00:32
767500 -- (-1247.548) (-1245.096) (-1248.806) [-1244.646] * [-1247.752] (-1250.300) (-1250.398) (-1260.258) -- 0:00:32
768000 -- [-1245.690] (-1245.177) (-1245.655) (-1243.839) * (-1248.752) [-1246.444] (-1254.473) (-1251.206) -- 0:00:32
768500 -- (-1246.615) (-1245.132) [-1257.509] (-1245.423) * [-1243.742] (-1247.834) (-1253.757) (-1251.144) -- 0:00:31
769000 -- [-1249.616] (-1246.392) (-1245.429) (-1247.663) * [-1246.204] (-1256.747) (-1249.665) (-1251.049) -- 0:00:31
769500 -- (-1248.941) [-1254.628] (-1248.423) (-1247.448) * [-1243.717] (-1249.981) (-1247.497) (-1245.665) -- 0:00:31
770000 -- (-1254.028) (-1245.119) (-1246.125) [-1247.303] * [-1243.697] (-1245.210) (-1245.868) (-1245.662) -- 0:00:31
Average standard deviation of split frequencies: 0.000612
770500 -- (-1252.564) (-1248.905) [-1246.309] (-1250.251) * (-1250.429) [-1248.607] (-1245.118) (-1248.416) -- 0:00:31
771000 -- (-1245.446) (-1246.645) [-1245.962] (-1255.539) * (-1247.562) (-1248.918) [-1249.246] (-1250.072) -- 0:00:31
771500 -- (-1247.796) [-1249.084] (-1250.312) (-1257.860) * (-1247.842) (-1251.135) [-1251.353] (-1253.626) -- 0:00:31
772000 -- [-1244.802] (-1249.597) (-1252.266) (-1247.227) * (-1244.174) (-1253.026) (-1252.931) [-1251.658] -- 0:00:31
772500 -- (-1247.237) [-1243.221] (-1250.097) (-1249.421) * (-1244.415) (-1248.235) [-1249.558] (-1252.570) -- 0:00:31
773000 -- (-1246.501) (-1247.670) [-1244.139] (-1251.516) * (-1250.275) [-1248.163] (-1256.678) (-1246.440) -- 0:00:31
773500 -- (-1252.154) (-1247.930) [-1249.305] (-1251.418) * (-1246.503) (-1246.611) [-1248.207] (-1248.293) -- 0:00:31
774000 -- (-1245.995) (-1244.158) [-1247.245] (-1248.673) * (-1243.154) (-1246.277) [-1249.522] (-1252.674) -- 0:00:31
774500 -- [-1243.375] (-1246.454) (-1249.181) (-1250.708) * (-1247.398) (-1258.047) [-1244.092] (-1249.207) -- 0:00:31
775000 -- (-1250.339) [-1248.723] (-1247.402) (-1250.225) * (-1249.361) (-1257.721) (-1248.265) [-1245.489] -- 0:00:31
Average standard deviation of split frequencies: 0.000607
775500 -- (-1249.084) (-1248.160) [-1244.450] (-1246.072) * (-1244.346) (-1252.641) [-1246.524] (-1247.202) -- 0:00:30
776000 -- (-1251.101) (-1245.447) (-1250.370) [-1245.513] * [-1249.464] (-1249.587) (-1246.801) (-1260.200) -- 0:00:30
776500 -- (-1260.178) (-1242.677) [-1249.712] (-1245.736) * (-1249.143) (-1253.254) (-1244.882) [-1250.009] -- 0:00:30
777000 -- (-1258.603) (-1250.610) [-1248.117] (-1245.397) * (-1250.725) [-1248.677] (-1245.890) (-1244.653) -- 0:00:30
777500 -- (-1254.827) (-1254.366) (-1248.403) [-1246.817] * (-1251.892) (-1263.548) (-1246.079) [-1244.863] -- 0:00:30
778000 -- [-1246.838] (-1256.945) (-1245.247) (-1248.180) * (-1248.417) (-1255.143) [-1248.325] (-1249.114) -- 0:00:30
778500 -- [-1244.986] (-1247.494) (-1245.848) (-1246.101) * [-1246.667] (-1255.973) (-1247.617) (-1246.443) -- 0:00:30
779000 -- [-1253.137] (-1247.947) (-1247.744) (-1249.067) * (-1248.723) (-1246.494) [-1251.799] (-1248.190) -- 0:00:30
779500 -- (-1248.405) [-1248.154] (-1249.481) (-1250.859) * (-1244.856) [-1247.048] (-1246.358) (-1251.583) -- 0:00:30
780000 -- (-1246.489) (-1255.833) (-1248.493) [-1246.162] * (-1242.168) (-1245.399) (-1248.567) [-1240.627] -- 0:00:30
Average standard deviation of split frequencies: 0.000604
780500 -- [-1247.101] (-1249.345) (-1247.943) (-1246.743) * (-1246.817) (-1250.973) (-1254.457) [-1250.236] -- 0:00:30
781000 -- [-1244.048] (-1251.849) (-1251.187) (-1248.980) * (-1251.912) [-1245.987] (-1252.043) (-1247.135) -- 0:00:30
781500 -- (-1248.681) (-1256.426) (-1244.331) [-1247.897] * [-1249.282] (-1248.332) (-1255.192) (-1262.328) -- 0:00:30
782000 -- (-1251.138) (-1243.822) (-1255.238) [-1244.215] * (-1249.524) (-1247.399) [-1246.941] (-1245.799) -- 0:00:30
782500 -- (-1258.746) [-1249.278] (-1245.539) (-1252.362) * (-1250.141) [-1243.965] (-1243.667) (-1250.593) -- 0:00:30
783000 -- (-1254.092) [-1246.499] (-1240.263) (-1252.843) * (-1251.053) [-1248.302] (-1247.401) (-1247.298) -- 0:00:29
783500 -- (-1250.604) [-1243.700] (-1248.126) (-1248.255) * (-1249.411) (-1255.172) (-1248.680) [-1247.475] -- 0:00:29
784000 -- (-1251.043) (-1247.079) [-1242.692] (-1251.273) * (-1257.585) (-1260.672) [-1247.412] (-1249.367) -- 0:00:29
784500 -- (-1247.880) [-1247.851] (-1252.722) (-1248.534) * (-1251.373) [-1246.533] (-1242.882) (-1251.395) -- 0:00:29
785000 -- (-1246.394) [-1242.029] (-1247.619) (-1251.755) * (-1249.047) (-1253.077) (-1246.968) [-1248.038] -- 0:00:29
Average standard deviation of split frequencies: 0.000600
785500 -- (-1246.816) (-1247.753) [-1249.307] (-1247.488) * [-1245.998] (-1253.496) (-1252.434) (-1245.381) -- 0:00:29
786000 -- (-1246.921) (-1253.552) (-1245.979) [-1247.169] * (-1253.403) [-1255.704] (-1253.121) (-1250.095) -- 0:00:29
786500 -- (-1248.311) (-1247.456) (-1249.105) [-1250.332] * (-1246.691) (-1252.165) [-1247.516] (-1248.304) -- 0:00:29
787000 -- (-1247.574) (-1243.613) [-1254.771] (-1250.701) * (-1247.267) (-1250.163) (-1247.627) [-1245.072] -- 0:00:29
787500 -- (-1247.468) [-1242.047] (-1245.128) (-1249.339) * (-1250.654) (-1246.994) [-1249.205] (-1250.772) -- 0:00:29
788000 -- [-1242.659] (-1245.695) (-1246.571) (-1247.017) * (-1253.969) (-1253.539) [-1250.181] (-1250.322) -- 0:00:29
788500 -- [-1248.894] (-1254.840) (-1243.456) (-1246.641) * (-1255.893) (-1244.616) [-1244.471] (-1252.186) -- 0:00:29
789000 -- (-1250.266) (-1256.269) [-1250.860] (-1251.256) * (-1253.697) (-1248.750) (-1245.452) [-1251.278] -- 0:00:29
789500 -- [-1251.389] (-1247.144) (-1244.616) (-1246.932) * (-1249.065) (-1250.511) (-1248.988) [-1244.435] -- 0:00:29
790000 -- (-1253.117) (-1250.011) [-1247.375] (-1254.193) * (-1248.776) (-1246.654) [-1249.395] (-1247.673) -- 0:00:28
Average standard deviation of split frequencies: 0.000894
790500 -- [-1248.303] (-1245.613) (-1247.858) (-1250.506) * (-1253.908) (-1244.784) [-1250.639] (-1255.918) -- 0:00:28
791000 -- (-1251.101) (-1243.050) [-1243.709] (-1252.139) * (-1247.909) (-1255.337) [-1246.478] (-1248.561) -- 0:00:28
791500 -- (-1250.774) (-1241.541) [-1245.982] (-1246.801) * (-1252.929) [-1245.079] (-1249.439) (-1248.593) -- 0:00:28
792000 -- [-1243.363] (-1247.981) (-1242.404) (-1249.551) * (-1250.589) (-1249.059) (-1247.212) [-1249.863] -- 0:00:28
792500 -- (-1245.751) [-1248.773] (-1242.510) (-1251.316) * (-1251.148) (-1251.077) [-1244.670] (-1253.346) -- 0:00:28
793000 -- (-1246.080) (-1253.524) (-1246.458) [-1245.304] * (-1248.791) (-1254.453) [-1244.307] (-1248.474) -- 0:00:28
793500 -- (-1253.769) (-1248.634) [-1247.339] (-1252.112) * (-1249.877) [-1245.272] (-1247.403) (-1244.028) -- 0:00:28
794000 -- [-1248.259] (-1253.798) (-1254.258) (-1243.064) * [-1243.366] (-1251.233) (-1245.804) (-1253.350) -- 0:00:28
794500 -- (-1246.546) (-1245.121) (-1243.989) [-1247.703] * (-1249.256) [-1246.105] (-1246.282) (-1251.845) -- 0:00:28
795000 -- (-1246.756) [-1245.265] (-1242.581) (-1247.192) * (-1248.707) [-1247.574] (-1248.456) (-1253.131) -- 0:00:28
Average standard deviation of split frequencies: 0.000888
795500 -- (-1247.556) (-1247.822) (-1243.297) [-1251.450] * (-1251.903) (-1250.455) [-1249.942] (-1251.057) -- 0:00:28
796000 -- (-1258.471) (-1250.684) [-1246.413] (-1248.708) * (-1250.336) (-1249.410) [-1244.552] (-1247.603) -- 0:00:28
796500 -- (-1247.870) (-1244.641) [-1244.009] (-1244.425) * (-1246.160) [-1248.684] (-1245.609) (-1247.573) -- 0:00:28
797000 -- (-1248.774) (-1246.477) (-1253.990) [-1243.768] * (-1249.375) (-1245.264) [-1244.303] (-1247.338) -- 0:00:28
797500 -- (-1252.054) [-1242.373] (-1242.526) (-1249.268) * (-1245.186) [-1243.430] (-1244.219) (-1243.686) -- 0:00:27
798000 -- [-1249.564] (-1248.118) (-1246.875) (-1244.203) * (-1254.591) [-1245.357] (-1251.283) (-1245.097) -- 0:00:27
798500 -- (-1248.274) [-1251.487] (-1246.254) (-1246.797) * (-1246.644) (-1242.332) (-1245.616) [-1243.494] -- 0:00:27
799000 -- (-1252.756) (-1244.373) [-1251.154] (-1247.008) * (-1243.883) [-1247.169] (-1246.280) (-1246.159) -- 0:00:27
799500 -- (-1248.605) [-1243.383] (-1247.112) (-1242.987) * (-1247.816) [-1254.703] (-1243.042) (-1250.095) -- 0:00:27
800000 -- [-1251.373] (-1243.790) (-1252.109) (-1250.006) * (-1250.411) (-1250.305) (-1245.204) [-1245.771] -- 0:00:27
Average standard deviation of split frequencies: 0.000883
800500 -- (-1254.232) (-1253.618) [-1250.174] (-1250.175) * (-1249.615) [-1246.145] (-1248.787) (-1248.452) -- 0:00:27
801000 -- (-1248.138) (-1248.344) (-1251.532) [-1245.919] * (-1251.044) (-1244.893) (-1247.337) [-1245.017] -- 0:00:27
801500 -- (-1252.033) (-1252.843) (-1246.734) [-1247.933] * [-1256.624] (-1246.381) (-1249.588) (-1247.414) -- 0:00:27
802000 -- (-1247.467) (-1258.492) [-1246.856] (-1248.442) * [-1252.899] (-1248.584) (-1251.061) (-1243.828) -- 0:00:27
802500 -- (-1245.599) (-1248.820) [-1247.285] (-1250.887) * [-1246.676] (-1241.831) (-1256.692) (-1250.473) -- 0:00:27
803000 -- (-1242.878) (-1247.684) [-1245.895] (-1249.951) * (-1257.974) (-1246.835) [-1250.545] (-1251.348) -- 0:00:27
803500 -- (-1248.287) (-1250.419) [-1244.103] (-1248.319) * (-1249.255) (-1253.314) (-1245.949) [-1250.195] -- 0:00:27
804000 -- (-1243.107) [-1247.119] (-1246.760) (-1250.656) * (-1250.090) [-1247.185] (-1245.744) (-1254.216) -- 0:00:27
804500 -- (-1249.076) (-1243.022) (-1248.318) [-1251.479] * (-1246.603) [-1252.229] (-1246.233) (-1251.429) -- 0:00:26
805000 -- (-1246.439) (-1247.819) (-1249.193) [-1250.499] * (-1245.535) (-1249.380) [-1248.238] (-1255.780) -- 0:00:26
Average standard deviation of split frequencies: 0.000877
805500 -- (-1250.973) (-1242.957) (-1247.036) [-1248.655] * [-1245.705] (-1254.633) (-1249.215) (-1246.302) -- 0:00:26
806000 -- (-1248.160) [-1248.401] (-1252.571) (-1243.577) * (-1247.093) [-1249.416] (-1243.774) (-1246.212) -- 0:00:26
806500 -- (-1253.997) (-1256.579) (-1245.984) [-1253.637] * [-1246.361] (-1250.664) (-1243.169) (-1250.059) -- 0:00:26
807000 -- (-1249.588) (-1253.950) [-1248.439] (-1244.527) * (-1248.590) (-1256.377) [-1243.767] (-1246.172) -- 0:00:26
807500 -- (-1246.925) [-1250.779] (-1251.137) (-1249.203) * (-1255.580) (-1244.924) [-1250.037] (-1244.877) -- 0:00:26
808000 -- (-1244.830) (-1252.207) [-1250.005] (-1249.283) * (-1252.516) [-1242.843] (-1246.064) (-1245.488) -- 0:00:26
808500 -- [-1245.018] (-1247.757) (-1250.528) (-1243.443) * [-1248.470] (-1249.997) (-1245.094) (-1246.691) -- 0:00:26
809000 -- (-1252.818) (-1246.623) (-1249.171) [-1244.130] * (-1244.106) [-1247.439] (-1244.097) (-1250.662) -- 0:00:26
809500 -- [-1251.759] (-1251.399) (-1250.630) (-1246.807) * (-1241.873) (-1256.119) (-1248.405) [-1245.755] -- 0:00:26
810000 -- (-1246.271) (-1245.295) (-1257.069) [-1246.110] * (-1249.820) [-1248.068] (-1256.131) (-1248.229) -- 0:00:26
Average standard deviation of split frequencies: 0.000582
810500 -- [-1242.727] (-1248.364) (-1255.521) (-1247.948) * (-1248.603) (-1246.531) [-1245.220] (-1253.067) -- 0:00:26
811000 -- (-1250.442) [-1246.088] (-1247.368) (-1247.558) * (-1248.143) (-1248.380) [-1245.127] (-1251.827) -- 0:00:26
811500 -- (-1250.321) (-1244.240) [-1250.866] (-1247.843) * [-1248.187] (-1244.725) (-1252.007) (-1246.788) -- 0:00:26
812000 -- [-1247.979] (-1244.396) (-1255.943) (-1250.841) * (-1245.496) [-1241.188] (-1247.889) (-1243.823) -- 0:00:25
812500 -- (-1256.391) [-1249.035] (-1246.910) (-1249.075) * (-1247.705) (-1247.711) [-1249.801] (-1251.957) -- 0:00:25
813000 -- (-1249.049) [-1244.971] (-1248.409) (-1248.803) * (-1243.811) [-1252.332] (-1249.121) (-1247.048) -- 0:00:25
813500 -- (-1251.699) (-1253.557) (-1246.933) [-1244.766] * (-1255.546) (-1248.916) (-1247.174) [-1247.975] -- 0:00:25
814000 -- [-1244.550] (-1242.502) (-1250.174) (-1248.610) * (-1254.535) (-1247.607) [-1246.557] (-1249.250) -- 0:00:25
814500 -- (-1245.159) [-1246.285] (-1249.759) (-1242.769) * [-1244.706] (-1253.584) (-1254.946) (-1252.642) -- 0:00:25
815000 -- (-1243.421) (-1241.177) [-1249.576] (-1245.125) * (-1251.494) (-1256.666) (-1247.757) [-1248.749] -- 0:00:25
Average standard deviation of split frequencies: 0.000578
815500 -- (-1245.833) [-1252.561] (-1248.293) (-1252.676) * (-1242.299) (-1246.524) (-1245.861) [-1244.293] -- 0:00:25
816000 -- (-1244.924) [-1249.169] (-1246.453) (-1248.696) * (-1253.152) (-1263.032) (-1244.578) [-1243.319] -- 0:00:25
816500 -- (-1258.788) [-1242.571] (-1245.323) (-1248.151) * (-1252.464) (-1254.821) [-1243.189] (-1249.225) -- 0:00:25
817000 -- (-1246.634) (-1246.979) [-1248.270] (-1248.909) * [-1253.823] (-1250.462) (-1242.594) (-1253.862) -- 0:00:25
817500 -- (-1250.806) [-1249.582] (-1249.107) (-1247.650) * [-1246.354] (-1251.481) (-1248.699) (-1246.092) -- 0:00:25
818000 -- (-1242.736) (-1242.768) [-1247.894] (-1247.145) * (-1249.553) (-1250.595) (-1258.306) [-1245.077] -- 0:00:25
818500 -- (-1248.746) (-1243.077) [-1242.870] (-1246.276) * [-1249.099] (-1248.938) (-1256.808) (-1245.706) -- 0:00:25
819000 -- (-1246.969) (-1250.720) [-1257.513] (-1249.278) * (-1247.005) [-1249.641] (-1264.518) (-1243.284) -- 0:00:24
819500 -- (-1246.890) (-1252.121) (-1254.184) [-1248.566] * (-1246.309) [-1246.821] (-1250.149) (-1244.738) -- 0:00:24
820000 -- (-1250.436) (-1245.509) (-1259.974) [-1244.127] * [-1243.320] (-1243.607) (-1253.074) (-1242.662) -- 0:00:24
Average standard deviation of split frequencies: 0.000574
820500 -- (-1252.074) (-1244.489) [-1251.566] (-1243.795) * (-1250.808) [-1247.269] (-1245.682) (-1246.723) -- 0:00:24
821000 -- (-1250.148) (-1245.518) (-1247.788) [-1246.477] * (-1251.811) (-1247.817) (-1245.002) [-1245.983] -- 0:00:24
821500 -- (-1249.450) [-1246.742] (-1252.497) (-1247.993) * (-1251.341) (-1244.117) (-1243.870) [-1245.641] -- 0:00:24
822000 -- (-1249.137) (-1250.078) [-1247.215] (-1248.825) * (-1248.826) [-1247.203] (-1250.109) (-1247.444) -- 0:00:24
822500 -- (-1256.020) [-1249.917] (-1245.711) (-1247.345) * (-1249.745) [-1245.230] (-1244.767) (-1245.570) -- 0:00:24
823000 -- (-1249.882) (-1252.222) (-1244.607) [-1241.975] * (-1245.653) [-1244.392] (-1242.081) (-1245.389) -- 0:00:24
823500 -- (-1248.970) (-1246.474) (-1258.958) [-1250.548] * [-1242.366] (-1248.021) (-1254.618) (-1248.225) -- 0:00:24
824000 -- (-1245.142) (-1254.897) [-1249.629] (-1255.622) * (-1246.182) (-1250.952) [-1247.014] (-1250.758) -- 0:00:24
824500 -- (-1249.396) (-1256.532) (-1253.725) [-1245.211] * (-1252.060) (-1245.797) [-1245.041] (-1246.541) -- 0:00:24
825000 -- (-1253.265) (-1248.670) [-1248.910] (-1248.724) * (-1247.763) (-1248.278) [-1244.008] (-1246.118) -- 0:00:24
Average standard deviation of split frequencies: 0.000571
825500 -- (-1249.578) (-1247.555) [-1241.745] (-1252.547) * (-1246.537) (-1247.927) (-1246.630) [-1245.854] -- 0:00:24
826000 -- (-1246.107) (-1255.981) [-1248.268] (-1248.469) * (-1255.154) (-1243.613) [-1247.418] (-1247.659) -- 0:00:24
826500 -- (-1244.120) (-1250.029) (-1245.059) [-1247.903] * [-1247.471] (-1244.271) (-1248.694) (-1247.747) -- 0:00:23
827000 -- [-1248.280] (-1249.009) (-1242.179) (-1247.732) * (-1249.381) [-1249.100] (-1253.499) (-1245.103) -- 0:00:23
827500 -- (-1251.963) (-1250.433) (-1246.131) [-1246.111] * (-1244.886) [-1245.823] (-1255.104) (-1247.923) -- 0:00:23
828000 -- (-1244.811) [-1250.623] (-1249.826) (-1247.365) * (-1254.391) [-1250.649] (-1249.148) (-1243.570) -- 0:00:23
828500 -- [-1242.096] (-1250.577) (-1248.372) (-1249.864) * (-1251.059) (-1248.821) (-1254.416) [-1246.786] -- 0:00:23
829000 -- (-1250.179) (-1250.760) [-1245.032] (-1253.133) * [-1247.842] (-1249.374) (-1246.996) (-1246.476) -- 0:00:23
829500 -- [-1248.285] (-1245.379) (-1243.109) (-1244.162) * [-1250.385] (-1250.335) (-1248.224) (-1246.116) -- 0:00:23
830000 -- (-1248.208) (-1246.247) (-1242.772) [-1247.341] * (-1254.161) [-1244.184] (-1246.953) (-1247.045) -- 0:00:23
Average standard deviation of split frequencies: 0.000568
830500 -- (-1248.025) [-1246.851] (-1245.965) (-1249.445) * (-1255.542) [-1246.134] (-1248.898) (-1251.151) -- 0:00:23
831000 -- [-1242.418] (-1246.174) (-1252.768) (-1256.245) * [-1248.672] (-1251.486) (-1249.571) (-1247.318) -- 0:00:23
831500 -- [-1250.110] (-1249.723) (-1245.764) (-1247.049) * [-1244.682] (-1253.637) (-1256.415) (-1250.184) -- 0:00:23
832000 -- [-1248.991] (-1246.316) (-1250.395) (-1248.897) * (-1246.814) (-1249.558) [-1250.323] (-1255.669) -- 0:00:23
832500 -- (-1247.181) [-1246.264] (-1252.218) (-1258.755) * (-1245.966) [-1248.560] (-1253.922) (-1253.334) -- 0:00:23
833000 -- (-1249.046) [-1248.177] (-1248.536) (-1247.152) * (-1250.320) [-1244.790] (-1249.854) (-1247.425) -- 0:00:23
833500 -- (-1252.779) (-1259.469) [-1251.960] (-1254.961) * (-1249.121) (-1246.766) [-1249.999] (-1243.131) -- 0:00:22
834000 -- (-1253.666) (-1244.987) (-1243.729) [-1249.069] * (-1245.524) [-1248.599] (-1259.972) (-1246.796) -- 0:00:22
834500 -- (-1248.012) (-1244.280) (-1247.910) [-1247.157] * (-1245.387) [-1251.396] (-1260.669) (-1250.239) -- 0:00:23
835000 -- [-1253.357] (-1246.769) (-1245.073) (-1245.215) * (-1244.364) (-1254.418) [-1250.753] (-1246.234) -- 0:00:22
Average standard deviation of split frequencies: 0.000564
835500 -- (-1248.827) (-1248.269) [-1242.464] (-1249.560) * (-1250.195) (-1247.069) [-1254.685] (-1248.071) -- 0:00:22
836000 -- (-1249.017) (-1249.029) (-1246.181) [-1245.956] * [-1246.939] (-1247.441) (-1246.992) (-1246.024) -- 0:00:22
836500 -- (-1250.541) [-1245.110] (-1251.840) (-1246.820) * (-1251.240) [-1256.774] (-1246.221) (-1244.937) -- 0:00:22
837000 -- (-1245.984) (-1251.253) (-1247.176) [-1249.362] * (-1247.765) (-1250.924) [-1248.152] (-1246.032) -- 0:00:22
837500 -- (-1248.368) (-1248.316) (-1249.670) [-1242.448] * (-1252.141) (-1252.661) (-1248.685) [-1249.968] -- 0:00:22
838000 -- (-1250.139) (-1244.523) (-1253.364) [-1248.663] * (-1246.343) (-1256.931) (-1249.226) [-1253.189] -- 0:00:22
838500 -- (-1244.912) (-1250.179) (-1251.853) [-1242.999] * [-1249.121] (-1261.186) (-1245.947) (-1250.199) -- 0:00:22
839000 -- [-1251.897] (-1245.451) (-1246.752) (-1242.312) * [-1250.056] (-1254.381) (-1243.575) (-1247.330) -- 0:00:22
839500 -- (-1250.952) (-1253.957) (-1250.160) [-1247.291] * (-1254.376) (-1246.713) (-1251.559) [-1251.012] -- 0:00:22
840000 -- (-1245.368) [-1246.849] (-1246.755) (-1248.354) * (-1255.550) [-1248.653] (-1251.312) (-1248.186) -- 0:00:22
Average standard deviation of split frequencies: 0.000841
840500 -- (-1242.771) [-1244.915] (-1255.254) (-1250.099) * (-1253.716) (-1248.502) [-1248.960] (-1247.345) -- 0:00:22
841000 -- [-1250.250] (-1247.486) (-1252.485) (-1245.016) * (-1248.010) (-1251.418) [-1251.294] (-1243.216) -- 0:00:21
841500 -- (-1248.341) (-1250.769) (-1246.683) [-1248.832] * [-1249.165] (-1253.227) (-1251.372) (-1244.112) -- 0:00:22
842000 -- [-1249.228] (-1257.369) (-1251.171) (-1249.619) * (-1250.121) [-1247.319] (-1255.212) (-1242.524) -- 0:00:21
842500 -- (-1246.280) (-1246.986) (-1252.370) [-1253.518] * (-1247.959) [-1244.153] (-1251.216) (-1244.667) -- 0:00:21
843000 -- (-1250.677) [-1247.950] (-1245.991) (-1255.188) * [-1254.395] (-1251.945) (-1246.085) (-1247.245) -- 0:00:21
843500 -- [-1248.519] (-1244.977) (-1254.972) (-1250.033) * [-1247.439] (-1254.063) (-1243.610) (-1249.263) -- 0:00:21
844000 -- [-1242.125] (-1250.797) (-1255.004) (-1249.702) * [-1245.443] (-1253.437) (-1243.488) (-1253.087) -- 0:00:21
844500 -- (-1246.467) [-1242.596] (-1247.981) (-1245.907) * (-1252.250) [-1246.414] (-1248.112) (-1254.650) -- 0:00:21
845000 -- (-1254.610) (-1250.786) [-1249.469] (-1247.290) * (-1251.457) (-1247.875) (-1251.055) [-1250.806] -- 0:00:21
Average standard deviation of split frequencies: 0.000836
845500 -- (-1251.673) [-1250.563] (-1251.178) (-1246.645) * (-1252.886) [-1248.672] (-1251.570) (-1244.535) -- 0:00:21
846000 -- (-1247.897) (-1248.093) (-1249.814) [-1245.060] * (-1250.473) [-1249.143] (-1248.846) (-1243.650) -- 0:00:21
846500 -- (-1242.617) (-1244.717) [-1244.328] (-1246.915) * (-1255.929) (-1249.969) (-1244.997) [-1245.241] -- 0:00:21
847000 -- (-1246.753) (-1262.597) [-1246.378] (-1245.671) * (-1248.600) (-1252.252) [-1248.383] (-1245.170) -- 0:00:21
847500 -- [-1245.816] (-1257.277) (-1245.446) (-1246.958) * (-1245.790) (-1248.860) [-1251.050] (-1245.988) -- 0:00:21
848000 -- (-1244.943) (-1249.322) [-1246.992] (-1250.430) * (-1251.288) (-1253.796) [-1249.908] (-1246.862) -- 0:00:20
848500 -- (-1244.252) (-1253.634) (-1249.584) [-1250.684] * (-1254.449) (-1250.155) (-1250.299) [-1243.664] -- 0:00:21
849000 -- (-1246.859) [-1250.244] (-1248.111) (-1248.036) * (-1252.685) [-1249.354] (-1246.595) (-1248.750) -- 0:00:20
849500 -- (-1247.856) (-1244.266) [-1247.420] (-1255.126) * (-1246.534) (-1250.036) (-1247.250) [-1248.308] -- 0:00:20
850000 -- [-1241.574] (-1248.658) (-1252.763) (-1249.489) * (-1254.070) [-1241.777] (-1248.919) (-1250.586) -- 0:00:20
Average standard deviation of split frequencies: 0.000831
850500 -- (-1246.831) [-1247.977] (-1253.759) (-1263.342) * [-1254.981] (-1246.957) (-1246.058) (-1247.786) -- 0:00:20
851000 -- (-1243.128) (-1247.880) [-1250.130] (-1251.874) * (-1255.670) [-1247.617] (-1243.953) (-1252.839) -- 0:00:20
851500 -- (-1246.264) (-1249.692) [-1249.205] (-1257.392) * (-1247.569) (-1244.503) (-1243.375) [-1248.537] -- 0:00:20
852000 -- (-1252.083) (-1249.199) [-1247.283] (-1254.280) * (-1246.122) [-1246.647] (-1243.161) (-1252.721) -- 0:00:20
852500 -- (-1244.785) [-1248.552] (-1244.987) (-1248.132) * (-1249.628) (-1245.942) [-1246.747] (-1245.768) -- 0:00:20
853000 -- (-1247.707) (-1250.494) [-1244.045] (-1257.272) * (-1250.416) [-1248.902] (-1255.862) (-1246.235) -- 0:00:20
853500 -- (-1250.270) (-1246.205) (-1241.557) [-1246.149] * (-1252.454) [-1252.960] (-1246.672) (-1243.878) -- 0:00:20
854000 -- [-1245.176] (-1242.602) (-1248.952) (-1248.366) * [-1247.872] (-1242.840) (-1246.767) (-1246.998) -- 0:00:20
854500 -- (-1246.046) [-1245.098] (-1247.727) (-1258.779) * (-1244.380) [-1247.700] (-1248.096) (-1243.828) -- 0:00:20
855000 -- [-1245.285] (-1251.092) (-1252.568) (-1244.029) * (-1251.187) (-1255.852) [-1247.242] (-1253.629) -- 0:00:20
Average standard deviation of split frequencies: 0.000826
855500 -- [-1245.289] (-1255.225) (-1252.229) (-1248.624) * (-1245.848) [-1246.500] (-1247.259) (-1250.648) -- 0:00:20
856000 -- (-1248.150) (-1253.454) (-1249.481) [-1248.775] * [-1243.919] (-1248.678) (-1247.324) (-1258.426) -- 0:00:20
856500 -- (-1249.508) [-1247.901] (-1251.460) (-1247.107) * [-1245.368] (-1246.750) (-1248.104) (-1245.764) -- 0:00:19
857000 -- [-1247.699] (-1248.470) (-1253.940) (-1248.648) * [-1250.583] (-1247.494) (-1247.292) (-1253.612) -- 0:00:19
857500 -- (-1254.654) (-1248.673) (-1244.474) [-1250.818] * (-1241.228) [-1244.748] (-1250.481) (-1253.570) -- 0:00:19
858000 -- (-1252.584) [-1248.329] (-1245.045) (-1244.323) * [-1245.079] (-1243.816) (-1245.231) (-1245.375) -- 0:00:19
858500 -- [-1246.429] (-1254.573) (-1254.355) (-1244.891) * (-1255.521) [-1248.370] (-1249.390) (-1250.459) -- 0:00:19
859000 -- (-1253.398) (-1251.238) (-1249.394) [-1253.229] * [-1247.400] (-1254.646) (-1248.558) (-1253.991) -- 0:00:19
859500 -- [-1246.679] (-1248.849) (-1246.441) (-1256.534) * (-1251.796) (-1251.398) [-1244.944] (-1252.754) -- 0:00:19
860000 -- (-1245.190) (-1262.040) [-1242.650] (-1249.812) * (-1253.190) [-1250.183] (-1245.754) (-1251.293) -- 0:00:19
Average standard deviation of split frequencies: 0.000822
860500 -- [-1247.607] (-1245.796) (-1251.518) (-1252.734) * (-1257.390) [-1245.291] (-1246.928) (-1246.125) -- 0:00:19
861000 -- (-1250.501) [-1244.965] (-1245.692) (-1244.121) * (-1253.366) (-1252.653) [-1250.511] (-1246.262) -- 0:00:19
861500 -- [-1245.880] (-1253.752) (-1247.837) (-1246.601) * [-1250.057] (-1244.318) (-1249.373) (-1253.653) -- 0:00:19
862000 -- (-1255.880) (-1247.523) [-1245.205] (-1248.767) * [-1245.825] (-1244.165) (-1249.870) (-1252.598) -- 0:00:19
862500 -- (-1247.772) (-1247.010) (-1251.280) [-1249.241] * (-1244.058) (-1250.024) (-1247.126) [-1251.328] -- 0:00:19
863000 -- (-1248.791) (-1245.340) [-1243.344] (-1247.066) * (-1252.376) (-1249.116) (-1252.108) [-1243.420] -- 0:00:19
863500 -- (-1243.300) (-1244.579) [-1246.616] (-1249.734) * [-1245.211] (-1246.981) (-1252.115) (-1251.754) -- 0:00:18
864000 -- (-1246.900) [-1247.587] (-1247.556) (-1245.430) * (-1253.589) (-1245.303) (-1252.294) [-1252.646] -- 0:00:18
864500 -- [-1241.742] (-1248.929) (-1247.523) (-1247.982) * (-1255.291) (-1248.920) (-1248.357) [-1248.807] -- 0:00:18
865000 -- [-1244.525] (-1248.292) (-1252.556) (-1254.805) * (-1248.798) (-1255.938) (-1245.988) [-1247.240] -- 0:00:18
Average standard deviation of split frequencies: 0.000817
865500 -- (-1244.416) (-1244.851) (-1248.674) [-1251.302] * [-1246.339] (-1256.197) (-1255.309) (-1248.912) -- 0:00:18
866000 -- (-1242.360) (-1247.352) [-1246.571] (-1248.753) * (-1244.716) (-1246.241) (-1250.831) [-1246.852] -- 0:00:18
866500 -- [-1243.584] (-1247.616) (-1248.385) (-1250.473) * (-1254.195) (-1243.367) [-1251.040] (-1253.040) -- 0:00:18
867000 -- [-1248.875] (-1245.001) (-1243.977) (-1246.038) * (-1254.815) (-1247.582) [-1249.839] (-1249.117) -- 0:00:18
867500 -- [-1243.743] (-1266.378) (-1248.510) (-1246.098) * (-1251.600) (-1246.818) [-1251.175] (-1247.950) -- 0:00:18
868000 -- (-1244.360) [-1244.230] (-1250.169) (-1247.448) * [-1249.337] (-1253.020) (-1251.629) (-1247.225) -- 0:00:18
868500 -- (-1250.002) (-1242.804) (-1246.054) [-1251.037] * (-1245.726) (-1244.633) (-1256.806) [-1245.651] -- 0:00:18
869000 -- [-1249.316] (-1251.705) (-1243.574) (-1252.791) * (-1245.423) [-1246.055] (-1250.803) (-1246.484) -- 0:00:18
869500 -- (-1248.694) (-1251.215) [-1247.613] (-1249.194) * (-1243.705) [-1244.550] (-1253.516) (-1245.453) -- 0:00:18
870000 -- (-1247.110) (-1249.573) [-1243.194] (-1252.927) * (-1248.106) (-1250.424) (-1250.637) [-1244.572] -- 0:00:18
Average standard deviation of split frequencies: 0.001083
870500 -- (-1251.509) (-1252.454) (-1247.804) [-1251.510] * (-1248.021) [-1251.467] (-1249.972) (-1244.740) -- 0:00:18
871000 -- [-1248.435] (-1251.186) (-1244.385) (-1254.797) * (-1250.524) [-1249.752] (-1249.961) (-1247.389) -- 0:00:17
871500 -- (-1257.789) (-1242.933) [-1244.465] (-1253.951) * (-1253.608) [-1248.246] (-1249.789) (-1247.056) -- 0:00:17
872000 -- (-1250.235) (-1249.717) [-1247.218] (-1251.025) * (-1255.592) (-1248.871) (-1250.661) [-1241.071] -- 0:00:17
872500 -- (-1257.232) [-1245.610] (-1249.888) (-1252.596) * [-1254.118] (-1251.047) (-1247.988) (-1249.883) -- 0:00:17
873000 -- [-1243.914] (-1247.369) (-1249.323) (-1249.045) * (-1244.192) (-1246.020) (-1253.556) [-1242.372] -- 0:00:17
873500 -- (-1248.876) [-1244.104] (-1250.749) (-1254.137) * (-1253.260) (-1248.916) [-1251.144] (-1250.988) -- 0:00:17
874000 -- [-1245.362] (-1247.493) (-1248.747) (-1251.436) * [-1250.118] (-1245.176) (-1248.964) (-1243.761) -- 0:00:17
874500 -- (-1243.857) (-1250.675) [-1244.519] (-1258.576) * (-1248.330) (-1250.614) (-1250.122) [-1242.370] -- 0:00:17
875000 -- (-1254.381) [-1245.637] (-1243.652) (-1252.066) * (-1249.888) (-1250.370) (-1252.440) [-1247.333] -- 0:00:17
Average standard deviation of split frequencies: 0.001076
875500 -- (-1242.183) (-1242.365) [-1243.656] (-1261.780) * (-1251.144) (-1254.050) (-1246.001) [-1244.383] -- 0:00:17
876000 -- (-1245.340) (-1250.755) [-1244.513] (-1257.553) * (-1254.881) (-1255.444) (-1248.367) [-1250.985] -- 0:00:17
876500 -- [-1245.200] (-1255.145) (-1242.452) (-1259.148) * (-1249.545) [-1247.439] (-1247.167) (-1252.140) -- 0:00:17
877000 -- (-1249.050) (-1253.601) [-1248.958] (-1258.574) * (-1252.426) (-1248.362) (-1251.582) [-1244.598] -- 0:00:17
877500 -- [-1248.934] (-1254.250) (-1247.203) (-1255.133) * [-1255.979] (-1247.202) (-1250.312) (-1246.395) -- 0:00:17
878000 -- (-1246.322) [-1247.713] (-1246.535) (-1254.079) * (-1247.096) [-1244.267] (-1246.861) (-1254.304) -- 0:00:16
878500 -- [-1246.565] (-1245.648) (-1253.082) (-1254.125) * (-1243.199) (-1250.423) (-1255.596) [-1250.482] -- 0:00:16
879000 -- [-1242.533] (-1251.837) (-1246.252) (-1252.591) * (-1247.447) (-1245.414) [-1246.521] (-1246.522) -- 0:00:16
879500 -- (-1244.881) [-1256.432] (-1246.017) (-1259.841) * (-1243.724) [-1246.075] (-1247.728) (-1246.642) -- 0:00:16
880000 -- [-1245.653] (-1247.364) (-1250.218) (-1264.291) * (-1246.514) (-1247.874) [-1244.464] (-1245.372) -- 0:00:16
Average standard deviation of split frequencies: 0.000803
880500 -- [-1242.741] (-1246.637) (-1245.273) (-1254.917) * (-1245.157) (-1256.796) [-1249.248] (-1240.805) -- 0:00:16
881000 -- [-1243.204] (-1248.388) (-1248.606) (-1254.591) * [-1245.002] (-1252.377) (-1241.482) (-1248.477) -- 0:00:16
881500 -- [-1244.390] (-1247.311) (-1245.497) (-1253.100) * (-1250.324) [-1248.452] (-1244.747) (-1253.139) -- 0:00:16
882000 -- [-1245.583] (-1245.482) (-1244.654) (-1256.368) * (-1246.638) (-1247.919) [-1249.352] (-1243.587) -- 0:00:16
882500 -- (-1249.123) (-1246.360) [-1245.651] (-1250.695) * (-1245.148) [-1243.839] (-1253.644) (-1246.294) -- 0:00:16
883000 -- (-1245.111) (-1245.521) [-1241.932] (-1249.580) * [-1246.680] (-1247.970) (-1251.087) (-1246.912) -- 0:00:16
883500 -- [-1244.762] (-1257.144) (-1249.324) (-1250.261) * (-1245.442) [-1248.515] (-1249.759) (-1247.110) -- 0:00:16
884000 -- (-1247.399) [-1251.093] (-1245.335) (-1254.547) * [-1252.672] (-1246.393) (-1249.783) (-1245.568) -- 0:00:16
884500 -- [-1247.662] (-1252.967) (-1248.340) (-1249.664) * (-1254.966) [-1248.438] (-1255.333) (-1241.779) -- 0:00:16
885000 -- (-1249.839) (-1254.112) (-1249.926) [-1248.446] * (-1253.018) (-1249.104) (-1253.327) [-1242.432] -- 0:00:15
Average standard deviation of split frequencies: 0.000798
885500 -- (-1248.689) (-1249.684) [-1250.303] (-1246.728) * (-1251.773) [-1242.450] (-1246.423) (-1245.227) -- 0:00:15
886000 -- [-1249.521] (-1249.182) (-1250.683) (-1250.158) * (-1258.621) (-1250.522) [-1243.580] (-1246.996) -- 0:00:15
886500 -- (-1250.252) (-1252.622) [-1247.832] (-1254.063) * (-1259.877) [-1249.544] (-1247.037) (-1246.678) -- 0:00:15
887000 -- [-1247.968] (-1250.221) (-1250.652) (-1243.373) * (-1249.658) [-1250.783] (-1247.140) (-1245.923) -- 0:00:15
887500 -- [-1240.834] (-1254.603) (-1253.016) (-1243.111) * [-1245.829] (-1251.486) (-1241.891) (-1242.941) -- 0:00:15
888000 -- (-1247.954) [-1248.758] (-1252.238) (-1243.428) * (-1256.053) [-1252.628] (-1245.263) (-1248.314) -- 0:00:15
888500 -- (-1253.801) (-1255.456) (-1250.673) [-1249.385] * [-1247.445] (-1256.274) (-1244.432) (-1246.119) -- 0:00:15
889000 -- (-1255.693) (-1245.135) [-1245.224] (-1246.949) * (-1244.531) (-1251.072) (-1245.001) [-1248.827] -- 0:00:15
889500 -- [-1252.650] (-1247.900) (-1243.024) (-1250.356) * (-1246.594) (-1252.359) [-1245.454] (-1250.206) -- 0:00:15
890000 -- (-1255.674) (-1246.568) [-1247.301] (-1244.189) * (-1245.257) (-1253.413) (-1243.024) [-1250.252] -- 0:00:15
Average standard deviation of split frequencies: 0.000529
890500 -- (-1252.665) (-1247.419) [-1245.424] (-1248.010) * [-1248.893] (-1259.007) (-1246.847) (-1247.438) -- 0:00:15
891000 -- (-1243.814) [-1244.514] (-1249.858) (-1244.874) * (-1252.602) (-1249.440) (-1245.574) [-1249.801] -- 0:00:15
891500 -- (-1247.809) (-1251.411) (-1252.873) [-1242.266] * (-1248.134) (-1252.730) (-1248.557) [-1246.991] -- 0:00:15
892000 -- (-1255.954) (-1250.346) (-1251.067) [-1245.364] * (-1249.908) (-1249.838) (-1243.963) [-1246.150] -- 0:00:15
892500 -- (-1250.001) (-1248.403) [-1253.538] (-1247.349) * [-1244.761] (-1245.179) (-1245.119) (-1248.887) -- 0:00:14
893000 -- [-1244.977] (-1257.898) (-1272.861) (-1245.609) * (-1244.102) (-1248.336) (-1244.974) [-1248.083] -- 0:00:14
893500 -- (-1246.023) (-1244.284) (-1249.408) [-1243.800] * (-1251.482) (-1248.959) (-1252.407) [-1246.065] -- 0:00:14
894000 -- (-1245.252) (-1247.626) (-1243.754) [-1253.115] * (-1252.701) (-1246.271) (-1244.034) [-1244.324] -- 0:00:14
894500 -- (-1246.403) (-1251.722) [-1242.437] (-1263.939) * (-1256.606) (-1253.050) [-1244.662] (-1248.718) -- 0:00:14
895000 -- (-1244.758) (-1259.434) [-1247.775] (-1248.048) * (-1246.010) (-1250.133) [-1250.833] (-1253.571) -- 0:00:14
Average standard deviation of split frequencies: 0.000526
895500 -- (-1253.231) (-1248.405) [-1249.715] (-1246.939) * [-1246.760] (-1247.179) (-1245.691) (-1250.056) -- 0:00:14
896000 -- (-1250.279) (-1253.934) (-1245.526) [-1249.910] * (-1247.166) [-1242.600] (-1247.260) (-1247.053) -- 0:00:14
896500 -- [-1248.754] (-1248.942) (-1241.319) (-1243.358) * [-1248.666] (-1249.366) (-1253.620) (-1247.814) -- 0:00:14
897000 -- (-1244.068) (-1249.256) (-1251.493) [-1249.701] * (-1248.852) [-1249.397] (-1245.872) (-1247.924) -- 0:00:14
897500 -- (-1249.476) [-1248.100] (-1245.313) (-1249.792) * (-1247.374) (-1245.661) [-1252.752] (-1249.164) -- 0:00:14
898000 -- [-1244.194] (-1254.027) (-1248.339) (-1250.600) * [-1248.005] (-1253.187) (-1254.525) (-1245.813) -- 0:00:14
898500 -- (-1246.137) (-1256.739) [-1246.040] (-1252.163) * (-1251.300) (-1248.868) (-1257.579) [-1245.235] -- 0:00:14
899000 -- (-1250.911) (-1247.320) (-1243.907) [-1248.868] * (-1255.157) (-1260.647) (-1251.635) [-1245.047] -- 0:00:14
899500 -- (-1246.889) [-1250.348] (-1246.447) (-1248.419) * (-1244.919) (-1257.860) (-1249.793) [-1249.600] -- 0:00:13
900000 -- [-1246.652] (-1252.723) (-1248.333) (-1247.985) * (-1245.035) (-1254.880) (-1246.677) [-1252.344] -- 0:00:13
Average standard deviation of split frequencies: 0.000523
900500 -- [-1248.951] (-1250.645) (-1252.212) (-1248.893) * (-1249.861) (-1243.966) (-1254.473) [-1248.054] -- 0:00:13
901000 -- (-1246.778) (-1256.326) [-1248.732] (-1245.840) * (-1251.974) [-1249.181] (-1250.565) (-1255.219) -- 0:00:13
901500 -- (-1256.768) (-1249.798) [-1245.266] (-1257.667) * [-1244.665] (-1251.913) (-1245.584) (-1252.722) -- 0:00:13
902000 -- (-1258.164) (-1260.506) (-1246.749) [-1247.904] * (-1252.115) (-1252.346) [-1244.739] (-1247.827) -- 0:00:13
902500 -- (-1256.177) [-1249.449] (-1252.939) (-1248.523) * (-1250.923) [-1244.806] (-1255.033) (-1243.252) -- 0:00:13
903000 -- (-1249.751) (-1244.260) (-1249.588) [-1244.889] * (-1255.936) (-1246.249) (-1248.869) [-1246.620] -- 0:00:13
903500 -- (-1252.327) (-1249.873) (-1253.709) [-1248.055] * (-1256.931) (-1248.404) [-1246.403] (-1246.305) -- 0:00:13
904000 -- (-1246.521) (-1247.502) [-1248.393] (-1244.872) * (-1253.830) (-1245.482) [-1248.717] (-1252.505) -- 0:00:13
904500 -- [-1245.840] (-1248.144) (-1252.228) (-1247.666) * [-1255.648] (-1249.452) (-1249.623) (-1255.590) -- 0:00:13
905000 -- (-1246.162) (-1240.653) (-1242.491) [-1253.994] * (-1257.744) [-1251.389] (-1252.397) (-1247.617) -- 0:00:13
Average standard deviation of split frequencies: 0.000260
905500 -- (-1241.868) (-1247.956) [-1248.031] (-1246.528) * [-1248.575] (-1253.623) (-1246.838) (-1246.604) -- 0:00:13
906000 -- [-1250.721] (-1243.597) (-1256.292) (-1243.691) * (-1247.910) [-1255.127] (-1251.373) (-1246.493) -- 0:00:13
906500 -- (-1249.245) (-1252.503) (-1255.353) [-1244.089] * [-1245.349] (-1250.068) (-1247.585) (-1245.215) -- 0:00:12
907000 -- (-1244.508) [-1248.334] (-1248.158) (-1250.223) * (-1253.553) (-1249.635) (-1255.387) [-1252.560] -- 0:00:12
907500 -- (-1244.365) [-1244.209] (-1245.268) (-1246.266) * [-1246.079] (-1256.051) (-1250.018) (-1246.357) -- 0:00:12
908000 -- [-1247.116] (-1244.954) (-1253.438) (-1246.800) * [-1251.068] (-1245.249) (-1253.124) (-1255.713) -- 0:00:12
908500 -- (-1246.159) (-1252.859) (-1249.145) [-1245.177] * [-1244.240] (-1242.712) (-1250.194) (-1246.636) -- 0:00:12
909000 -- (-1249.120) (-1245.302) (-1246.225) [-1246.343] * (-1252.109) (-1244.760) [-1247.282] (-1246.468) -- 0:00:12
909500 -- (-1251.891) (-1247.483) [-1244.146] (-1246.775) * (-1249.910) [-1246.367] (-1242.994) (-1245.085) -- 0:00:12
910000 -- (-1248.174) (-1254.413) [-1247.086] (-1243.597) * [-1246.130] (-1248.932) (-1244.982) (-1248.794) -- 0:00:12
Average standard deviation of split frequencies: 0.000259
910500 -- [-1245.786] (-1250.627) (-1252.422) (-1255.875) * (-1248.951) (-1249.154) (-1247.553) [-1245.650] -- 0:00:12
911000 -- [-1248.721] (-1254.128) (-1248.921) (-1254.433) * (-1249.243) (-1251.822) [-1250.350] (-1242.288) -- 0:00:12
911500 -- [-1248.518] (-1255.723) (-1251.223) (-1265.716) * (-1244.707) [-1248.239] (-1253.244) (-1248.565) -- 0:00:12
912000 -- (-1248.737) (-1257.367) (-1246.602) [-1251.899] * (-1243.429) [-1248.734] (-1250.288) (-1252.018) -- 0:00:12
912500 -- [-1247.891] (-1250.131) (-1248.248) (-1254.250) * (-1246.729) (-1246.884) (-1250.433) [-1244.386] -- 0:00:12
913000 -- (-1248.652) (-1247.055) [-1249.716] (-1250.451) * [-1247.803] (-1251.430) (-1250.922) (-1246.552) -- 0:00:12
913500 -- [-1253.811] (-1248.098) (-1257.771) (-1251.667) * (-1245.190) [-1243.581] (-1245.538) (-1250.455) -- 0:00:12
914000 -- (-1246.494) [-1246.072] (-1246.624) (-1250.678) * [-1244.325] (-1245.381) (-1244.449) (-1252.213) -- 0:00:11
914500 -- (-1252.468) (-1244.418) (-1248.744) [-1246.793] * (-1251.149) (-1252.202) [-1249.575] (-1254.787) -- 0:00:11
915000 -- [-1246.041] (-1255.663) (-1246.577) (-1248.554) * (-1241.123) [-1244.979] (-1250.990) (-1249.828) -- 0:00:11
Average standard deviation of split frequencies: 0.000257
915500 -- (-1244.966) [-1251.388] (-1245.454) (-1248.235) * (-1250.775) [-1245.703] (-1252.963) (-1256.119) -- 0:00:11
916000 -- (-1250.378) [-1248.169] (-1246.294) (-1248.377) * [-1248.609] (-1256.064) (-1250.478) (-1253.387) -- 0:00:11
916500 -- (-1248.121) (-1252.035) [-1247.682] (-1247.955) * [-1246.304] (-1247.622) (-1247.955) (-1245.480) -- 0:00:11
917000 -- (-1245.161) [-1248.750] (-1248.144) (-1249.524) * (-1246.615) (-1249.915) (-1253.505) [-1243.285] -- 0:00:11
917500 -- (-1245.668) (-1248.892) [-1242.297] (-1242.229) * [-1246.823] (-1256.640) (-1251.339) (-1250.074) -- 0:00:11
918000 -- (-1246.568) (-1248.547) (-1247.416) [-1243.272] * (-1248.119) (-1249.941) [-1246.473] (-1253.402) -- 0:00:11
918500 -- (-1256.445) [-1247.077] (-1250.751) (-1250.089) * [-1244.738] (-1245.533) (-1253.389) (-1250.199) -- 0:00:11
919000 -- (-1248.636) (-1253.716) [-1248.322] (-1249.559) * [-1250.278] (-1245.292) (-1245.430) (-1245.776) -- 0:00:11
919500 -- (-1248.541) (-1251.148) (-1251.446) [-1248.220] * (-1247.541) (-1252.652) [-1247.073] (-1246.189) -- 0:00:11
920000 -- (-1246.167) [-1248.182] (-1253.407) (-1247.069) * (-1249.919) [-1245.804] (-1243.875) (-1241.937) -- 0:00:11
Average standard deviation of split frequencies: 0.000512
920500 -- (-1246.202) (-1249.933) (-1246.425) [-1251.414] * [-1245.544] (-1247.399) (-1250.760) (-1249.262) -- 0:00:11
921000 -- (-1246.923) (-1248.710) [-1243.535] (-1242.906) * (-1251.545) (-1252.763) [-1243.266] (-1243.836) -- 0:00:10
921500 -- [-1245.862] (-1246.633) (-1251.158) (-1244.744) * (-1244.207) (-1248.751) (-1251.208) [-1243.685] -- 0:00:10
922000 -- [-1251.913] (-1245.325) (-1250.033) (-1244.041) * [-1241.751] (-1245.029) (-1246.970) (-1245.176) -- 0:00:10
922500 -- (-1254.361) (-1250.438) (-1247.749) [-1246.063] * [-1247.304] (-1246.511) (-1246.868) (-1245.534) -- 0:00:10
923000 -- (-1245.390) (-1248.745) [-1247.761] (-1245.001) * (-1246.997) [-1250.686] (-1251.298) (-1251.729) -- 0:00:10
923500 -- (-1248.320) (-1254.017) (-1243.520) [-1252.016] * (-1246.892) (-1250.094) [-1242.679] (-1249.715) -- 0:00:10
924000 -- (-1250.670) [-1256.961] (-1245.653) (-1248.813) * [-1249.722] (-1242.113) (-1249.446) (-1250.858) -- 0:00:10
924500 -- (-1245.816) (-1253.417) [-1245.632] (-1255.619) * (-1247.669) (-1255.405) (-1249.117) [-1245.540] -- 0:00:10
925000 -- [-1247.243] (-1247.756) (-1247.188) (-1249.513) * (-1248.340) [-1248.453] (-1244.917) (-1244.920) -- 0:00:10
Average standard deviation of split frequencies: 0.000509
925500 -- (-1246.953) (-1246.436) (-1244.342) [-1253.116] * (-1250.848) [-1248.358] (-1244.765) (-1252.277) -- 0:00:10
926000 -- (-1244.777) (-1244.733) (-1246.917) [-1240.861] * (-1244.784) (-1248.784) [-1245.705] (-1244.328) -- 0:00:10
926500 -- (-1251.716) (-1249.119) [-1246.190] (-1256.447) * [-1246.974] (-1245.410) (-1249.460) (-1248.059) -- 0:00:10
927000 -- (-1247.402) (-1244.353) (-1247.878) [-1244.069] * (-1244.179) [-1245.157] (-1249.193) (-1247.784) -- 0:00:10
927500 -- [-1244.352] (-1244.930) (-1250.633) (-1251.524) * [-1247.679] (-1246.252) (-1250.376) (-1248.256) -- 0:00:10
928000 -- (-1247.196) (-1246.269) (-1243.665) [-1247.402] * (-1249.314) (-1249.466) [-1255.971] (-1253.983) -- 0:00:10
928500 -- (-1244.443) (-1243.122) [-1253.231] (-1248.163) * (-1243.963) (-1247.625) (-1256.377) [-1248.040] -- 0:00:09
929000 -- (-1249.362) [-1240.883] (-1251.234) (-1249.369) * (-1249.315) (-1253.514) [-1252.341] (-1247.095) -- 0:00:09
929500 -- [-1244.376] (-1250.206) (-1245.366) (-1244.030) * (-1249.089) (-1252.435) (-1253.930) [-1243.270] -- 0:00:09
930000 -- [-1247.117] (-1247.318) (-1243.762) (-1244.403) * [-1245.187] (-1248.773) (-1253.894) (-1243.214) -- 0:00:09
Average standard deviation of split frequencies: 0.000253
930500 -- (-1246.067) (-1248.672) (-1244.237) [-1248.332] * [-1245.673] (-1246.165) (-1250.342) (-1248.839) -- 0:00:09
931000 -- [-1242.869] (-1249.602) (-1251.726) (-1249.416) * (-1246.796) (-1245.368) [-1247.338] (-1249.284) -- 0:00:09
931500 -- (-1247.198) (-1250.955) (-1247.596) [-1244.818] * (-1248.922) (-1246.275) [-1242.415] (-1248.043) -- 0:00:09
932000 -- (-1244.601) (-1245.825) (-1250.664) [-1248.274] * (-1252.649) (-1251.832) (-1246.525) [-1250.420] -- 0:00:09
932500 -- (-1243.215) (-1248.789) (-1243.367) [-1248.559] * (-1257.059) (-1247.369) (-1254.984) [-1250.001] -- 0:00:09
933000 -- (-1253.032) (-1249.152) (-1251.956) [-1241.261] * (-1263.284) [-1245.579] (-1250.422) (-1250.209) -- 0:00:09
933500 -- [-1251.186] (-1253.839) (-1250.654) (-1243.772) * (-1261.529) (-1249.092) [-1246.008] (-1250.877) -- 0:00:09
934000 -- (-1247.067) (-1253.437) (-1245.398) [-1251.094] * (-1249.545) (-1248.845) [-1245.720] (-1254.717) -- 0:00:09
934500 -- (-1247.678) (-1251.938) (-1242.268) [-1247.485] * (-1252.628) (-1247.269) [-1246.966] (-1244.310) -- 0:00:09
935000 -- (-1251.799) (-1251.625) (-1247.574) [-1245.771] * (-1246.142) (-1249.876) [-1241.942] (-1256.405) -- 0:00:09
Average standard deviation of split frequencies: 0.000252
935500 -- (-1249.059) (-1249.038) [-1247.843] (-1254.091) * (-1245.878) (-1252.860) [-1249.615] (-1250.750) -- 0:00:08
936000 -- (-1247.060) [-1242.477] (-1249.104) (-1243.159) * (-1246.347) (-1245.783) [-1245.262] (-1245.379) -- 0:00:08
936500 -- [-1247.227] (-1245.770) (-1249.692) (-1244.838) * [-1240.459] (-1246.313) (-1245.798) (-1249.583) -- 0:00:08
937000 -- (-1247.524) (-1247.266) (-1249.036) [-1252.105] * (-1257.536) (-1245.240) [-1245.136] (-1246.018) -- 0:00:08
937500 -- (-1253.254) [-1247.336] (-1250.684) (-1249.119) * [-1245.639] (-1246.913) (-1256.334) (-1256.458) -- 0:00:08
938000 -- (-1252.272) (-1252.927) [-1253.419] (-1242.640) * (-1253.574) (-1244.123) (-1244.468) [-1248.079] -- 0:00:08
938500 -- (-1254.901) [-1249.358] (-1252.719) (-1251.502) * (-1251.394) [-1244.923] (-1244.778) (-1252.119) -- 0:00:08
939000 -- (-1252.462) (-1252.287) (-1245.598) [-1243.713] * [-1249.750] (-1250.832) (-1249.898) (-1247.249) -- 0:00:08
939500 -- (-1244.182) (-1250.587) [-1250.258] (-1246.822) * [-1245.788] (-1244.511) (-1241.547) (-1246.539) -- 0:00:08
940000 -- (-1245.799) [-1250.591] (-1252.385) (-1247.481) * (-1254.041) (-1244.194) [-1244.858] (-1248.453) -- 0:00:08
Average standard deviation of split frequencies: 0.000251
940500 -- (-1245.637) [-1252.363] (-1245.950) (-1248.372) * [-1252.324] (-1248.133) (-1249.148) (-1249.131) -- 0:00:08
941000 -- (-1254.544) (-1254.218) [-1245.283] (-1259.154) * (-1250.110) (-1245.140) (-1244.693) [-1247.637] -- 0:00:08
941500 -- (-1256.290) (-1243.044) [-1245.329] (-1256.735) * (-1253.263) (-1246.176) (-1247.399) [-1248.791] -- 0:00:08
942000 -- (-1244.340) [-1243.760] (-1253.070) (-1248.529) * [-1253.525] (-1247.650) (-1251.919) (-1243.340) -- 0:00:08
942500 -- (-1252.492) [-1242.139] (-1250.089) (-1251.963) * (-1250.603) (-1250.485) (-1250.934) [-1245.066] -- 0:00:07
943000 -- (-1251.649) [-1249.653] (-1251.221) (-1250.462) * (-1246.501) [-1242.376] (-1253.430) (-1245.046) -- 0:00:07
943500 -- (-1249.680) (-1246.977) (-1252.925) [-1248.481] * (-1248.592) (-1246.165) [-1245.779] (-1246.943) -- 0:00:07
944000 -- (-1256.357) [-1246.545] (-1249.717) (-1246.898) * (-1242.182) (-1253.016) (-1246.454) [-1250.906] -- 0:00:07
944500 -- [-1246.386] (-1245.742) (-1250.771) (-1249.641) * [-1249.674] (-1246.651) (-1246.459) (-1250.957) -- 0:00:07
945000 -- (-1248.463) [-1250.626] (-1255.489) (-1252.836) * (-1250.511) [-1248.610] (-1250.439) (-1247.860) -- 0:00:07
Average standard deviation of split frequencies: 0.000498
945500 -- [-1245.238] (-1249.881) (-1255.171) (-1249.526) * (-1247.139) (-1250.367) (-1253.766) [-1247.447] -- 0:00:07
946000 -- (-1248.966) (-1248.576) (-1249.713) [-1251.887] * (-1254.075) [-1246.294] (-1251.949) (-1244.157) -- 0:00:07
946500 -- [-1246.515] (-1249.637) (-1247.572) (-1254.046) * (-1251.060) [-1250.925] (-1249.314) (-1249.155) -- 0:00:07
947000 -- (-1254.511) [-1246.914] (-1247.095) (-1255.800) * (-1244.417) (-1247.424) (-1245.857) [-1244.459] -- 0:00:07
947500 -- (-1253.633) (-1249.237) [-1242.705] (-1248.871) * [-1243.551] (-1246.330) (-1246.214) (-1242.921) -- 0:00:07
948000 -- (-1247.546) [-1245.783] (-1244.709) (-1252.290) * [-1253.287] (-1245.740) (-1247.163) (-1246.122) -- 0:00:07
948500 -- (-1241.014) (-1243.734) [-1243.157] (-1252.877) * (-1255.571) [-1247.042] (-1248.759) (-1253.445) -- 0:00:07
949000 -- (-1249.209) (-1245.736) [-1245.035] (-1251.116) * [-1246.694] (-1244.893) (-1252.835) (-1247.685) -- 0:00:07
949500 -- (-1244.181) [-1245.689] (-1246.435) (-1249.445) * [-1248.724] (-1245.576) (-1252.946) (-1248.742) -- 0:00:07
950000 -- [-1245.378] (-1252.102) (-1253.987) (-1245.190) * [-1246.558] (-1248.445) (-1248.863) (-1249.343) -- 0:00:06
Average standard deviation of split frequencies: 0.000496
950500 -- (-1253.538) [-1249.609] (-1251.905) (-1242.685) * (-1247.606) (-1247.253) [-1252.597] (-1253.393) -- 0:00:06
951000 -- (-1251.254) (-1250.372) [-1245.255] (-1250.109) * (-1245.679) [-1242.772] (-1246.845) (-1248.535) -- 0:00:06
951500 -- (-1250.578) [-1244.528] (-1244.834) (-1248.282) * [-1246.823] (-1244.842) (-1250.857) (-1248.253) -- 0:00:06
952000 -- (-1247.840) [-1241.966] (-1244.761) (-1244.942) * [-1245.390] (-1248.429) (-1254.877) (-1243.799) -- 0:00:06
952500 -- (-1250.453) (-1245.154) [-1247.201] (-1247.436) * (-1247.564) (-1253.547) (-1242.650) [-1243.707] -- 0:00:06
953000 -- (-1259.725) [-1250.000] (-1244.756) (-1245.029) * (-1256.593) (-1250.454) (-1243.597) [-1242.397] -- 0:00:06
953500 -- (-1255.155) (-1245.402) [-1244.699] (-1252.514) * (-1245.443) (-1246.245) (-1246.967) [-1247.746] -- 0:00:06
954000 -- (-1254.474) (-1250.198) [-1248.745] (-1247.075) * (-1253.394) (-1247.970) [-1245.738] (-1249.013) -- 0:00:06
954500 -- (-1251.975) (-1246.339) (-1248.723) [-1244.053] * (-1249.839) (-1250.912) (-1252.672) [-1246.555] -- 0:00:06
955000 -- (-1256.219) (-1246.443) [-1253.347] (-1252.037) * [-1245.897] (-1253.347) (-1245.689) (-1247.550) -- 0:00:06
Average standard deviation of split frequencies: 0.000493
955500 -- (-1255.357) (-1251.763) [-1245.616] (-1259.488) * (-1252.831) (-1247.751) [-1250.390] (-1255.166) -- 0:00:06
956000 -- (-1248.599) [-1244.972] (-1246.919) (-1249.561) * [-1246.784] (-1244.931) (-1246.884) (-1244.404) -- 0:00:06
956500 -- (-1250.852) (-1247.093) (-1245.403) [-1248.464] * (-1251.359) (-1243.228) [-1248.659] (-1250.929) -- 0:00:06
957000 -- (-1249.770) [-1245.827] (-1249.806) (-1249.692) * (-1249.545) (-1245.676) (-1254.752) [-1249.472] -- 0:00:05
957500 -- (-1247.322) [-1246.440] (-1248.674) (-1254.535) * (-1250.828) (-1243.326) [-1246.562] (-1250.721) -- 0:00:05
958000 -- [-1251.084] (-1246.516) (-1246.156) (-1246.323) * (-1245.510) (-1257.729) (-1251.906) [-1248.355] -- 0:00:05
958500 -- (-1247.799) (-1249.403) [-1246.073] (-1246.829) * (-1245.068) [-1249.416] (-1247.564) (-1251.067) -- 0:00:05
959000 -- (-1256.975) (-1252.026) [-1252.418] (-1250.975) * (-1249.388) (-1259.733) [-1247.075] (-1243.077) -- 0:00:05
959500 -- (-1250.350) (-1253.851) (-1247.343) [-1249.362] * (-1244.829) (-1251.119) (-1249.279) [-1242.010] -- 0:00:05
960000 -- (-1249.246) (-1253.087) [-1242.984] (-1249.649) * (-1246.408) [-1249.168] (-1255.879) (-1243.625) -- 0:00:05
Average standard deviation of split frequencies: 0.000491
960500 -- (-1246.185) [-1247.249] (-1242.484) (-1245.485) * [-1248.650] (-1251.995) (-1254.736) (-1245.940) -- 0:00:05
961000 -- (-1244.359) (-1252.100) [-1248.583] (-1243.493) * (-1257.239) [-1246.016] (-1251.303) (-1248.746) -- 0:00:05
961500 -- [-1247.110] (-1250.750) (-1249.916) (-1247.463) * [-1249.476] (-1246.422) (-1251.424) (-1242.582) -- 0:00:05
962000 -- (-1249.336) [-1248.496] (-1244.308) (-1253.562) * (-1254.877) (-1249.181) (-1247.647) [-1241.195] -- 0:00:05
962500 -- (-1245.731) (-1251.849) [-1245.841] (-1253.028) * (-1253.168) (-1245.007) (-1250.919) [-1250.333] -- 0:00:05
963000 -- [-1247.472] (-1242.725) (-1249.650) (-1252.086) * (-1246.918) (-1250.933) [-1253.363] (-1246.506) -- 0:00:05
963500 -- (-1253.680) [-1240.970] (-1246.832) (-1249.561) * [-1245.505] (-1249.117) (-1254.434) (-1250.158) -- 0:00:05
964000 -- (-1253.106) [-1249.143] (-1249.648) (-1248.961) * [-1244.566] (-1247.128) (-1252.234) (-1245.837) -- 0:00:04
964500 -- [-1249.175] (-1247.700) (-1242.643) (-1243.740) * (-1251.503) (-1248.107) (-1254.195) [-1251.861] -- 0:00:04
965000 -- (-1248.015) [-1252.964] (-1249.750) (-1245.423) * (-1247.207) [-1244.247] (-1248.620) (-1251.173) -- 0:00:04
Average standard deviation of split frequencies: 0.000732
965500 -- [-1246.940] (-1254.819) (-1247.357) (-1251.547) * [-1244.018] (-1247.853) (-1247.975) (-1244.428) -- 0:00:04
966000 -- (-1249.185) (-1251.141) [-1245.365] (-1243.674) * (-1248.936) [-1242.716] (-1246.205) (-1248.848) -- 0:00:04
966500 -- (-1251.869) (-1246.112) (-1244.716) [-1246.895] * (-1247.700) (-1241.427) [-1245.013] (-1249.412) -- 0:00:04
967000 -- [-1249.011] (-1245.845) (-1251.533) (-1257.001) * (-1254.308) [-1249.584] (-1247.181) (-1248.827) -- 0:00:04
967500 -- (-1248.386) (-1245.867) (-1249.044) [-1248.558] * (-1250.532) (-1245.332) [-1241.971] (-1250.253) -- 0:00:04
968000 -- (-1250.193) (-1244.347) [-1246.185] (-1246.018) * [-1247.145] (-1245.804) (-1243.217) (-1249.439) -- 0:00:04
968500 -- (-1246.929) [-1246.583] (-1250.178) (-1251.000) * (-1250.989) [-1241.679] (-1243.816) (-1245.918) -- 0:00:04
969000 -- (-1247.974) [-1243.041] (-1249.856) (-1252.512) * [-1248.384] (-1251.645) (-1243.376) (-1244.780) -- 0:00:04
969500 -- (-1253.193) (-1245.638) (-1247.535) [-1248.929] * (-1256.088) (-1246.177) [-1248.727] (-1245.100) -- 0:00:04
970000 -- (-1245.084) (-1247.207) (-1250.292) [-1246.865] * (-1247.655) [-1246.122] (-1253.102) (-1247.342) -- 0:00:04
Average standard deviation of split frequencies: 0.000971
970500 -- (-1249.198) (-1255.912) (-1252.554) [-1243.365] * (-1252.183) (-1247.320) [-1246.843] (-1250.408) -- 0:00:04
971000 -- (-1246.366) (-1250.555) (-1252.709) [-1242.261] * (-1244.782) [-1247.534] (-1246.088) (-1243.391) -- 0:00:04
971500 -- (-1245.521) (-1245.977) [-1244.142] (-1250.247) * [-1249.248] (-1249.282) (-1248.964) (-1249.176) -- 0:00:03
972000 -- [-1245.410] (-1246.681) (-1255.236) (-1248.323) * [-1248.959] (-1245.530) (-1246.501) (-1248.401) -- 0:00:03
972500 -- (-1249.650) (-1247.111) [-1250.846] (-1247.605) * (-1244.169) [-1245.174] (-1244.337) (-1244.025) -- 0:00:03
973000 -- (-1248.142) [-1247.556] (-1245.431) (-1254.948) * (-1242.529) (-1246.012) [-1245.708] (-1245.057) -- 0:00:03
973500 -- (-1253.692) (-1244.841) [-1246.371] (-1243.758) * [-1246.358] (-1247.472) (-1246.052) (-1247.091) -- 0:00:03
974000 -- [-1250.429] (-1244.380) (-1245.658) (-1243.741) * (-1243.932) (-1246.740) (-1247.240) [-1244.398] -- 0:00:03
974500 -- (-1248.023) (-1244.379) (-1241.090) [-1249.448] * (-1243.219) [-1253.802] (-1243.265) (-1250.577) -- 0:00:03
975000 -- [-1247.656] (-1247.877) (-1245.999) (-1250.604) * (-1244.782) (-1252.220) [-1243.683] (-1252.385) -- 0:00:03
Average standard deviation of split frequencies: 0.000966
975500 -- [-1242.287] (-1243.777) (-1247.814) (-1255.200) * (-1254.252) (-1244.401) [-1246.051] (-1247.973) -- 0:00:03
976000 -- (-1243.485) (-1244.288) (-1248.673) [-1251.991] * [-1249.773] (-1246.451) (-1248.242) (-1247.458) -- 0:00:03
976500 -- (-1255.318) (-1251.987) [-1246.786] (-1251.800) * (-1249.042) (-1255.430) [-1251.786] (-1247.586) -- 0:00:03
977000 -- (-1248.171) (-1248.168) (-1248.169) [-1244.591] * (-1247.251) (-1246.870) (-1244.349) [-1239.971] -- 0:00:03
977500 -- [-1245.427] (-1248.411) (-1246.204) (-1244.519) * (-1254.651) [-1248.022] (-1248.803) (-1245.152) -- 0:00:03
978000 -- (-1248.691) (-1252.763) [-1247.356] (-1251.404) * (-1247.965) (-1250.512) (-1264.286) [-1247.918] -- 0:00:03
978500 -- [-1247.985] (-1245.265) (-1244.967) (-1251.566) * [-1251.424] (-1247.661) (-1251.321) (-1254.754) -- 0:00:02
979000 -- (-1246.927) (-1251.727) [-1247.869] (-1250.663) * (-1249.649) [-1246.099] (-1243.308) (-1248.491) -- 0:00:02
979500 -- (-1250.369) (-1245.319) [-1245.023] (-1258.591) * (-1252.520) (-1249.621) [-1246.176] (-1247.459) -- 0:00:02
980000 -- [-1245.181] (-1250.433) (-1253.392) (-1253.335) * [-1250.061] (-1252.737) (-1248.605) (-1252.945) -- 0:00:02
Average standard deviation of split frequencies: 0.000961
980500 -- [-1244.001] (-1251.723) (-1249.715) (-1249.712) * (-1248.268) (-1246.695) [-1246.524] (-1251.213) -- 0:00:02
981000 -- [-1251.666] (-1255.986) (-1251.870) (-1249.899) * (-1251.780) [-1244.981] (-1251.819) (-1253.613) -- 0:00:02
981500 -- (-1248.996) (-1246.319) (-1250.187) [-1249.790] * [-1246.880] (-1249.974) (-1247.085) (-1249.760) -- 0:00:02
982000 -- (-1252.935) [-1254.686] (-1249.292) (-1250.969) * (-1247.344) (-1254.398) (-1249.295) [-1250.249] -- 0:00:02
982500 -- (-1257.322) [-1253.300] (-1246.544) (-1245.571) * (-1249.237) (-1249.142) [-1250.571] (-1245.773) -- 0:00:02
983000 -- (-1243.539) [-1251.889] (-1256.371) (-1246.429) * [-1247.559] (-1249.594) (-1252.918) (-1242.252) -- 0:00:02
983500 -- (-1246.490) (-1248.449) [-1244.906] (-1246.357) * [-1244.953] (-1246.626) (-1252.590) (-1246.446) -- 0:00:02
984000 -- (-1252.481) (-1245.002) [-1246.795] (-1248.279) * [-1246.910] (-1247.226) (-1254.382) (-1249.458) -- 0:00:02
984500 -- [-1244.958] (-1246.531) (-1246.983) (-1241.251) * [-1245.451] (-1245.428) (-1250.680) (-1250.216) -- 0:00:02
985000 -- (-1249.516) (-1241.355) (-1245.221) [-1245.906] * [-1242.954] (-1250.147) (-1246.479) (-1261.621) -- 0:00:02
Average standard deviation of split frequencies: 0.000956
985500 -- [-1245.870] (-1256.100) (-1246.319) (-1244.280) * (-1243.186) (-1251.788) [-1246.929] (-1251.463) -- 0:00:02
986000 -- (-1250.943) (-1251.024) (-1244.325) [-1252.539] * [-1243.721] (-1246.551) (-1249.622) (-1247.064) -- 0:00:01
986500 -- (-1246.171) (-1247.451) [-1242.626] (-1244.015) * (-1245.543) (-1248.817) [-1246.011] (-1249.693) -- 0:00:01
987000 -- (-1252.984) (-1253.353) [-1243.998] (-1245.436) * (-1245.793) [-1246.683] (-1252.682) (-1250.922) -- 0:00:01
987500 -- (-1245.653) (-1256.726) [-1244.044] (-1246.438) * (-1247.235) (-1247.834) [-1244.402] (-1244.805) -- 0:00:01
988000 -- (-1252.047) (-1249.192) (-1249.729) [-1247.925] * (-1249.070) (-1249.359) [-1253.228] (-1248.296) -- 0:00:01
988500 -- (-1245.908) (-1250.942) [-1245.049] (-1244.693) * (-1253.712) (-1250.810) [-1245.212] (-1246.360) -- 0:00:01
989000 -- (-1244.877) (-1257.168) (-1243.207) [-1242.469] * (-1247.814) [-1249.666] (-1252.046) (-1248.233) -- 0:00:01
989500 -- [-1244.924] (-1251.626) (-1245.259) (-1250.682) * (-1246.138) [-1248.599] (-1253.385) (-1250.032) -- 0:00:01
990000 -- [-1244.115] (-1247.000) (-1241.128) (-1249.143) * (-1246.956) [-1247.534] (-1258.935) (-1251.944) -- 0:00:01
Average standard deviation of split frequencies: 0.000714
990500 -- (-1250.289) (-1248.906) [-1241.550] (-1250.406) * (-1249.456) [-1246.093] (-1243.725) (-1245.558) -- 0:00:01
991000 -- (-1247.802) (-1249.964) [-1249.281] (-1243.698) * (-1260.473) (-1243.474) (-1250.360) [-1253.779] -- 0:00:01
991500 -- [-1245.606] (-1254.592) (-1250.643) (-1244.951) * (-1250.034) (-1242.031) [-1250.283] (-1244.250) -- 0:00:01
992000 -- [-1248.424] (-1245.464) (-1248.326) (-1246.976) * [-1247.589] (-1242.884) (-1248.635) (-1244.225) -- 0:00:01
992500 -- (-1244.377) (-1253.484) [-1244.413] (-1243.727) * (-1251.322) [-1245.782] (-1250.197) (-1244.377) -- 0:00:01
993000 -- (-1242.282) (-1244.814) [-1248.565] (-1252.013) * (-1251.490) [-1249.440] (-1253.948) (-1247.886) -- 0:00:00
993500 -- (-1245.118) [-1244.806] (-1243.273) (-1253.457) * (-1255.377) (-1248.838) [-1250.902] (-1251.359) -- 0:00:00
994000 -- (-1244.697) [-1246.128] (-1254.100) (-1246.190) * [-1245.502] (-1246.901) (-1252.366) (-1252.467) -- 0:00:00
994500 -- (-1246.119) [-1243.637] (-1248.641) (-1245.676) * [-1246.911] (-1248.114) (-1248.444) (-1248.123) -- 0:00:00
995000 -- (-1244.831) (-1246.177) (-1243.813) [-1245.290] * (-1250.803) (-1254.108) [-1245.064] (-1251.316) -- 0:00:00
Average standard deviation of split frequencies: 0.000710
995500 -- (-1242.800) (-1253.609) (-1251.607) [-1248.193] * (-1253.747) (-1250.913) [-1243.613] (-1251.730) -- 0:00:00
996000 -- (-1242.440) [-1248.249] (-1247.046) (-1245.056) * (-1246.604) (-1254.230) [-1257.654] (-1251.559) -- 0:00:00
996500 -- [-1244.312] (-1249.231) (-1248.705) (-1247.083) * (-1245.600) (-1249.826) [-1252.176] (-1247.850) -- 0:00:00
997000 -- [-1251.376] (-1259.098) (-1246.147) (-1251.772) * [-1253.618] (-1255.727) (-1248.874) (-1249.661) -- 0:00:00
997500 -- [-1245.559] (-1259.650) (-1255.096) (-1241.828) * (-1249.846) [-1245.952] (-1248.026) (-1249.336) -- 0:00:00
998000 -- [-1246.355] (-1248.162) (-1247.271) (-1241.860) * (-1243.455) (-1251.144) [-1242.592] (-1253.539) -- 0:00:00
998500 -- (-1250.815) (-1245.387) [-1248.194] (-1246.225) * (-1253.450) (-1248.447) [-1245.516] (-1247.336) -- 0:00:00
999000 -- (-1257.360) [-1248.487] (-1247.824) (-1243.234) * (-1255.295) [-1243.627] (-1251.354) (-1256.221) -- 0:00:00
999500 -- (-1258.125) (-1259.266) [-1241.959] (-1248.200) * [-1255.516] (-1248.715) (-1249.255) (-1247.329) -- 0:00:00
1000000 -- (-1255.368) (-1251.393) (-1246.948) [-1250.673] * (-1252.838) (-1244.660) [-1252.203] (-1246.432) -- 0:00:00
Average standard deviation of split frequencies: 0.000707
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1255.367583 -- 12.056075
Chain 1 -- -1255.367583 -- 12.056075
Chain 2 -- -1251.393178 -- 14.379812
Chain 2 -- -1251.393179 -- 14.379812
Chain 3 -- -1246.947552 -- 15.911392
Chain 3 -- -1246.947552 -- 15.911392
Chain 4 -- -1250.672621 -- 16.693615
Chain 4 -- -1250.672621 -- 16.693615
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1252.837653 -- 15.620495
Chain 1 -- -1252.837653 -- 15.620495
Chain 2 -- -1244.659520 -- 15.209595
Chain 2 -- -1244.659520 -- 15.209595
Chain 3 -- -1252.203488 -- 14.682059
Chain 3 -- -1252.203488 -- 14.682059
Chain 4 -- -1246.431817 -- 16.647494
Chain 4 -- -1246.431817 -- 16.647494
Analysis completed in 2 mins 18 seconds
Analysis used 138.41 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1239.14
Likelihood of best state for "cold" chain of run 2 was -1238.56
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
61.4 % ( 56 %) Dirichlet(Revmat{all})
78.2 % ( 68 %) Slider(Revmat{all})
28.3 % ( 32 %) Dirichlet(Pi{all})
30.2 % ( 26 %) Slider(Pi{all})
67.1 % ( 34 %) Multiplier(Alpha{1,2})
50.8 % ( 23 %) Multiplier(Alpha{3})
60.2 % ( 28 %) Slider(Pinvar{all})
0.9 % ( 0 %) ExtSPR(Tau{all},V{all})
0.8 % ( 4 %) ExtTBR(Tau{all},V{all})
0.8 % ( 0 %) NNI(Tau{all},V{all})
1.1 % ( 4 %) ParsSPR(Tau{all},V{all})
26.5 % ( 26 %) Multiplier(V{all})
39.5 % ( 34 %) Nodeslider(V{all})
26.4 % ( 29 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
61.1 % ( 50 %) Dirichlet(Revmat{all})
76.7 % ( 66 %) Slider(Revmat{all})
28.5 % ( 27 %) Dirichlet(Pi{all})
30.7 % ( 28 %) Slider(Pi{all})
67.8 % ( 45 %) Multiplier(Alpha{1,2})
51.2 % ( 31 %) Multiplier(Alpha{3})
60.8 % ( 27 %) Slider(Pinvar{all})
0.7 % ( 3 %) ExtSPR(Tau{all},V{all})
0.8 % ( 3 %) ExtTBR(Tau{all},V{all})
0.8 % ( 2 %) NNI(Tau{all},V{all})
1.0 % ( 4 %) ParsSPR(Tau{all},V{all})
26.5 % ( 28 %) Multiplier(V{all})
39.3 % ( 39 %) Nodeslider(V{all})
26.7 % ( 27 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.82 0.68 0.55
2 | 166912 0.84 0.70
3 | 166320 166439 0.85
4 | 166576 167333 166420
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.83 0.67 0.54
2 | 166721 0.84 0.70
3 | 166700 166467 0.85
4 | 166962 166890 166260
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1246.00
| 2 2 2 2 2 1|
| 1 1 2 1 2 1 1 1 |
| 1 2 1 1 1 2 2 2 |
| 1 2 1 2 2 11 1 * 2 |
| 1 1 1 11 * 1 *2 |
| 22 2 2 1 21 2 2 1 2 1 1 11 |
| 122 2 2 * 2 2 1 11 21 1 |
|2 1 1 2 2 2 1 12 2 2 21 |
| 1 2 1 22 1 2 2 |
| 22 1 2 1 2 2 |
| 1 1 2 1 1 |
|11 2 1 2 1 2 2 |
| 1 1 2|
| 2 |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1249.09
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1244.29 -1253.45
2 -1244.10 -1255.21
--------------------------------------
TOTAL -1244.19 -1254.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.263367 0.004237 0.151082 0.388468 0.253370 943.49 1146.96 1.001
r(A<->C){all} 0.058351 0.001101 0.001309 0.120029 0.054139 780.12 873.36 1.001
r(A<->G){all} 0.257326 0.006266 0.115638 0.412947 0.248320 572.87 583.65 1.003
r(A<->T){all} 0.071954 0.001267 0.010794 0.142247 0.067106 721.46 762.16 1.000
r(C<->G){all} 0.167778 0.002878 0.066130 0.273326 0.163775 518.00 713.84 1.000
r(C<->T){all} 0.412161 0.006623 0.254416 0.574266 0.410864 504.70 549.20 1.002
r(G<->T){all} 0.032430 0.000732 0.000009 0.086177 0.025601 883.70 906.67 1.000
pi(A){all} 0.293465 0.000325 0.256516 0.327131 0.293080 1257.57 1311.51 1.001
pi(C){all} 0.271545 0.000302 0.239601 0.306537 0.271232 1238.94 1337.34 1.000
pi(G){all} 0.225372 0.000264 0.193058 0.255462 0.225002 880.59 1050.18 1.000
pi(T){all} 0.209618 0.000242 0.178262 0.239034 0.209108 1336.86 1354.10 1.000
alpha{1,2} 0.061454 0.002294 0.000115 0.143702 0.051878 1350.53 1425.77 1.000
alpha{3} 1.745881 0.546862 0.463289 3.164939 1.618189 1194.51 1347.75 1.000
pinvar{all} 0.547706 0.011068 0.330004 0.718701 0.564737 977.51 1068.80 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------
1 -- .****
2 -- .*...
3 -- ..*..
4 -- ...*.
5 -- ....*
6 -- ...**
7 -- .**..
-----------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
6 3002 1.000000 0.000000 1.000000 1.000000 2
7 2967 0.988341 0.001413 0.987342 0.989340 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
------------------------------------------------------------------------------------------
length{all}[1] 0.027594 0.000165 0.006436 0.053165 0.025780 1.000 2
length{all}[2] 0.008673 0.000028 0.000663 0.019205 0.007639 1.000 2
length{all}[3] 0.011469 0.000036 0.002294 0.024086 0.010438 1.000 2
length{all}[4] 0.061795 0.000559 0.019852 0.106168 0.057680 1.000 2
length{all}[5] 0.050568 0.000475 0.016183 0.090974 0.046385 1.000 2
length{all}[6] 0.079721 0.001159 0.027852 0.147375 0.072430 1.001 2
length{all}[7] 0.023744 0.000133 0.003788 0.046850 0.021773 1.000 2
------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.000707
Maximum standard deviation of split frequencies = 0.001413
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.001
Clade credibility values:
/------------------------------------------------------------------------ C1 (1)
|
| /------------------------------------ C4 (4)
|----------------100----------------+
+ \------------------------------------ C5 (5)
|
| /------------------------------------ C2 (2)
\-----------------99----------------+
\------------------------------------ C3 (3)
Phylogram (based on average branch lengths):
/-------------- C1 (1)
|
| /-------------------------------- C4 (4)
|---------------------------------------+
+ \-------------------------- C5 (5)
|
| /---- C2 (2)
\-----------+
\------ C3 (3)
|----------| 0.020 expected changes per site
Calculating tree probabilities...
Credible sets of trees (3 trees sampled):
99 % credible set contains 2 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 5 ls = 603
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Sequences read..
Counting site patterns.. 0:00
112 patterns at 201 / 201 sites (100.0%), 0:00
Counting codons..
80 bytes for distance
109312 bytes for conP
15232 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, (4, 5), (2, 3)); MP score: 73
163968 bytes for conP, adjusted
0.049721 0.086332 0.091865 0.087401 0.040994 0.017700 0.017526 0.300000 1.300000
ntime & nrate & np: 7 2 9
Bounds (np=9):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 9
lnL0 = -1295.189289
Iterating by ming2
Initial: fx= 1295.189289
x= 0.04972 0.08633 0.09187 0.08740 0.04099 0.01770 0.01753 0.30000 1.30000
1 h-m-p 0.0000 0.0040 121.6186 ++++YYCCC 1278.233375 4 0.0023 24 | 0/9
2 h-m-p 0.0002 0.0008 800.6385 +YCCCC 1267.286489 4 0.0004 44 | 0/9
3 h-m-p 0.0002 0.0011 324.2777 +YYCCCC 1257.344526 5 0.0007 65 | 0/9
4 h-m-p 0.0000 0.0002 1204.3972 CYCC 1255.622883 3 0.0000 82 | 0/9
5 h-m-p 0.0004 0.0023 122.1949 YCCCC 1254.589585 4 0.0003 101 | 0/9
6 h-m-p 0.0006 0.0039 62.3790 CCCCC 1253.341895 4 0.0010 121 | 0/9
7 h-m-p 0.0004 0.0062 158.3099 +CYYCYCYCCC 1217.672946 9 0.0054 149 | 0/9
8 h-m-p 0.0001 0.0003 395.7031 YYCC 1217.278066 3 0.0001 165 | 0/9
9 h-m-p 0.0097 0.0569 2.3039 CCC 1217.234865 2 0.0030 181 | 0/9
10 h-m-p 0.0062 0.1350 1.1140 +CCCC 1214.960141 3 0.0389 200 | 0/9
11 h-m-p 0.4205 2.1025 0.0908 YCCC 1211.382869 3 0.7674 217 | 0/9
12 h-m-p 1.1467 5.7337 0.0237 CYCCC 1209.477502 4 2.0036 245 | 0/9
13 h-m-p 0.8775 4.5983 0.0541 CCCC 1209.148517 3 1.0284 272 | 0/9
14 h-m-p 0.9074 8.0000 0.0614 +YCCC 1208.746186 3 2.2857 299 | 0/9
15 h-m-p 1.6000 8.0000 0.0751 CCC 1208.420516 2 2.1986 324 | 0/9
16 h-m-p 1.6000 8.0000 0.0704 CCC 1208.268963 2 1.4393 349 | 0/9
17 h-m-p 1.6000 8.0000 0.0427 YCC 1208.237064 2 0.7560 373 | 0/9
18 h-m-p 1.0343 8.0000 0.0312 CCC 1208.203956 2 1.6292 398 | 0/9
19 h-m-p 1.6000 8.0000 0.0024 CC 1208.200339 1 1.4056 421 | 0/9
20 h-m-p 1.6000 8.0000 0.0018 CC 1208.199942 1 2.0792 444 | 0/9
21 h-m-p 1.6000 8.0000 0.0018 C 1208.199886 0 1.6970 465 | 0/9
22 h-m-p 1.6000 8.0000 0.0002 Y 1208.199885 0 1.1174 486 | 0/9
23 h-m-p 1.6000 8.0000 0.0000 Y 1208.199885 0 1.1536 507 | 0/9
24 h-m-p 1.6000 8.0000 0.0000 Y 1208.199885 0 0.8605 528 | 0/9
25 h-m-p 1.2373 8.0000 0.0000 Y 1208.199885 0 1.2373 549 | 0/9
26 h-m-p 1.6000 8.0000 0.0000 Y 1208.199885 0 1.6000 570 | 0/9
27 h-m-p 1.6000 8.0000 0.0000 C 1208.199885 0 0.4000 591
Out..
lnL = -1208.199885
592 lfun, 592 eigenQcodon, 4144 P(t)
Time used: 0:02
Model 1: NearlyNeutral
TREE # 1
(1, (4, 5), (2, 3)); MP score: 73
0.049721 0.086332 0.091865 0.087401 0.040994 0.017700 0.017526 1.681148 0.573207 0.492243
ntime & nrate & np: 7 2 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 6.680323
np = 10
lnL0 = -1230.928860
Iterating by ming2
Initial: fx= 1230.928860
x= 0.04972 0.08633 0.09187 0.08740 0.04099 0.01770 0.01753 1.68115 0.57321 0.49224
1 h-m-p 0.0000 0.0046 44.0652 +++CCCC 1229.989351 3 0.0010 24 | 0/10
2 h-m-p 0.0002 0.0010 136.7233 CYCCC 1228.885339 4 0.0004 44 | 0/10
3 h-m-p 0.0001 0.0015 368.7933 +CYCYCCC 1214.683386 6 0.0012 69 | 0/10
4 h-m-p 0.0000 0.0001 1927.8840 CCCCC 1214.148012 4 0.0000 90 | 0/10
5 h-m-p 0.0001 0.0007 43.5744 YYC 1214.084107 2 0.0001 105 | 0/10
6 h-m-p 0.0006 0.0132 8.9926 CCC 1214.048755 2 0.0008 122 | 0/10
7 h-m-p 0.0005 0.0203 13.4469 ++CCCC 1213.459153 3 0.0101 143 | 0/10
8 h-m-p 0.0035 0.0320 38.2667 CCCC 1212.779923 3 0.0044 162 | 0/10
9 h-m-p 0.0009 0.0091 179.2511 +YYYYCCC 1210.014693 6 0.0038 184 | 0/10
10 h-m-p 0.0070 0.0349 5.3540 YC 1209.999523 1 0.0011 198 | 0/10
11 h-m-p 0.0098 3.2341 0.6025 +++YCCCC 1206.589309 4 1.2629 221 | 0/10
12 h-m-p 0.8778 4.3889 0.4530 YYYC 1205.945583 3 0.8008 247 | 0/10
13 h-m-p 1.1529 5.7647 0.1521 YCC 1205.762736 2 0.7889 273 | 0/10
14 h-m-p 1.6000 8.0000 0.0102 CCC 1205.713126 2 1.3316 300 | 0/10
15 h-m-p 1.6000 8.0000 0.0048 YC 1205.702469 1 1.1153 324 | 0/10
16 h-m-p 1.6000 8.0000 0.0023 CC 1205.700399 1 1.2817 349 | 0/10
17 h-m-p 0.4500 8.0000 0.0066 +YC 1205.699126 1 1.4618 374 | 0/10
18 h-m-p 1.6000 8.0000 0.0055 YC 1205.698877 1 1.0454 398 | 0/10
19 h-m-p 1.6000 8.0000 0.0005 C 1205.698798 0 1.4465 421 | 0/10
20 h-m-p 1.6000 8.0000 0.0003 Y 1205.698792 0 0.8587 444 | 0/10
21 h-m-p 1.6000 8.0000 0.0000 Y 1205.698792 0 0.9196 467 | 0/10
22 h-m-p 1.6000 8.0000 0.0000 Y 1205.698792 0 0.9047 490 | 0/10
23 h-m-p 1.6000 8.0000 0.0000 Y 1205.698792 0 0.4000 513 | 0/10
24 h-m-p 0.8430 8.0000 0.0000 -Y 1205.698792 0 0.0527 537 | 0/10
25 h-m-p 0.0676 8.0000 0.0000 Y 1205.698792 0 0.0676 560 | 0/10
26 h-m-p 0.0430 8.0000 0.0000 --------------.. | 0/10
27 h-m-p 0.0160 8.0000 0.0002 ------------- | 0/10
28 h-m-p 0.0160 8.0000 0.0002 -------------
Out..
lnL = -1205.698792
664 lfun, 1992 eigenQcodon, 9296 P(t)
Time used: 0:04
Model 2: PositiveSelection
TREE # 1
(1, (4, 5), (2, 3)); MP score: 73
initial w for M2:NSpselection reset.
0.049721 0.086332 0.091865 0.087401 0.040994 0.017700 0.017526 1.735217 0.986220 0.117156 0.463564 2.408838
ntime & nrate & np: 7 3 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 5.141173
np = 12
lnL0 = -1238.193486
Iterating by ming2
Initial: fx= 1238.193486
x= 0.04972 0.08633 0.09187 0.08740 0.04099 0.01770 0.01753 1.73522 0.98622 0.11716 0.46356 2.40884
1 h-m-p 0.0000 0.0193 52.0211 +++YCCC 1237.701220 3 0.0004 37 | 0/12
2 h-m-p 0.0003 0.0016 81.6757 CCCC 1237.055752 3 0.0004 70 | 0/12
3 h-m-p 0.0004 0.0018 82.5115 YCCCC 1236.236807 4 0.0007 104 | 0/12
4 h-m-p 0.0002 0.0012 365.0510 +CYCCCC 1230.845304 5 0.0008 141 | 0/12
5 h-m-p 0.0000 0.0001 1853.4625 ++ 1226.539404 m 0.0001 168 | 1/12
6 h-m-p 0.0006 0.0084 122.4905 YCCC 1226.396310 3 0.0003 200 | 1/12
7 h-m-p 0.0017 0.0715 19.8667 ++CCYC 1222.328531 3 0.0276 233 | 1/12
8 h-m-p 0.0007 0.0037 255.4997 YCYCCC 1218.760784 5 0.0017 267 | 1/12
9 h-m-p 0.0028 0.0138 37.6758 YCC 1218.311158 2 0.0019 296 | 1/12
10 h-m-p 0.0038 0.1605 19.2282 ++YYYCCCC 1212.688068 6 0.0615 333 | 1/12
11 h-m-p 0.1780 0.8899 0.8915 +YCC 1210.416137 2 0.7633 363 | 1/12
12 h-m-p 0.0165 0.0825 1.4399 ++ 1210.197018 m 0.0825 389 | 2/12
13 h-m-p 0.0085 0.4333 7.6013 +YCCC 1209.519408 3 0.0824 421 | 2/12
14 h-m-p 0.5280 2.6402 1.0280 CCCCC 1208.258261 4 0.6638 454 | 2/12
15 h-m-p 1.6000 8.0000 0.2103 CYC 1207.340521 2 1.7585 482 | 1/12
16 h-m-p 0.0018 0.0161 209.0804 YCCCC 1206.789202 4 0.0011 514 | 1/12
17 h-m-p 0.3249 3.7492 0.7053 YCCC 1205.977919 3 0.8341 545 | 1/12
18 h-m-p 1.6000 8.0000 0.1506 YCCC 1205.801466 3 0.8462 576 | 1/12
19 h-m-p 1.6000 8.0000 0.0642 CC 1205.714594 1 1.3911 604 | 1/12
20 h-m-p 1.3580 8.0000 0.0657 YC 1205.700490 1 0.9347 631 | 1/12
21 h-m-p 1.6000 8.0000 0.0222 YC 1205.698856 1 0.8875 658 | 1/12
22 h-m-p 1.6000 8.0000 0.0011 Y 1205.698801 0 1.1055 684 | 1/12
23 h-m-p 1.6000 8.0000 0.0002 C 1205.698798 0 2.0462 710 | 1/12
24 h-m-p 0.8289 8.0000 0.0004 +Y 1205.698792 0 4.5420 737 | 1/12
25 h-m-p 1.6000 8.0000 0.0003 Y 1205.698792 0 1.1757 763 | 1/12
26 h-m-p 1.6000 8.0000 0.0000 Y 1205.698792 0 1.0000 789 | 1/12
27 h-m-p 1.6000 8.0000 0.0000 Y 1205.698792 0 0.8497 815 | 1/12
28 h-m-p 1.6000 8.0000 0.0000 C 1205.698792 0 1.6132 841 | 1/12
29 h-m-p 1.6000 8.0000 0.0000 Y 1205.698792 0 0.4000 867 | 1/12
30 h-m-p 0.7138 8.0000 0.0000 --------------Y 1205.698792 0 0.0000 907
Out..
lnL = -1205.698792
908 lfun, 3632 eigenQcodon, 19068 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1214.255022 S = -1154.625812 -51.877000
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 112 patterns 0:10
did 20 / 112 patterns 0:10
did 30 / 112 patterns 0:10
did 40 / 112 patterns 0:10
did 50 / 112 patterns 0:10
did 60 / 112 patterns 0:10
did 70 / 112 patterns 0:11
did 80 / 112 patterns 0:11
did 90 / 112 patterns 0:11
did 100 / 112 patterns 0:11
did 110 / 112 patterns 0:11
did 112 / 112 patterns 0:11
Time used: 0:11
Model 3: discrete
TREE # 1
(1, (4, 5), (2, 3)); MP score: 73
0.049721 0.086332 0.091865 0.087401 0.040994 0.017700 0.017526 1.735217 0.331355 0.382499 0.069405 0.173263 0.290109
ntime & nrate & np: 7 4 13
Bounds (np=13):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 14.081246
np = 13
lnL0 = -1208.017670
Iterating by ming2
Initial: fx= 1208.017670
x= 0.04972 0.08633 0.09187 0.08740 0.04099 0.01770 0.01753 1.73522 0.33136 0.38250 0.06940 0.17326 0.29011
1 h-m-p 0.0000 0.0030 41.2494 ++YCCC 1207.720059 3 0.0004 38 | 0/13
2 h-m-p 0.0003 0.0014 47.6114 CC 1207.531928 1 0.0003 69 | 0/13
3 h-m-p 0.0005 0.0023 29.1877 +CCC 1207.110998 2 0.0016 103 | 0/13
4 h-m-p 0.0000 0.0002 103.1389 ++ 1206.917841 m 0.0002 132 | 1/13
5 h-m-p 0.0004 0.0061 24.6565 +CCC 1206.750845 2 0.0015 166 | 1/13
6 h-m-p 0.0008 0.0041 31.8168 YCC 1206.682110 2 0.0006 197 | 1/13
7 h-m-p 0.0007 0.0056 25.6576 YCCC 1206.540635 3 0.0015 230 | 1/13
8 h-m-p 0.0004 0.0019 63.2772 +YC 1206.126794 1 0.0017 260 | 1/13
9 h-m-p 0.0003 0.0014 13.6250 +YC 1206.098432 1 0.0007 290 | 1/13
10 h-m-p 0.0068 0.6329 1.4736 +CYC 1205.974739 2 0.0349 322 | 0/13
11 h-m-p 0.0023 0.0114 5.6587 ++ 1205.888015 m 0.0114 350 | 1/13
12 h-m-p 0.0599 0.6369 1.0256 +YCCC 1205.629602 3 0.3957 385 | 1/13
13 h-m-p 0.0352 0.1761 0.8451 ++ 1205.503291 m 0.1761 413 | 2/13
14 h-m-p 0.0732 3.9386 2.0229 YYCC 1205.480385 3 0.1116 445 | 2/13
15 h-m-p 0.4153 6.5533 0.5434 YCCC 1205.457148 3 0.2361 477 | 2/13
16 h-m-p 1.6000 8.0000 0.0475 YC 1205.444296 1 0.8690 505 | 2/13
17 h-m-p 0.6895 8.0000 0.0598 YC 1205.441303 1 1.4738 533 | 2/13
18 h-m-p 1.6000 8.0000 0.0119 CC 1205.440724 1 1.3095 562 | 2/13
19 h-m-p 1.6000 8.0000 0.0020 Y 1205.440705 0 1.2104 589 | 2/13
20 h-m-p 1.6000 8.0000 0.0007 C 1205.440704 0 1.4828 616 | 2/13
21 h-m-p 1.6000 8.0000 0.0001 Y 1205.440704 0 0.9841 643 | 2/13
22 h-m-p 1.6000 8.0000 0.0000 Y 1205.440704 0 1.2784 670 | 2/13
23 h-m-p 1.6000 8.0000 0.0000 Y 1205.440704 0 1.6000 697 | 2/13
24 h-m-p 1.6000 8.0000 0.0000 C 1205.440704 0 0.4000 724 | 2/13
25 h-m-p 0.7645 8.0000 0.0000 ---C 1205.440704 0 0.0030 754
Out..
lnL = -1205.440704
755 lfun, 3020 eigenQcodon, 15855 P(t)
Time used: 0:15
Model 7: beta
TREE # 1
(1, (4, 5), (2, 3)); MP score: 73
0.049721 0.086332 0.091865 0.087401 0.040994 0.017700 0.017526 1.705678 0.665673 1.549129
ntime & nrate & np: 7 1 10
Bounds (np=10):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 11.116347
np = 10
lnL0 = -1211.366754
Iterating by ming2
Initial: fx= 1211.366754
x= 0.04972 0.08633 0.09187 0.08740 0.04099 0.01770 0.01753 1.70568 0.66567 1.54913
1 h-m-p 0.0000 0.0087 40.5812 +++YCCC 1211.050361 3 0.0004 33 | 0/10
2 h-m-p 0.0003 0.0013 52.1872 YYCC 1210.872492 3 0.0002 60 | 0/10
3 h-m-p 0.0004 0.0036 35.3802 YCC 1210.681197 2 0.0006 86 | 0/10
4 h-m-p 0.0002 0.0023 123.3534 +YYYYY 1209.889530 4 0.0007 114 | 0/10
5 h-m-p 0.0004 0.0026 233.0194 +YYCCCC 1206.627845 5 0.0012 146 | 0/10
6 h-m-p 0.0003 0.0017 80.1751 YYYC 1206.412416 3 0.0003 172 | 0/10
7 h-m-p 0.0050 0.0297 5.3925 YC 1206.402333 1 0.0007 196 | 0/10
8 h-m-p 0.0020 0.2378 1.9524 YC 1206.399323 1 0.0013 220 | 0/10
9 h-m-p 0.0011 0.5525 2.3949 +++CYC 1206.194725 2 0.0768 249 | 0/10
10 h-m-p 0.3221 3.2922 0.5712 CCCC 1205.891283 3 0.4280 278 | 0/10
11 h-m-p 0.5403 5.3360 0.4525 YCC 1205.811150 2 0.3493 304 | 0/10
12 h-m-p 1.2771 8.0000 0.1237 +CYCC 1205.662510 3 5.5517 333 | 0/10
13 h-m-p 0.2217 1.1083 1.0455 CYCYC 1205.566659 4 0.3945 362 | 0/10
14 h-m-p 1.6000 8.0000 0.1023 YCC 1205.540541 2 0.7419 388 | 0/10
15 h-m-p 1.3730 8.0000 0.0553 YC 1205.533905 1 0.6852 412 | 0/10
16 h-m-p 1.6000 8.0000 0.0071 YC 1205.533471 1 0.9104 436 | 0/10
17 h-m-p 1.6000 8.0000 0.0035 C 1205.533469 0 0.4652 459 | 0/10
18 h-m-p 1.6000 8.0000 0.0005 Y 1205.533468 0 0.8652 482 | 0/10
19 h-m-p 1.6000 8.0000 0.0000 Y 1205.533468 0 0.8993 505 | 0/10
20 h-m-p 1.6000 8.0000 0.0000 C 1205.533468 0 0.4000 528 | 0/10
21 h-m-p 0.5978 8.0000 0.0000 Y 1205.533468 0 0.5978 551 | 0/10
22 h-m-p 1.1960 8.0000 0.0000 ----------------.. | 0/10
23 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -1205.533468
623 lfun, 6853 eigenQcodon, 43610 P(t)
Time used: 0:28
Model 8: beta&w>1
TREE # 1
(1, (4, 5), (2, 3)); MP score: 73
initial w for M8:NSbetaw>1 reset.
0.049721 0.086332 0.091865 0.087401 0.040994 0.017700 0.017526 1.708667 0.900000 0.401601 1.403915 2.022819
ntime & nrate & np: 7 2 12
Bounds (np=12):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 9.512958
np = 12
lnL0 = -1213.440187
Iterating by ming2
Initial: fx= 1213.440187
x= 0.04972 0.08633 0.09187 0.08740 0.04099 0.01770 0.01753 1.70867 0.90000 0.40160 1.40392 2.02282
1 h-m-p 0.0000 0.0015 91.6737 +++CC 1210.622048 1 0.0007 34 | 0/12
2 h-m-p 0.0001 0.0004 169.4018 ++ 1208.208688 m 0.0004 61 | 1/12
3 h-m-p 0.0004 0.0018 43.1960 CCCCC 1207.809650 4 0.0005 96 | 1/12
4 h-m-p 0.0002 0.0010 99.7128 CCCCC 1207.362384 4 0.0003 130 | 1/12
5 h-m-p 0.0003 0.0029 97.8208 YCCC 1206.611230 3 0.0006 161 | 1/12
6 h-m-p 0.0009 0.0054 60.6122 YYCC 1206.183231 3 0.0007 191 | 1/12
7 h-m-p 0.0031 0.0156 12.8937 CC 1206.114984 1 0.0009 219 | 1/12
8 h-m-p 0.0010 0.0229 11.5662 CCC 1206.035522 2 0.0014 249 | 1/12
9 h-m-p 0.0047 0.0545 3.4914 YC 1206.029410 1 0.0009 276 | 0/12
10 h-m-p 0.0005 0.1405 7.2429 YCC 1206.010600 2 0.0007 305 | 0/12
11 h-m-p 0.0058 0.6778 0.9093 +++YCCC 1205.800120 3 0.2430 340 | 0/12
12 h-m-p 0.3208 1.6039 0.5420 CCC 1205.727437 2 0.3411 371 | 0/12
13 h-m-p 0.7326 6.5428 0.2524 +YYCCC 1205.617449 4 2.3032 405 | 0/12
14 h-m-p 0.5687 2.8434 0.3133 CYCCC 1205.557053 4 1.1404 439 | 0/12
15 h-m-p 0.2436 1.2178 0.0220 ++ 1205.535555 m 1.2178 466 | 1/12
16 h-m-p 1.6000 8.0000 0.0122 C 1205.534285 0 0.4000 493 | 1/12
17 h-m-p 0.1344 8.0000 0.0364 +CC 1205.533600 1 0.6653 522 | 1/12
18 h-m-p 1.3285 8.0000 0.0183 YC 1205.533509 1 0.5886 549 | 1/12
19 h-m-p 1.6000 8.0000 0.0024 Y 1205.533495 0 0.7925 575 | 1/12
20 h-m-p 1.6000 8.0000 0.0001 Y 1205.533495 0 1.0403 601 | 1/12
21 h-m-p 1.4913 8.0000 0.0001 Y 1205.533495 0 3.5044 627 | 1/12
22 h-m-p 1.0861 8.0000 0.0003 ++ 1205.533495 m 8.0000 653 | 1/12
23 h-m-p 0.0122 1.3913 0.2120 ++++ 1205.533477 m 1.3913 681 | 2/12
24 h-m-p 1.0400 8.0000 0.0003 C 1205.533471 0 1.0015 707 | 2/12
25 h-m-p 1.6000 8.0000 0.0000 Y 1205.533471 0 1.0158 732 | 2/12
26 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/12
27 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -1205.533471
808 lfun, 9696 eigenQcodon, 62216 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1213.049308 S = -1154.808269 -51.121271
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 112 patterns 0:47
did 20 / 112 patterns 0:47
did 30 / 112 patterns 0:48
did 40 / 112 patterns 0:48
did 50 / 112 patterns 0:48
did 60 / 112 patterns 0:48
did 70 / 112 patterns 0:48
did 80 / 112 patterns 0:48
did 90 / 112 patterns 0:49
did 100 / 112 patterns 0:49
did 110 / 112 patterns 0:49
did 112 / 112 patterns 0:49
Time used: 0:49
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=201
D_melanogaster_ac-PA MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
D_sechellia_ac-PA MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
D_simulans_ac-PA MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
D_yakuba_ac-PA MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
D_erecta_ac-PA MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
****.**:*:* *******..*****************************
D_melanogaster_ac-PA IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
D_sechellia_ac-PA IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
D_simulans_ac-PA IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
D_yakuba_ac-PA IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
D_erecta_ac-PA IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
**************************************************
D_melanogaster_ac-PA KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
D_sechellia_ac-PA KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
D_simulans_ac-PA KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
D_yakuba_ac-PA KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
D_erecta_ac-PA KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
****:*:**************::***:*: ******** ***** ****:
D_melanogaster_ac-PA PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
D_sechellia_ac-PA PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
D_simulans_ac-PA PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
D_yakuba_ac-PA PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
D_erecta_ac-PA PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
* **********.*::******:***************************
D_melanogaster_ac-PA L
D_sechellia_ac-PA L
D_simulans_ac-PA L
D_yakuba_ac-PA L
D_erecta_ac-PA L
*
>D_melanogaster_ac-PA ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGACGAGGAGTC ATCTTCGGCCTTTAATGGACCCTCTGTTATCCGGAGAAATGCCCGGGAAC GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT ATCCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG AAACAGAAACAGTTGCATTTGCAGCAGCAACATTTGCACTTTCAGCAGCA GCAACAGCATCAACACTTATACGCCTGGCACCAAGAGTTGCAGTTGCAAT CTCCAACTGGCAGCACAAGTTCCTGCAACAGCATTAGCTCTTATTGCAAG CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTTCATAC CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG GTACTGAAGATGAGGACATCCTCGACTATATATCACTCTGGCAGGACGAC CTG >D_sechellia_ac-PA ATGGCTTTGGGCGGCGAAAATCACTCTGTTTTCAACGACGATGAGGAGTC ATCTTCGCCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG TGGAGTACATACGACGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTCCACAC CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC CTG >D_simulans_ac-PA ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGATGAGGAATC ATCTTCGGCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAGCAT ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG TGGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTACGAATTTCCACAC CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC CTG >D_yakuba_ac-PA ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCTACGACGACGAGGAGTC ATCTTCTCCCGTCAATGGACCCTCTGTTATCCGGCGAAATGCCCGGGAAC GCAACCGCGTAAAGCAGGTCAACAACGGCTTCAGCCAACTACGACAACAT ATTCCTGCGGCCGTAATTGCCGATTTGAGCAACGGTCGCCGGGGAATTGG TCCAGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAGATGGCAG TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG AAGCAGAAACAGATGCACATGCAGCAGCAGCATTTGCACTTTCAGCAGCA GCAACAGCATCAACACTTTTACGCCTGGCAGCAGCAGTCGCAGCTGCAAT CCCCCACTGGCAGCATAAGTTCCTGCAATAGCAGCAGCTCCTATTGCGAG CCAGCAACATCGACGATTCCAGGAGCAACACCTCCTACCAATTTGTATAC CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG GTACTGAAGATGAGGACATCCTCGACTACATATCACTGTGGCAGGACGAC CTG >D_erecta_ac-PA ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCAACGACGACGAGGAATC ATCTTCTGCCGTTAATGGGCCCTCTGTTATCCGGCGAAATGCCCGGGAAC GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAC ATTCCCGCGGCCGTAATTGCGGATTTGAGCAACGGTCGCCGGGGAATTGG TCCCGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG AAGCAGAAACAGTTGCACTTGCAGCAGCAACATCTGCACTTTCAGCAGCA GCAACAGCATCAAAACTTTTACGCCTGGCAGCAGCAGTTGCAGTTGCAGT CCCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCTTATTGCCAG CCAGAAACATCGACGATTCCAGGAGCAACACCTCCCACCAATTTCCATAC CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG GTACCGAAGACGAGGACATCCTTGACTATATTTCACTCTGGCAGGACGAC CTG
>D_melanogaster_ac-PA MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD L >D_sechellia_ac-PA MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD L >D_simulans_ac-PA MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD L >D_yakuba_ac-PA MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD L >D_erecta_ac-PA MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD L
#NEXUS
[ID: 4315310249]
begin taxa;
dimensions ntax=5;
taxlabels
D_melanogaster_ac-PA
D_sechellia_ac-PA
D_simulans_ac-PA
D_yakuba_ac-PA
D_erecta_ac-PA
;
end;
begin trees;
translate
1 D_melanogaster_ac-PA,
2 D_sechellia_ac-PA,
3 D_simulans_ac-PA,
4 D_yakuba_ac-PA,
5 D_erecta_ac-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.02577966,(4:0.0576804,5:0.0463849)1.000:0.07243024,(2:0.007639425,3:0.01043779)0.988:0.02177333);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.02577966,(4:0.0576804,5:0.0463849):0.07243024,(2:0.007639425,3:0.01043779):0.02177333);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1244.29 -1253.45
2 -1244.10 -1255.21
--------------------------------------
TOTAL -1244.19 -1254.67
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 0.263367 0.004237 0.151082 0.388468 0.253370 943.49 1146.96 1.001
r(A<->C){all} 0.058351 0.001101 0.001309 0.120029 0.054139 780.12 873.36 1.001
r(A<->G){all} 0.257326 0.006266 0.115638 0.412947 0.248320 572.87 583.65 1.003
r(A<->T){all} 0.071954 0.001267 0.010794 0.142247 0.067106 721.46 762.16 1.000
r(C<->G){all} 0.167778 0.002878 0.066130 0.273326 0.163775 518.00 713.84 1.000
r(C<->T){all} 0.412161 0.006623 0.254416 0.574266 0.410864 504.70 549.20 1.002
r(G<->T){all} 0.032430 0.000732 0.000009 0.086177 0.025601 883.70 906.67 1.000
pi(A){all} 0.293465 0.000325 0.256516 0.327131 0.293080 1257.57 1311.51 1.001
pi(C){all} 0.271545 0.000302 0.239601 0.306537 0.271232 1238.94 1337.34 1.000
pi(G){all} 0.225372 0.000264 0.193058 0.255462 0.225002 880.59 1050.18 1.000
pi(T){all} 0.209618 0.000242 0.178262 0.239034 0.209108 1336.86 1354.10 1.000
alpha{1,2} 0.061454 0.002294 0.000115 0.143702 0.051878 1350.53 1425.77 1.000
alpha{3} 1.745881 0.546862 0.463289 3.164939 1.618189 1194.51 1347.75 1.000
pinvar{all} 0.547706 0.011068 0.330004 0.718701 0.564737 977.51 1068.80 1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/ac-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 5 ls = 201
Codon usage in sequences
----------------------------------------------------------------------------------------------------------------------
Phe TTT 4 3 3 2 2 | Ser TCT 6 5 5 5 6 | Tyr TAT 2 2 2 3 3 | Cys TGT 0 0 0 0 0
TTC 2 3 3 2 3 | TCC 2 3 3 4 3 | TAC 3 3 3 5 3 | TGC 3 3 3 3 3
Leu TTA 2 2 2 0 0 | TCA 2 2 2 2 2 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 8 6 6 6 8 | TCG 2 2 2 2 1 | TAG 0 0 0 0 0 | Trp TGG 2 2 2 2 2
----------------------------------------------------------------------------------------------------------------------
Leu CTT 1 2 2 2 3 | Pro CCT 3 3 3 3 1 | His CAT 6 5 5 4 4 | Arg CGT 1 1 1 1 1
CTC 2 1 1 1 1 | CCC 2 4 3 3 5 | CAC 4 5 5 3 3 | CGC 4 5 5 4 4
CTA 1 1 1 1 1 | CCA 2 1 1 3 2 | Gln CAA 7 7 6 5 5 | CGA 1 2 1 2 2
CTG 3 4 4 5 4 | CCG 1 1 1 0 0 | CAG 14 14 15 19 20 | CGG 4 2 3 4 4
----------------------------------------------------------------------------------------------------------------------
Ile ATT 3 3 3 4 5 | Thr ACT 2 2 2 2 1 | Asn AAT 8 8 8 7 7 | Ser AGT 3 3 3 3 3
ATC 3 2 2 2 2 | ACC 1 2 2 2 4 | AAC 7 7 6 6 8 | AGC 8 7 8 9 8
ATA 3 4 4 3 2 | ACA 4 3 3 3 3 | Lys AAA 7 6 6 5 6 | Arg AGA 1 1 1 0 0
Met ATG 2 2 2 4 2 | ACG 1 1 2 1 1 | AAG 3 4 4 4 3 | AGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 4 5 5 3 4 | Ala GCT 1 1 1 1 1 | Asp GAT 2 3 3 2 1 | Gly GGT 3 3 3 4 4
GTC 1 1 1 2 1 | GCC 7 6 7 6 6 | GAC 8 7 7 8 9 | GGC 4 5 4 3 3
GTA 3 2 2 3 3 | GCA 3 3 3 3 2 | Glu GAA 6 6 7 6 8 | GGA 3 3 3 3 2
GTG 0 1 1 0 0 | GCG 1 1 1 1 2 | GAG 5 5 4 5 3 | GGG 0 0 0 0 1
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_ac-PA
position 1: T:0.18905 C:0.27861 A:0.27861 G:0.25373
position 2: T:0.20896 C:0.19900 A:0.40796 G:0.18408
position 3: T:0.24378 C:0.30348 A:0.22388 G:0.22886
Average T:0.21393 C:0.26036 A:0.30348 G:0.22222
#2: D_sechellia_ac-PA
position 1: T:0.17910 C:0.28856 A:0.27363 G:0.25871
position 2: T:0.20896 C:0.19900 A:0.40796 G:0.18408
position 3: T:0.24378 C:0.31841 A:0.21393 G:0.22388
Average T:0.21061 C:0.26866 A:0.29851 G:0.22222
#3: D_simulans_ac-PA
position 1: T:0.17910 C:0.28358 A:0.27861 G:0.25871
position 2: T:0.20896 C:0.20398 A:0.40299 G:0.18408
position 3: T:0.24378 C:0.31343 A:0.20896 G:0.23383
Average T:0.21061 C:0.26700 A:0.29685 G:0.22554
#4: D_yakuba_ac-PA
position 1: T:0.17910 C:0.29851 A:0.27363 G:0.24876
position 2: T:0.19900 C:0.20398 A:0.40796 G:0.18905
position 3: T:0.22886 C:0.31343 A:0.19403 G:0.26368
Average T:0.20232 C:0.27197 A:0.29187 G:0.23383
#5: D_erecta_ac-PA
position 1: T:0.17910 C:0.29851 A:0.27363 G:0.24876
position 2: T:0.20398 C:0.19900 A:0.41294 G:0.18408
position 3: T:0.22886 C:0.32836 A:0.18905 G:0.25373
Average T:0.20398 C:0.27529 A:0.29187 G:0.22886
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 14 | Ser S TCT 27 | Tyr Y TAT 12 | Cys C TGT 0
TTC 13 | TCC 15 | TAC 17 | TGC 15
Leu L TTA 6 | TCA 10 | *** * TAA 0 | *** * TGA 0
TTG 34 | TCG 9 | TAG 0 | Trp W TGG 10
------------------------------------------------------------------------------
Leu L CTT 10 | Pro P CCT 13 | His H CAT 24 | Arg R CGT 5
CTC 6 | CCC 17 | CAC 20 | CGC 22
CTA 5 | CCA 9 | Gln Q CAA 30 | CGA 8
CTG 20 | CCG 3 | CAG 82 | CGG 17
------------------------------------------------------------------------------
Ile I ATT 18 | Thr T ACT 9 | Asn N AAT 38 | Ser S AGT 15
ATC 11 | ACC 11 | AAC 34 | AGC 40
ATA 16 | ACA 16 | Lys K AAA 30 | Arg R AGA 3
Met M ATG 12 | ACG 6 | AAG 18 | AGG 0
------------------------------------------------------------------------------
Val V GTT 21 | Ala A GCT 5 | Asp D GAT 11 | Gly G GGT 17
GTC 6 | GCC 32 | GAC 39 | GGC 19
GTA 13 | GCA 14 | Glu E GAA 33 | GGA 14
GTG 2 | GCG 6 | GAG 22 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.18109 C:0.28955 A:0.27562 G:0.25373
position 2: T:0.20597 C:0.20100 A:0.40796 G:0.18507
position 3: T:0.23781 C:0.31542 A:0.20597 G:0.24080
Average T:0.20829 C:0.26866 A:0.29652 G:0.22653
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_ac-PA
D_sechellia_ac-PA 0.1123 (0.0128 0.1144)
D_simulans_ac-PA 0.0921 (0.0118 0.1278) 0.2782 (0.0075 0.0269)
D_yakuba_ac-PA 0.1885 (0.0392 0.2081) 0.1452 (0.0337 0.2322) 0.1244 (0.0315 0.2531)
D_erecta_ac-PA 0.1179 (0.0281 0.2386) 0.0850 (0.0238 0.2797) 0.0615 (0.0172 0.2798) 0.1271 (0.0238 0.1870)
Model 0: one-ratio
TREE # 1: (1, (4, 5), (2, 3)); MP score: 73
lnL(ntime: 7 np: 9): -1208.199885 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.056077 0.095203 0.102919 0.079278 0.037838 0.019688 0.016493 1.681148 0.138809
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.40750
(1: 0.056077, (4: 0.102919, 5: 0.079278): 0.095203, (2: 0.019688, 3: 0.016493): 0.037838);
(D_melanogaster_ac-PA: 0.056077, (D_yakuba_ac-PA: 0.102919, D_erecta_ac-PA: 0.079278): 0.095203, (D_sechellia_ac-PA: 0.019688, D_simulans_ac-PA: 0.016493): 0.037838);
Detailed output identifying parameters
kappa (ts/tv) = 1.68115
omega (dN/dS) = 0.13881
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.056 461.4 141.6 0.1388 0.0076 0.0548 3.5 7.8
6..7 0.095 461.4 141.6 0.1388 0.0129 0.0931 6.0 13.2
7..4 0.103 461.4 141.6 0.1388 0.0140 0.1006 6.4 14.2
7..5 0.079 461.4 141.6 0.1388 0.0108 0.0775 5.0 11.0
6..8 0.038 461.4 141.6 0.1388 0.0051 0.0370 2.4 5.2
8..2 0.020 461.4 141.6 0.1388 0.0027 0.0192 1.2 2.7
8..3 0.016 461.4 141.6 0.1388 0.0022 0.0161 1.0 2.3
tree length for dN: 0.0553
tree length for dS: 0.3984
Time used: 0:02
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 73
check convergence..
lnL(ntime: 7 np: 10): -1205.698792 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.055073 0.098734 0.104988 0.081839 0.039270 0.018749 0.017717 1.735217 0.889209 0.054110
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41637
(1: 0.055073, (4: 0.104988, 5: 0.081839): 0.098734, (2: 0.018749, 3: 0.017717): 0.039270);
(D_melanogaster_ac-PA: 0.055073, (D_yakuba_ac-PA: 0.104988, D_erecta_ac-PA: 0.081839): 0.098734, (D_sechellia_ac-PA: 0.018749, D_simulans_ac-PA: 0.017717): 0.039270);
Detailed output identifying parameters
kappa (ts/tv) = 1.73522
dN/dS (w) for site classes (K=2)
p: 0.88921 0.11079
w: 0.05411 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.055 460.3 142.7 0.1589 0.0081 0.0513 3.8 7.3
6..7 0.099 460.3 142.7 0.1589 0.0146 0.0919 6.7 13.1
7..4 0.105 460.3 142.7 0.1589 0.0155 0.0978 7.2 14.0
7..5 0.082 460.3 142.7 0.1589 0.0121 0.0762 5.6 10.9
6..8 0.039 460.3 142.7 0.1589 0.0058 0.0366 2.7 5.2
8..2 0.019 460.3 142.7 0.1589 0.0028 0.0175 1.3 2.5
8..3 0.018 460.3 142.7 0.1589 0.0026 0.0165 1.2 2.4
Time used: 0:04
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 73
lnL(ntime: 7 np: 12): -1205.698792 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.055073 0.098734 0.104988 0.081839 0.039270 0.018749 0.017717 1.735217 0.889209 0.046601 0.054110 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41637
(1: 0.055073, (4: 0.104988, 5: 0.081839): 0.098734, (2: 0.018749, 3: 0.017717): 0.039270);
(D_melanogaster_ac-PA: 0.055073, (D_yakuba_ac-PA: 0.104988, D_erecta_ac-PA: 0.081839): 0.098734, (D_sechellia_ac-PA: 0.018749, D_simulans_ac-PA: 0.017717): 0.039270);
Detailed output identifying parameters
kappa (ts/tv) = 1.73522
dN/dS (w) for site classes (K=3)
p: 0.88921 0.04660 0.06419
w: 0.05411 1.00000 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.055 460.3 142.7 0.1589 0.0081 0.0513 3.8 7.3
6..7 0.099 460.3 142.7 0.1589 0.0146 0.0919 6.7 13.1
7..4 0.105 460.3 142.7 0.1589 0.0155 0.0978 7.2 14.0
7..5 0.082 460.3 142.7 0.1589 0.0121 0.0762 5.6 10.9
6..8 0.039 460.3 142.7 0.1589 0.0058 0.0366 2.7 5.2
8..2 0.019 460.3 142.7 0.1589 0.0028 0.0175 1.3 2.5
8..3 0.018 460.3 142.7 0.1589 0.0026 0.0165 1.2 2.4
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_ac-PA)
Pr(w>1) post mean +- SE for w
20 A 0.517 1.455 +- 0.843
145 I 0.531 1.480 +- 0.863
163 N 0.548 1.513 +- 0.893
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 0.937 0.063 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.687 0.207 0.062 0.022 0.009 0.005 0.003 0.002 0.002 0.001
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.003
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.006 0.259
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.001 0.030 0.256 0.445
sum of density on p0-p1 = 1.000000
Time used: 0:11
Model 3: discrete (3 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 73
lnL(ntime: 7 np: 13): -1205.440704 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.055695 0.097682 0.104922 0.081325 0.038751 0.019160 0.017212 1.705678 0.525738 0.196913 0.000001 0.000001 0.536760
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41475
(1: 0.055695, (4: 0.104922, 5: 0.081325): 0.097682, (2: 0.019160, 3: 0.017212): 0.038751);
(D_melanogaster_ac-PA: 0.055695, (D_yakuba_ac-PA: 0.104922, D_erecta_ac-PA: 0.081325): 0.097682, (D_sechellia_ac-PA: 0.019160, D_simulans_ac-PA: 0.017212): 0.038751);
Detailed output identifying parameters
kappa (ts/tv) = 1.70568
dN/dS (w) for site classes (K=3)
p: 0.52574 0.19691 0.27735
w: 0.00000 0.00000 0.53676
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.056 460.9 142.1 0.1489 0.0079 0.0531 3.6 7.5
6..7 0.098 460.9 142.1 0.1489 0.0139 0.0932 6.4 13.2
7..4 0.105 460.9 142.1 0.1489 0.0149 0.1001 6.9 14.2
7..5 0.081 460.9 142.1 0.1489 0.0115 0.0776 5.3 11.0
6..8 0.039 460.9 142.1 0.1489 0.0055 0.0370 2.5 5.3
8..2 0.019 460.9 142.1 0.1489 0.0027 0.0183 1.3 2.6
8..3 0.017 460.9 142.1 0.1489 0.0024 0.0164 1.1 2.3
Naive Empirical Bayes (NEB) analysis
Time used: 0:15
Model 7: beta (10 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 73
check convergence..
lnL(ntime: 7 np: 10): -1205.533468 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.055468 0.097982 0.104867 0.081413 0.038899 0.019020 0.017374 1.708667 0.138551 0.774154
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41502
(1: 0.055468, (4: 0.104867, 5: 0.081413): 0.097982, (2: 0.019020, 3: 0.017374): 0.038899);
(D_melanogaster_ac-PA: 0.055468, (D_yakuba_ac-PA: 0.104867, D_erecta_ac-PA: 0.081413): 0.097982, (D_sechellia_ac-PA: 0.019020, D_simulans_ac-PA: 0.017374): 0.038899);
Detailed output identifying parameters
kappa (ts/tv) = 1.70867
Parameters in M7 (beta):
p = 0.13855 q = 0.77415
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00000 0.00007 0.00077 0.00469 0.01990 0.06583 0.18042 0.41963 0.81253
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.055 460.9 142.1 0.1504 0.0079 0.0527 3.7 7.5
6..7 0.098 460.9 142.1 0.1504 0.0140 0.0931 6.5 13.2
7..4 0.105 460.9 142.1 0.1504 0.0150 0.0997 6.9 14.2
7..5 0.081 460.9 142.1 0.1504 0.0116 0.0774 5.4 11.0
6..8 0.039 460.9 142.1 0.1504 0.0056 0.0370 2.6 5.3
8..2 0.019 460.9 142.1 0.1504 0.0027 0.0181 1.3 2.6
8..3 0.017 460.9 142.1 0.1504 0.0025 0.0165 1.1 2.3
Time used: 0:28
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, (4, 5), (2, 3)); MP score: 73
check convergence..
lnL(ntime: 7 np: 12): -1205.533471 +0.000000
6..1 6..7 7..4 7..5 6..8 8..2 8..3
0.055468 0.097982 0.104867 0.081413 0.038899 0.019020 0.017374 1.708668 0.999990 0.138553 0.774211 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 0.41502
(1: 0.055468, (4: 0.104867, 5: 0.081413): 0.097982, (2: 0.019020, 3: 0.017374): 0.038899);
(D_melanogaster_ac-PA: 0.055468, (D_yakuba_ac-PA: 0.104867, D_erecta_ac-PA: 0.081413): 0.097982, (D_sechellia_ac-PA: 0.019020, D_simulans_ac-PA: 0.017374): 0.038899);
Detailed output identifying parameters
kappa (ts/tv) = 1.70867
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.13855 q = 0.77421
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00000 0.00007 0.00077 0.00469 0.01990 0.06583 0.18040 0.41960 0.81250 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
6..1 0.055 460.9 142.1 0.1504 0.0079 0.0527 3.7 7.5
6..7 0.098 460.9 142.1 0.1504 0.0140 0.0931 6.5 13.2
7..4 0.105 460.9 142.1 0.1504 0.0150 0.0997 6.9 14.2
7..5 0.081 460.9 142.1 0.1504 0.0116 0.0774 5.4 11.0
6..8 0.039 460.9 142.1 0.1504 0.0056 0.0370 2.6 5.3
8..2 0.019 460.9 142.1 0.1504 0.0027 0.0181 1.3 2.6
8..3 0.017 460.9 142.1 0.1504 0.0025 0.0165 1.1 2.3
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_ac-PA)
Pr(w>1) post mean +- SE for w
20 A 0.641 1.367 +- 0.824
145 I 0.658 1.394 +- 0.827
150 K 0.560 1.230 +- 0.790
163 N 0.680 1.428 +- 0.827
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.008 0.992
p : 0.932 0.067 0.001 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.009 0.046 0.095 0.134 0.158 0.173 0.186 0.199
ws: 0.758 0.191 0.038 0.009 0.003 0.001 0.000 0.000 0.000 0.000
Time used: 0:49
Model 1: NearlyNeutral -1205.698792 Model 2: PositiveSelection -1205.698792 Model 0: one-ratio -1208.199885 Model 3: discrete -1205.440704 Model 7: beta -1205.533468 Model 8: beta&w>1 -1205.533471 Model 0 vs 1 5.002186000000165 Model 2 vs 1 0.0 Model 8 vs 7 5.999999757477781E-6
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
