--- EXPERIMENT NOTES




 --- EXPERIMENT PROPERTIES

#Tue Nov 22 06:52:11 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/ac-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=



 --- PSRF SUMMARY

      Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)

(Values are saved to the file /opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)

Run   Arithmetic mean   Harmonic mean
--------------------------------------
1      -1244.29         -1253.45
2      -1244.10         -1255.21
--------------------------------------
TOTAL    -1244.19         -1254.67
--------------------------------------


Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".

95% HPD Interval
--------------------
Parameter         Mean      Variance     Lower       Upper       Median    min ESS*  avg ESS    PSRF+
------------------------------------------------------------------------------------------------------
TL{all}         0.263367    0.004237    0.151082    0.388468    0.253370    943.49   1146.96    1.001
r(A<->C){all}   0.058351    0.001101    0.001309    0.120029    0.054139    780.12    873.36    1.001
r(A<->G){all}   0.257326    0.006266    0.115638    0.412947    0.248320    572.87    583.65    1.003
r(A<->T){all}   0.071954    0.001267    0.010794    0.142247    0.067106    721.46    762.16    1.000
r(C<->G){all}   0.167778    0.002878    0.066130    0.273326    0.163775    518.00    713.84    1.000
r(C<->T){all}   0.412161    0.006623    0.254416    0.574266    0.410864    504.70    549.20    1.002
r(G<->T){all}   0.032430    0.000732    0.000009    0.086177    0.025601    883.70    906.67    1.000
pi(A){all}      0.293465    0.000325    0.256516    0.327131    0.293080   1257.57   1311.51    1.001
pi(C){all}      0.271545    0.000302    0.239601    0.306537    0.271232   1238.94   1337.34    1.000
pi(G){all}      0.225372    0.000264    0.193058    0.255462    0.225002    880.59   1050.18    1.000
pi(T){all}      0.209618    0.000242    0.178262    0.239034    0.209108   1336.86   1354.10    1.000
alpha{1,2}      0.061454    0.002294    0.000115    0.143702    0.051878   1350.53   1425.77    1.000
alpha{3}        1.745881    0.546862    0.463289    3.164939    1.618189   1194.51   1347.75    1.000
pinvar{all}     0.547706    0.011068    0.330004    0.718701    0.564737    977.51   1068.80    1.002
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.


Setting sumt conformat to Simple



 --- CODEML SUMMARY

Model 1: NearlyNeutral	-1205.698792
Model 2: PositiveSelection	-1205.698792
Model 0: one-ratio	-1208.199885
Model 3: discrete	-1205.440704
Model 7: beta	-1205.533468
Model 8: beta&w>1	-1205.533471


Model 0 vs 1	5.002186000000165

Model 2 vs 1	0.0

Model 8 vs 7	5.999999757477781E-6
>C1
MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C2
MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C3
MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C4
MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C5
MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE:  ], CPU=0.00 sec, SCORE=100, Nseq=5, Len=201 

C1              MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
C2              MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C3              MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C4              MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C5              MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
                ****.**:*:* *******..*****************************

C1              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C2              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C3              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C4              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C5              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
                **************************************************

C1              KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
C2              KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
C3              KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
C4              KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
C5              KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
                ****:*:**************::***:*: ******** ***** ****:

C1              PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C2              PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C3              PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C4              PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
C5              PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
                * **********.*::******:***************************

C1              L
C2              L
C3              L
C4              L
C5              L
                *




PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log      	S	[0] 
-genepred_score	S	[0] 	nsd
-run_name      	S	[0] 
-mem_mode      	S	[0] 	mem
-extend        	D	[1] 	1 
-extend_mode   	S	[0] 	very_fast_triplet
-max_n_pair    	D	[0] 	10 
-seq_name_for_quadruplet	S	[0] 	all
-compact       	S	[0] 	default
-clean         	S	[0] 	no
-do_self       	FL	[0] 	0
-do_normalise  	D	[0] 	1000 
-template_file 	S	[0] 
-setenv        	S	[0] 	0
-template_mode 	S	[0] 
-flip          	D	[0] 	0 
-remove_template_file	D	[0] 	0 
-profile_template_file	S	[0] 
-in            	S	[0] 
-seq           	S	[0] 
-aln           	S	[0] 
-method_limits 	S	[0] 
-method        	S	[0] 
-lib           	S	[0] 
-profile       	S	[0] 
-profile1      	S	[0] 
-profile2      	S	[0] 
-pdb           	S	[0] 
-relax_lib     	D	[0] 	1 
-filter_lib    	D	[0] 	0 
-shrink_lib    	D	[0] 	0 
-out_lib       	W_F	[0] 	no
-out_lib_mode  	S	[0] 	primary
-lib_only      	D	[0] 	0 
-outseqweight  	W_F	[0] 	no
-dpa           	FL	[0] 	0
-seq_source    	S	[0] 	ANY
-cosmetic_penalty	D	[0] 	0 
-gapopen       	D	[0] 	0 
-gapext        	D	[0] 	0 
-fgapopen      	D	[0] 	0 
-fgapext       	D	[0] 	0 
-nomatch       	D	[0] 	0 
-newtree       	W_F	[0] 	default
-tree          	W_F	[0] 	NO
-usetree       	R_F	[0] 
-tree_mode     	S	[0] 	nj
-distance_matrix_mode	S	[0] 	ktup
-distance_matrix_sim_mode	S	[0] 	idmat_sim1
-quicktree     	FL	[0] 	0
-outfile       	W_F	[0] 	default
-maximise      	FL	[1] 	1
-output        	S	[1] 	score_ascii	html	score_ascii
-len           	D	[0] 	0 
-infile        	R_F	[1] 	/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix        	S	[0] 	default
-tg_mode       	D	[0] 	1 
-profile_mode  	S	[0] 	cw_profile_profile
-profile_comparison	S	[0] 	profile
-dp_mode       	S	[0] 	linked_pair_wise
-ktuple        	D	[0] 	1 
-ndiag         	D	[0] 	0 
-diag_threshold	D	[0] 	0 
-diag_mode     	D	[0] 	0 
-sim_matrix    	S	[0] 	vasiliky
-transform     	S	[0] 
-extend_seq    	FL	[0] 	0
-outorder      	S	[0] 	input
-inorder       	S	[0] 	aligned
-seqnos        	S	[0] 	off
-case          	S	[0] 	keep
-cpu           	D	[0] 	0 
-maxnseq       	D	[0] 	1000 
-maxlen        	D	[0] 	-1 
-sample_dp     	D	[0] 	0 
-weight        	S	[0] 	default
-seq_weight    	S	[0] 	no
-align         	FL	[1] 	1
-mocca         	FL	[0] 	0
-domain        	FL	[0] 	0
-start         	D	[0] 	0 
-len           	D	[0] 	0 
-scale         	D	[0] 	0 
-mocca_interactive	FL	[0] 	0
-method_evaluate_mode	S	[0] 	default
-evaluate_mode 	S	[1] 	t_coffee_fast
-get_type      	FL	[0] 	0
-clean_aln     	D	[0] 	0 
-clean_threshold	D	[1] 	1 
-clean_iteration	D	[1] 	1 
-clean_evaluate_mode	S	[0] 	t_coffee_fast
-extend_matrix 	FL	[0] 	0
-prot_min_sim  	D	[40] 	40 
-prot_max_sim  	D	[90] 	90 
-prot_min_cov  	D	[40] 	40 
-pdb_type      	S	[0] 	d
-pdb_min_sim   	D	[35] 	35 
-pdb_max_sim   	D	[100] 	100 
-pdb_min_cov   	D	[50] 	50 
-pdb_blast_server	W_F	[0] 	EBI
-blast         	W_F	[0] 
-blast_server  	W_F	[0] 	EBI
-pdb_db        	W_F	[0] 	pdb
-protein_db    	W_F	[0] 	uniprot
-method_log    	W_F	[0] 	no
-struc_to_use  	S	[0] 
-cache         	W_F	[0] 	use
-align_pdb_param_file	W_F	[0] 	no
-align_pdb_hasch_mode	W_F	[0] 	hasch_ca_trace_bubble
-external_aligner	S	[0] 	NO
-msa_mode      	S	[0] 	tree
-master        	S	[0] 	no
-blast_nseq    	D	[0] 	0 
-lalign_n_top  	D	[0] 	10 
-iterate       	D	[1] 	0 
-trim          	D	[0] 	0 
-split         	D	[0] 	0 
-trimfile      	S	[0] 	default
-split         	D	[0] 	0 
-split_nseq_thres	D	[0] 	0 
-split_score_thres	D	[0] 	0 
-check_pdb_status	D	[0] 	0 
-clean_seq_name	D	[0] 	0 
-seq_to_keep   	S	[0] 
-dpa_master_aln	S	[0] 
-dpa_maxnseq   	D	[0] 	0 
-dpa_min_score1	D	[0] 
-dpa_min_score2	D	[0] 
-dpa_keep_tmpfile	FL	[0] 	0
-dpa_debug     	D	[0] 	0 
-multi_core    	S	[0] 	templates_jobs_relax_msa_evaluate
-n_core        	D	[0] 	0 
-max_n_proc    	D	[0] 	0 
-lib_list      	S	[0] 
-prune_lib_mode	S	[0] 	5
-tip           	S	[0] 	none
-rna_lib       	S	[0] 
-no_warning    	D	[0] 	0 
-run_local_script	D	[0] 	0 
-plugins       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:
       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln       	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
        	S	[0] 	default
-proxy         	S	[0] 	unset
-email         	S	[0] 
-clean_overaln 	D	[0] 	0 
-overaln_param 	S	[0] 
-overaln_mode  	S	[0] 
-overaln_model 	S	[0] 
-overaln_threshold	D	[0] 	0 
-overaln_target	D	[0] 	0 
-overaln_P1    	D	[0] 	0 
-overaln_P2    	D	[0] 	0 
-overaln_P3    	D	[0] 	0 
-overaln_P4    	D	[0] 	0 
-exon_boundaries	S	[0] 
-dump          	S	[0] 	no
-display       	D	[0] 	100 

INPUT FILES
	Input File (S) /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln  Format clustal_aln
	Input File (M) proba_pair 

Identify Master Sequences [no]:

Master Sequences Identified
INPUT SEQUENCES: 5 SEQUENCES  [PROTEIN]
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length  201 type PROTEIN Struct Unchecked
  Input File /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length  201 type PROTEIN Struct Unchecked

	Multi Core Mode: 72 processors:

	--- Process Method/Library/Aln S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	--- Process Method/Library/Aln Mproba_pair
	xxx Retrieved S/opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
	xxx Retrieved Mproba_pair

	All Methods Retrieved

MANUAL PENALTIES: gapopen=0 gapext=0

	Library Total Size: [4020]

Library Relaxation: Multi_proc [72]
 
Relaxation Summary: [4020]--->[4020]



UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1


OUTPUT RESULTS
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
	#### File Type= MSA             Format= html            Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
	#### File Type= MSA             Format= score_ascii     Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii

# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/ac-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast  [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.271 Mb, Max= 30.513 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C2
MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C3
MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C4
MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C5
MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
CLUSTAL W (1.83) multiple sequence alignment

C1              MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
C2              MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C3              MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C4              MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
C5              MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
                ****.**:*:* *******..*****************************

C1              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C2              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C3              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C4              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
C5              IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
                **************************************************

C1              KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
C2              KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
C3              KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
C4              KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
C5              KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
                ****:*:**************::***:*: ******** ***** ****:

C1              PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C2              PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C3              PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
C4              PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
C5              PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
                * **********.*::******:***************************

C1              L
C2              L
C3              L
C4              L
C5              L
                *



>C1
MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C2
MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C3
MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C4
MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C5
MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:201 S:100 BS:201
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# PW_SEQ_DISTANCES 
BOT	    0    1	 97.01 C1	 C2	 97.01
TOP	    1    0	 97.01 C2	 C1	 97.01
BOT	    0    2	 97.51 C1	 C3	 97.51
TOP	    2    0	 97.51 C3	 C1	 97.51
BOT	    0    3	 91.04 C1	 C4	 91.04
TOP	    3    0	 91.04 C4	 C1	 91.04
BOT	    0    4	 93.53 C1	 C5	 93.53
TOP	    4    0	 93.53 C5	 C1	 93.53
BOT	    1    2	 98.51 C2	 C3	 98.51
TOP	    2    1	 98.51 C3	 C2	 98.51
BOT	    1    3	 92.54 C2	 C4	 92.54
TOP	    3    1	 92.54 C4	 C2	 92.54
BOT	    1    4	 94.53 C2	 C5	 94.53
TOP	    4    1	 94.53 C5	 C2	 94.53
BOT	    2    3	 93.03 C3	 C4	 93.03
TOP	    3    2	 93.03 C4	 C3	 93.03
BOT	    2    4	 96.02 C3	 C5	 96.02
TOP	    4    2	 96.02 C5	 C3	 96.02
BOT	    3    4	 94.53 C4	 C5	 94.53
TOP	    4    3	 94.53 C5	 C4	 94.53
AVG	 0	 C1	  *	 94.78
AVG	 1	 C2	  *	 95.65
AVG	 2	 C3	  *	 96.27
AVG	 3	 C4	  *	 92.79
AVG	 4	 C5	  *	 94.65
TOT	 TOT	  *	 94.83
CLUSTAL W (1.83) multiple sequence alignment

C1              ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGACGAGGAGTC
C2              ATGGCTTTGGGCGGCGAAAATCACTCTGTTTTCAACGACGATGAGGAGTC
C3              ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGATGAGGAATC
C4              ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCTACGACGACGAGGAGTC
C5              ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCAACGACGACGAGGAATC
                ************.********** *** *****:******* *****.**

C1              ATCTTCGGCCTTTAATGGACCCTCTGTTATCCGGAGAAATGCCCGGGAAC
C2              ATCTTCGCCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC
C3              ATCTTCGGCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC
C4              ATCTTCTCCCGTCAATGGACCCTCTGTTATCCGGCGAAATGCCCGGGAAC
C5              ATCTTCTGCCGTTAATGGGCCCTCTGTTATCCGGCGAAATGCCCGGGAAC
                ******  ** * *****.************** .***************

C1              GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT
C2              GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT
C3              GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAGCAT
C4              GCAACCGCGTAAAGCAGGTCAACAACGGCTTCAGCCAACTACGACAACAT
C5              GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAC
                ************************* ********************.** 

C1              ATCCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
C2              ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
C3              ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
C4              ATTCCTGCGGCCGTAATTGCCGATTTGAGCAACGGTCGCCGGGGAATTGG
C5              ATTCCCGCGGCCGTAATTGCGGATTTGAGCAACGGTCGCCGGGGAATTGG
                ** ** ***********:** *****.***** *****************

C1              TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
C2              TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
C3              TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
C4              TCCAGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAGATGGCAG
C5              TCCCGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
                ***.** ***********************************.*******

C1              TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
C2              TGGAGTACATACGACGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
C3              TGGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
C4              TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
C5              TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
                *.***********.************************************

C1              AAACAGAAACAGTTGCATTTGCAGCAGCAACATTTGCACTTTCAGCAGCA
C2              AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA
C3              AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA
C4              AAGCAGAAACAGATGCACATGCAGCAGCAGCATTTGCACTTTCAGCAGCA
C5              AAGCAGAAACAGTTGCACTTGCAGCAGCAACATCTGCACTTTCAGCAGCA
                **.*****.***:**** :*.********.*** ****************

C1              GCAACAGCATCAACACTTATACGCCTGGCACCAAGAGTTGCAGTTGCAAT
C2              GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT
C3              GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT
C4              GCAACAGCATCAACACTTTTACGCCTGGCAGCAGCAGTCGCAGCTGCAAT
C5              GCAACAGCATCAAAACTTTTACGCCTGGCAGCAGCAGTTGCAGTTGCAGT
                *************.****:*********** **. *** **** ****.*

C1              CTCCAACTGGCAGCACAAGTTCCTGCAACAGCATTAGCTCTTATTGCAAG
C2              CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG
C3              CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG
C4              CCCCCACTGGCAGCATAAGTTCCTGCAATAGCAGCAGCTCCTATTGCGAG
C5              CCCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCTTATTGCCAG
                * **.********** ************ ****  ***** ****** **

C1              CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTTCATAC
C2              CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTCCACAC
C3              CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTACGAATTTCCACAC
C4              CCAGCAACATCGACGATTCCAGGAGCAACACCTCCTACCAATTTGTATAC
C5              CCAGAAACATCGACGATTCCAGGAGCAACACCTCCCACCAATTTCCATAC
                ****.***************.************** *. *****  * **

C1              CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
C2              CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
C3              CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
C4              CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG
C5              CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG
                *****************:********************************

C1              GTACTGAAGATGAGGACATCCTCGACTATATATCACTCTGGCAGGACGAC
C2              GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC
C3              GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC
C4              GTACTGAAGATGAGGACATCCTCGACTACATATCACTGTGGCAGGACGAC
C5              GTACCGAAGACGAGGACATCCTTGACTATATTTCACTCTGGCAGGACGAC
                **** ***** *********** ***** **:***** ************

C1              CTG
C2              CTG
C3              CTG
C4              CTG
C5              CTG
                ***



>C1
ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGACGAGGAGTC
ATCTTCGGCCTTTAATGGACCCTCTGTTATCCGGAGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT
ATCCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAACAGAAACAGTTGCATTTGCAGCAGCAACATTTGCACTTTCAGCAGCA
GCAACAGCATCAACACTTATACGCCTGGCACCAAGAGTTGCAGTTGCAAT
CTCCAACTGGCAGCACAAGTTCCTGCAACAGCATTAGCTCTTATTGCAAG
CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTTCATAC
CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACTGAAGATGAGGACATCCTCGACTATATATCACTCTGGCAGGACGAC
CTG
>C2
ATGGCTTTGGGCGGCGAAAATCACTCTGTTTTCAACGACGATGAGGAGTC
ATCTTCGCCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAT
ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
TGGAGTACATACGACGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA
GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT
CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG
CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTAACAATTTCCACAC
CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC
CTG
>C3
ATGGCTTTGGGCAGCGAAAATCACTCTGTTTTCAACGACGATGAGGAATC
ATCTTCGGCCGTTAATGGACCCTCTGTTATCCGCAGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAGCAT
ATTCCTGCGGCCGTAATAGCCGATTTAAGCAATGGTCGCCGGGGAATTGG
TCCCGGCGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
TGGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAACAGAAGCAGTTGCATTTACAGCAGCAACATTTGCACTTTCAGCAGCA
GCAACAGCATCAACACTTTTACGCCTGGCACCAAGAGTTGCAGCTGCAAT
CTCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCCTATTGCAAG
CCAGCAACATCGACGATTCCGGGAGCAACACCTCCTACGAATTTCCACAC
CAAGTTGGAAGCCAGTTTTGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACTGAAGATGAGGACATCCTTGACTATATATCACTCTGGCAGGACGAC
CTG
>C4
ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCTACGACGACGAGGAGTC
ATCTTCTCCCGTCAATGGACCCTCTGTTATCCGGCGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAACGGCTTCAGCCAACTACGACAACAT
ATTCCTGCGGCCGTAATTGCCGATTTGAGCAACGGTCGCCGGGGAATTGG
TCCAGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAGATGGCAG
TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAGCAGAAACAGATGCACATGCAGCAGCAGCATTTGCACTTTCAGCAGCA
GCAACAGCATCAACACTTTTACGCCTGGCAGCAGCAGTCGCAGCTGCAAT
CCCCCACTGGCAGCATAAGTTCCTGCAATAGCAGCAGCTCCTATTGCGAG
CCAGCAACATCGACGATTCCAGGAGCAACACCTCCTACCAATTTGTATAC
CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACTGAAGATGAGGACATCCTCGACTACATATCACTGTGGCAGGACGAC
CTG
>C5
ATGGCTTTGGGCAGCGAAAATCAGTCTCTTTTCAACGACGACGAGGAATC
ATCTTCTGCCGTTAATGGGCCCTCTGTTATCCGGCGAAATGCCCGGGAAC
GCAACCGCGTAAAGCAGGTCAACAATGGCTTCAGCCAACTACGACAACAC
ATTCCCGCGGCCGTAATTGCGGATTTGAGCAACGGTCGCCGGGGAATTGG
TCCCGGTGCCAATAAAAAACTGAGCAAAGTTAGCACACTGAAAATGGCAG
TAGAGTACATACGGCGCTTGCAGAAAGTTCTTCATGAAAACGACCAGCAG
AAGCAGAAACAGTTGCACTTGCAGCAGCAACATCTGCACTTTCAGCAGCA
GCAACAGCATCAAAACTTTTACGCCTGGCAGCAGCAGTTGCAGTTGCAGT
CCCCCACTGGCAGCATAAGTTCCTGCAACAGCACCAGCTCTTATTGCCAG
CCAGAAACATCGACGATTCCAGGAGCAACACCTCCCACCAATTTCCATAC
CAAGTTGGAAGCCAGTTATGAAGACTACCGTAACAATTCCTGCAGTTCTG
GTACCGAAGACGAGGACATCCTTGACTATATTTCACTCTGGCAGGACGAC
CTG
>C1
MALGSENHSVFNDDEESSSAFNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHLYAWHQELQLQSPTGSTSSCNSISSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C2
MALGGENHSVFNDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPNNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C3
MALGSENHSVFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQHFYAWHQELQLQSPTGSISSCNSTSSYCK
PATSTIPGATPPTNFHTKLEASFEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C4
MALGSENQSLFYDDEESSSPVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQMHMQQQHLHFQQQQQHQHFYAWQQQSQLQSPTGSISSCNSSSSYCE
PATSTIPGATPPTNLYTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L
>C5
MALGSENQSLFNDDEESSSAVNGPSVIRRNARERNRVKQVNNGFSQLRQH
IPAAVIADLSNGRRGIGPGANKKLSKVSTLKMAVEYIRRLQKVLHENDQQ
KQKQLHLQQQHLHFQQQQQHQNFYAWQQQLQLQSPTGSISSCNSTSSYCQ
PETSTIPGATPPTNFHTKLEASYEDYRNNSCSSGTEDEDILDYISLWQDD
L


                            MrBayes v3.2.2 x64

                      (Bayesian Analysis of Phylogeny)

              Distributed under the GNU General Public License


               Type "help" or "help <command>" for information
                     on the commands that are available.

                   Type "about" for authorship and general
                       information about the program.



   Executing file "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
   UNIX line termination
   Longest line length = 63
   Parsing file
   Expecting NEXUS formatted file
   Reading data block
      Allocated taxon set
      Allocated matrix
      Defining new matrix with 5 taxa and 603 characters
      Missing data coded as ?
      Data matrix is interleaved
      Data is Dna
      Gaps coded as -
      Matching characters coded as .
      Taxon 1 -> C1
      Taxon 2 -> C2
      Taxon 3 -> C3
      Taxon 4 -> C4
      Taxon 5 -> C5
      Successfully read matrix
      Setting default partition (does not divide up characters)
      Setting model defaults
      Seed (for generating default start values) = 1479797343
      Setting output file names to "/opt/ADOPS/3/ac-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
   Exiting data block
   Reading mrbayes block
      Setting autoclose to yes
      Setting nowarnings to yes
      Defining charset called first_pos
      Defining charset called second_pos
      Defining charset called third_pos
      Defining partition called by_codon
      Setting by_codon as the partition, dividing characters into 3 parts.
      Setting model defaults
      Seed (for generating default start values) = 1468792643
      Setting Nst to 6 for partition 1
      Setting Nst to 6 for partition 2
      Setting Nst to 6 for partition 3
      Setting Rates to Invgamma for partition 1
      Setting Rates to Invgamma for partition 2
      Setting Rates to Invgamma for partition 3
      Successfully set likelihood model parameters to all
         applicable data partitions 
      Unlinking
      Setting number of generations to 1000000
      Running Markov chain
      MCMC stamp = 4315310249
      Seed = 1419924826
      Swapseed = 1479797343
      Model settings:

         Settings for partition 1 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 2 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

         Settings for partition 3 --
            Datatype  = DNA
            Nucmodel  = 4by4
            Nst       = 6
                        Substitution rates, expressed as proportions
                        of the rate sum, have a Dirichlet prior
                        (1.00,1.00,1.00,1.00,1.00,1.00)
            Covarion  = No
            # States  = 4
                        State frequencies have a Dirichlet prior
                        (1.00,1.00,1.00,1.00)
            Rates     = Invgamma
                        Gamma shape parameter is exponentially
                        distributed with parameter (2.00).
                        Proportion of invariable sites is uniformly dist-
                        ributed on the interval (0.00,1.00).
                        Gamma distribution is approximated using 4 categories.
                        Likelihood summarized over all rate categories in each generation.

      Active parameters: 

                          Partition(s)
         Parameters       1  2  3
         ------------------------
         Revmat           1  1  1
         Statefreq        2  2  2
         Shape            3  3  4
         Pinvar           5  5  5
         Ratemultiplier   6  6  6
         Topology         7  7  7
         Brlens           8  8  8
         ------------------------

         Parameters can be linked or unlinked across partitions using 'link' and 'unlink'

         1 --  Parameter  = Revmat{all}
               Type       = Rates of reversible rate matrix
               Prior      = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
               Partitions = All

         2 --  Parameter  = Pi{all}
               Type       = Stationary state frequencies
               Prior      = Dirichlet
               Partitions = All

         3 --  Parameter  = Alpha{1,2}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partitions = 1 and 2

         4 --  Parameter  = Alpha{3}
               Type       = Shape of scaled gamma distribution of site rates
               Prior      = Exponential(2.00)
               Partition  = 3

         5 --  Parameter  = Pinvar{all}
               Type       = Proportion of invariable sites
               Prior      = Uniform(0.00,1.00)
               Partitions = All

         6 --  Parameter  = Ratemultiplier{all}
               Type       = Partition-specific rate multiplier
               Prior      = Fixed(1.0)
               Partitions = All

         7 --  Parameter  = Tau{all}
               Type       = Topology
               Prior      = All topologies equally probable a priori
               Partitions = All
               Subparam.  = V{all}

         8 --  Parameter  = V{all}
               Type       = Branch lengths
               Prior      = Unconstrained:Exponential(10.0)
               Partitions = All



      The MCMC sampler will use the following moves:
         With prob.  Chain will use move
            1.06 %   Dirichlet(Revmat{all})
            1.06 %   Slider(Revmat{all})
            1.06 %   Dirichlet(Pi{all})
            1.06 %   Slider(Pi{all})
            2.13 %   Multiplier(Alpha{1,2})
            2.13 %   Multiplier(Alpha{3})
            2.13 %   Slider(Pinvar{all})
           10.64 %   ExtSPR(Tau{all},V{all})
           10.64 %   ExtTBR(Tau{all},V{all})
           10.64 %   NNI(Tau{all},V{all})
           10.64 %   ParsSPR(Tau{all},V{all})
           31.91 %   Multiplier(V{all})
           10.64 %   Nodeslider(V{all})
            4.26 %   TLMultiplier(V{all})

      Division 1 has 16 unique site patterns
      Division 2 has 10 unique site patterns
      Division 3 has 36 unique site patterns
      Initializing conditional likelihoods
      Using standard SSE likelihood calculator for division 1 (single-precision)
      Using standard SSE likelihood calculator for division 2 (single-precision)
      Using standard SSE likelihood calculator for division 3 (single-precision)
      Initializing invariable-site conditional likelihoods

      Initial log likelihoods and log prior probs for run 1:
         Chain 1 -- -1504.175647 -- -25.624409
         Chain 2 -- -1486.784525 -- -25.624409
         Chain 3 -- -1547.431818 -- -25.624409
         Chain 4 -- -1525.595852 -- -25.624409

      Initial log likelihoods and log prior probs for run 2:
         Chain 1 -- -1525.595852 -- -25.624409
         Chain 2 -- -1547.431818 -- -25.624409
         Chain 3 -- -1560.207842 -- -25.624409
         Chain 4 -- -1548.629662 -- -25.624409


      Using a relative burnin of 25.0 % for diagnostics

      Chain results (1000000 generations requested):

          0 -- [-1504.176] (-1486.785) (-1547.432) (-1525.596) * [-1525.596] (-1547.432) (-1560.208) (-1548.630) 
        500 -- [-1269.081] (-1274.521) (-1277.580) (-1276.293) * (-1272.945) (-1259.510) [-1270.968] (-1269.652) -- 0:00:00
       1000 -- [-1255.886] (-1268.344) (-1280.183) (-1266.799) * (-1265.066) [-1262.849] (-1271.836) (-1274.209) -- 0:00:00
       1500 -- [-1254.038] (-1258.127) (-1268.556) (-1270.168) * (-1264.291) (-1257.640) (-1264.145) [-1267.159] -- 0:00:00
       2000 -- (-1254.781) [-1254.987] (-1262.070) (-1259.958) * (-1256.672) [-1262.995] (-1263.656) (-1261.581) -- 0:00:00
       2500 -- (-1248.978) [-1253.080] (-1260.385) (-1261.390) * [-1253.735] (-1255.809) (-1252.685) (-1254.392) -- 0:00:00
       3000 -- (-1250.981) [-1248.936] (-1268.301) (-1266.051) * (-1258.314) (-1252.193) [-1258.249] (-1261.656) -- 0:00:00
       3500 -- (-1249.875) [-1250.901] (-1262.226) (-1261.378) * (-1258.259) (-1251.985) [-1249.953] (-1260.210) -- 0:00:00
       4000 -- (-1244.987) [-1250.101] (-1253.924) (-1254.897) * (-1264.455) (-1249.823) [-1254.420] (-1254.245) -- 0:00:00
       4500 -- [-1247.250] (-1247.933) (-1260.788) (-1245.445) * (-1260.174) (-1250.563) (-1252.974) [-1249.907] -- 0:03:41
       5000 -- (-1243.654) (-1249.722) (-1255.402) [-1249.461] * (-1254.144) (-1251.252) (-1256.844) [-1247.647] -- 0:03:19

      Average standard deviation of split frequencies: 0.000000

       5500 -- [-1245.880] (-1250.653) (-1250.756) (-1252.950) * [-1246.332] (-1247.634) (-1251.528) (-1250.223) -- 0:03:00
       6000 -- (-1249.353) (-1246.175) (-1249.869) [-1251.071] * (-1247.969) [-1248.062] (-1250.247) (-1250.336) -- 0:02:45
       6500 -- [-1243.850] (-1247.639) (-1250.464) (-1248.385) * [-1249.541] (-1244.739) (-1252.720) (-1247.537) -- 0:02:32
       7000 -- (-1246.608) [-1250.104] (-1249.031) (-1252.248) * (-1250.721) (-1243.996) (-1248.087) [-1248.306] -- 0:02:21
       7500 -- (-1252.858) (-1250.308) [-1248.809] (-1251.187) * [-1242.317] (-1251.169) (-1249.185) (-1249.340) -- 0:02:12
       8000 -- (-1253.075) (-1250.479) [-1250.758] (-1245.815) * (-1243.746) [-1250.439] (-1247.863) (-1255.301) -- 0:02:04
       8500 -- [-1248.756] (-1241.277) (-1249.027) (-1249.520) * (-1251.403) [-1250.740] (-1252.694) (-1247.354) -- 0:01:56
       9000 -- [-1248.902] (-1248.231) (-1249.542) (-1251.310) * [-1250.174] (-1262.130) (-1246.979) (-1248.671) -- 0:01:50
       9500 -- (-1251.527) (-1246.728) (-1243.736) [-1249.198] * (-1253.411) (-1243.405) [-1252.751] (-1250.491) -- 0:01:44
      10000 -- (-1249.605) (-1249.969) [-1245.618] (-1258.111) * (-1248.851) [-1245.410] (-1253.582) (-1254.136) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      10500 -- (-1249.267) (-1245.838) [-1244.014] (-1253.948) * [-1248.735] (-1248.491) (-1244.852) (-1247.711) -- 0:01:34
      11000 -- (-1245.813) (-1248.347) [-1249.695] (-1248.518) * (-1242.757) [-1245.500] (-1248.731) (-1253.539) -- 0:01:29
      11500 -- (-1250.685) (-1249.590) [-1249.182] (-1247.292) * [-1250.378] (-1242.584) (-1250.712) (-1249.821) -- 0:02:51
      12000 -- (-1250.777) (-1249.798) (-1244.398) [-1249.674] * (-1248.770) [-1248.250] (-1247.912) (-1251.171) -- 0:02:44
      12500 -- (-1255.398) [-1243.182] (-1253.616) (-1243.477) * [-1247.672] (-1246.438) (-1247.194) (-1248.282) -- 0:02:38
      13000 -- (-1251.543) [-1247.177] (-1254.037) (-1242.810) * (-1248.153) (-1246.665) (-1249.057) [-1247.579] -- 0:02:31
      13500 -- (-1250.149) (-1249.235) (-1248.512) [-1246.383] * [-1253.656] (-1249.451) (-1252.005) (-1251.564) -- 0:02:26
      14000 -- (-1247.802) (-1248.865) [-1248.746] (-1246.388) * [-1249.666] (-1251.226) (-1252.910) (-1251.852) -- 0:02:20
      14500 -- (-1254.702) [-1245.201] (-1251.528) (-1253.435) * (-1248.569) [-1245.076] (-1245.135) (-1251.331) -- 0:02:15
      15000 -- (-1252.033) [-1244.777] (-1247.016) (-1245.716) * [-1247.354] (-1252.393) (-1244.016) (-1250.499) -- 0:02:11

      Average standard deviation of split frequencies: 0.014731

      15500 -- (-1248.396) (-1250.940) (-1249.730) [-1244.241] * (-1244.441) (-1252.337) (-1254.082) [-1246.138] -- 0:02:07
      16000 -- (-1251.620) [-1245.982] (-1246.807) (-1243.905) * (-1246.374) (-1247.631) (-1247.789) [-1247.089] -- 0:02:03
      16500 -- (-1246.853) [-1246.607] (-1254.760) (-1247.847) * [-1245.235] (-1246.097) (-1247.637) (-1246.144) -- 0:01:59
      17000 -- (-1245.496) (-1251.732) (-1248.769) [-1250.266] * (-1254.203) [-1246.706] (-1247.388) (-1246.351) -- 0:01:55
      17500 -- (-1250.821) (-1244.586) (-1248.482) [-1248.845] * (-1246.883) (-1248.532) (-1250.114) [-1245.668] -- 0:01:52
      18000 -- (-1254.182) (-1251.755) [-1244.487] (-1248.972) * (-1243.184) (-1250.398) [-1247.528] (-1245.221) -- 0:01:49
      18500 -- (-1253.768) (-1246.485) [-1246.581] (-1248.169) * [-1242.050] (-1249.902) (-1245.437) (-1243.474) -- 0:02:39
      19000 -- (-1248.895) [-1248.640] (-1252.671) (-1252.092) * (-1247.412) (-1246.252) [-1244.774] (-1242.874) -- 0:02:34
      19500 -- (-1253.851) (-1247.631) [-1247.604] (-1251.874) * [-1241.990] (-1244.930) (-1251.332) (-1249.504) -- 0:02:30
      20000 -- [-1250.706] (-1246.148) (-1244.944) (-1250.872) * (-1243.189) (-1249.128) (-1244.942) [-1249.886] -- 0:02:27

      Average standard deviation of split frequencies: 0.011405

      20500 -- [-1248.898] (-1248.748) (-1245.625) (-1256.291) * (-1247.438) (-1244.500) (-1249.692) [-1247.396] -- 0:02:23
      21000 -- (-1250.857) [-1251.801] (-1249.959) (-1256.620) * (-1246.039) (-1254.408) [-1249.556] (-1248.478) -- 0:02:19
      21500 -- (-1251.360) [-1243.213] (-1246.702) (-1252.367) * [-1250.518] (-1252.252) (-1254.594) (-1253.923) -- 0:02:16
      22000 -- (-1254.856) (-1244.971) (-1245.922) [-1248.614] * (-1246.340) (-1251.369) [-1249.769] (-1249.717) -- 0:02:13
      22500 -- (-1248.978) [-1245.275] (-1255.314) (-1250.935) * [-1245.061] (-1255.588) (-1251.051) (-1257.589) -- 0:02:10
      23000 -- (-1252.562) [-1251.128] (-1247.728) (-1251.676) * (-1249.183) [-1248.495] (-1245.312) (-1254.165) -- 0:02:07
      23500 -- (-1257.375) (-1243.431) (-1246.755) [-1251.573] * (-1248.541) (-1245.417) [-1251.741] (-1251.825) -- 0:02:04
      24000 -- (-1262.759) (-1246.494) (-1250.902) [-1245.456] * [-1246.204] (-1245.151) (-1243.449) (-1248.902) -- 0:02:02
      24500 -- (-1250.405) (-1248.759) (-1256.143) [-1244.690] * (-1248.658) (-1246.915) (-1249.273) [-1250.213] -- 0:01:59
      25000 -- (-1248.581) (-1249.316) [-1247.186] (-1240.510) * (-1249.155) [-1252.738] (-1244.587) (-1246.264) -- 0:01:57

      Average standard deviation of split frequencies: 0.009065

      25500 -- (-1255.101) [-1244.284] (-1249.274) (-1244.932) * [-1247.360] (-1251.320) (-1252.941) (-1258.390) -- 0:02:32
      26000 -- [-1248.834] (-1252.501) (-1251.870) (-1244.191) * (-1246.731) (-1252.206) (-1248.214) [-1242.227] -- 0:02:29
      26500 -- [-1248.105] (-1246.977) (-1259.326) (-1246.813) * (-1247.556) (-1255.218) [-1250.859] (-1244.995) -- 0:02:26
      27000 -- [-1244.673] (-1253.476) (-1248.441) (-1252.998) * [-1241.544] (-1250.622) (-1245.145) (-1243.376) -- 0:02:24
      27500 -- (-1253.219) (-1250.250) [-1248.584] (-1251.562) * (-1250.245) [-1251.766] (-1250.346) (-1250.390) -- 0:02:21
      28000 -- [-1248.060] (-1243.672) (-1254.280) (-1247.930) * (-1246.545) [-1243.628] (-1246.591) (-1255.239) -- 0:02:18
      28500 -- (-1248.956) (-1251.079) (-1254.997) [-1246.884] * [-1244.119] (-1246.070) (-1251.569) (-1253.466) -- 0:02:16
      29000 -- (-1249.995) [-1250.960] (-1249.517) (-1250.320) * [-1242.510] (-1248.931) (-1248.704) (-1252.911) -- 0:02:13
      29500 -- (-1250.844) [-1252.131] (-1247.617) (-1254.898) * (-1256.618) (-1245.608) (-1244.948) [-1253.103] -- 0:02:11
      30000 -- [-1254.986] (-1253.347) (-1251.518) (-1249.024) * (-1250.509) (-1250.298) [-1244.589] (-1247.189) -- 0:02:09

      Average standard deviation of split frequencies: 0.007686

      30500 -- (-1253.167) (-1246.508) (-1248.879) [-1258.111] * (-1254.911) (-1247.309) (-1251.724) [-1247.865] -- 0:02:07
      31000 -- (-1249.047) (-1249.719) (-1254.190) [-1252.024] * [-1246.666] (-1255.808) (-1249.728) (-1247.875) -- 0:02:05
      31500 -- (-1250.941) [-1243.884] (-1251.672) (-1249.381) * (-1250.360) (-1247.541) (-1248.394) [-1243.651] -- 0:02:02
      32000 -- (-1246.898) (-1251.400) (-1255.276) [-1246.099] * [-1245.991] (-1248.786) (-1254.777) (-1251.768) -- 0:02:01
      32500 -- (-1251.196) [-1243.140] (-1259.343) (-1247.580) * [-1246.493] (-1244.439) (-1251.933) (-1243.087) -- 0:01:59
      33000 -- (-1252.645) (-1246.310) (-1263.935) [-1244.477] * [-1243.976] (-1246.248) (-1250.163) (-1243.968) -- 0:02:26
      33500 -- [-1253.008] (-1244.156) (-1255.723) (-1244.729) * (-1249.678) [-1247.446] (-1254.282) (-1251.842) -- 0:02:24
      34000 -- (-1248.917) (-1249.753) (-1252.994) [-1250.011] * (-1246.942) (-1243.648) [-1247.976] (-1258.004) -- 0:02:22
      34500 -- [-1247.286] (-1251.583) (-1254.911) (-1256.417) * (-1246.684) (-1247.875) (-1252.060) [-1246.081] -- 0:02:19
      35000 -- (-1243.719) [-1248.886] (-1256.285) (-1252.318) * (-1247.796) (-1254.340) (-1256.058) [-1247.592] -- 0:02:17

      Average standard deviation of split frequencies: 0.013095

      35500 -- [-1246.246] (-1249.741) (-1256.366) (-1250.207) * (-1246.748) [-1247.284] (-1251.793) (-1248.853) -- 0:02:15
      36000 -- (-1250.417) [-1248.180] (-1254.363) (-1248.285) * (-1246.982) (-1245.959) [-1250.563] (-1248.713) -- 0:02:13
      36500 -- (-1248.209) (-1256.052) (-1251.703) [-1244.224] * (-1245.019) (-1252.115) [-1248.348] (-1254.633) -- 0:02:11
      37000 -- (-1244.061) (-1253.619) (-1249.374) [-1243.689] * [-1247.967] (-1249.108) (-1249.499) (-1248.600) -- 0:02:10
      37500 -- [-1244.111] (-1256.749) (-1254.106) (-1249.291) * (-1251.347) [-1248.019] (-1247.537) (-1250.130) -- 0:02:08
      38000 -- [-1246.347] (-1253.101) (-1251.641) (-1245.997) * (-1249.210) [-1249.525] (-1247.006) (-1249.791) -- 0:02:06
      38500 -- (-1245.356) (-1255.353) (-1259.231) [-1245.405] * (-1249.923) [-1248.706] (-1248.423) (-1246.555) -- 0:02:04
      39000 -- (-1244.184) [-1251.036] (-1251.724) (-1249.325) * (-1251.721) (-1249.133) (-1246.991) [-1241.890] -- 0:02:03
      39500 -- (-1241.577) (-1253.179) [-1247.383] (-1246.675) * (-1248.854) (-1244.737) [-1246.544] (-1245.997) -- 0:02:01
      40000 -- (-1246.087) (-1255.994) [-1250.016] (-1250.569) * (-1249.269) (-1245.278) [-1247.659] (-1254.835) -- 0:02:24

      Average standard deviation of split frequencies: 0.011592

      40500 -- (-1244.532) [-1248.431] (-1257.310) (-1247.524) * (-1246.198) (-1245.828) [-1248.412] (-1243.592) -- 0:02:22
      41000 -- [-1243.830] (-1255.632) (-1254.867) (-1245.776) * [-1250.104] (-1246.014) (-1240.156) (-1247.514) -- 0:02:20
      41500 -- (-1246.704) (-1246.492) (-1246.094) [-1247.270] * [-1246.659] (-1244.597) (-1248.719) (-1242.582) -- 0:02:18
      42000 -- (-1251.512) [-1249.169] (-1245.667) (-1247.184) * (-1245.059) (-1251.395) [-1247.019] (-1246.997) -- 0:02:16
      42500 -- [-1244.520] (-1249.867) (-1247.869) (-1246.472) * (-1247.177) (-1246.448) (-1259.297) [-1247.109] -- 0:02:15
      43000 -- (-1248.375) [-1251.358] (-1245.332) (-1245.067) * (-1244.529) [-1248.092] (-1243.744) (-1254.786) -- 0:02:13
      43500 -- (-1257.473) [-1250.617] (-1245.110) (-1248.848) * (-1244.619) (-1248.336) (-1250.596) [-1256.348] -- 0:02:11
      44000 -- (-1249.493) (-1247.211) [-1247.690] (-1246.325) * [-1244.388] (-1244.326) (-1248.375) (-1255.651) -- 0:02:10
      44500 -- (-1253.005) (-1249.901) (-1249.645) [-1245.164] * (-1244.138) (-1244.523) (-1251.090) [-1246.705] -- 0:02:08
      45000 -- (-1247.406) (-1251.446) (-1247.712) [-1243.667] * (-1245.784) (-1248.947) [-1243.188] (-1253.177) -- 0:02:07

      Average standard deviation of split frequencies: 0.010248

      45500 -- (-1244.098) (-1251.297) (-1250.445) [-1242.805] * [-1244.924] (-1244.657) (-1242.106) (-1252.720) -- 0:02:05
      46000 -- (-1246.742) (-1247.878) (-1255.335) [-1252.191] * (-1242.628) (-1254.559) (-1251.028) [-1245.348] -- 0:02:04
      46500 -- (-1245.747) (-1255.769) [-1255.570] (-1249.782) * (-1248.239) (-1244.848) [-1249.648] (-1243.891) -- 0:02:03
      47000 -- (-1253.377) (-1252.774) (-1255.506) [-1247.915] * (-1248.357) (-1247.360) [-1249.914] (-1250.899) -- 0:02:21
      47500 -- [-1244.591] (-1248.740) (-1251.118) (-1245.706) * (-1244.373) (-1250.808) (-1249.130) [-1249.352] -- 0:02:20
      48000 -- (-1254.792) (-1254.501) (-1245.860) [-1246.170] * (-1256.058) [-1249.247] (-1260.011) (-1251.657) -- 0:02:18
      48500 -- (-1260.927) [-1250.745] (-1248.594) (-1251.363) * (-1257.878) (-1247.779) (-1246.935) [-1242.941] -- 0:02:17
      49000 -- (-1251.052) (-1250.743) (-1254.067) [-1242.807] * [-1257.238] (-1247.490) (-1253.801) (-1248.203) -- 0:02:15
      49500 -- (-1249.852) (-1249.144) (-1251.853) [-1245.576] * (-1248.830) [-1244.666] (-1251.525) (-1249.808) -- 0:02:14
      50000 -- (-1250.778) (-1250.437) (-1256.098) [-1249.509] * [-1245.621] (-1246.224) (-1248.373) (-1244.896) -- 0:02:13

      Average standard deviation of split frequencies: 0.009304

      50500 -- (-1245.902) (-1243.029) (-1250.690) [-1244.926] * (-1252.059) (-1251.713) [-1249.060] (-1243.424) -- 0:02:11
      51000 -- (-1250.719) (-1250.358) (-1246.849) [-1242.217] * (-1254.964) (-1248.332) (-1252.558) [-1247.158] -- 0:02:10
      51500 -- (-1246.255) (-1247.302) [-1245.788] (-1244.916) * (-1245.307) (-1246.645) [-1244.759] (-1252.058) -- 0:02:08
      52000 -- (-1246.827) [-1249.155] (-1261.992) (-1251.691) * [-1246.983] (-1246.214) (-1247.239) (-1254.349) -- 0:02:07
      52500 -- (-1251.887) [-1250.554] (-1257.169) (-1253.556) * (-1250.991) (-1246.112) (-1255.113) [-1247.993] -- 0:02:06
      53000 -- (-1244.451) (-1248.630) [-1247.923] (-1245.815) * (-1246.100) (-1253.309) [-1252.319] (-1245.608) -- 0:02:05
      53500 -- (-1249.947) [-1253.771] (-1248.542) (-1254.226) * (-1246.783) (-1246.636) (-1246.347) [-1245.387] -- 0:02:03
      54000 -- (-1247.162) [-1248.566] (-1245.440) (-1251.186) * (-1247.515) [-1245.658] (-1251.818) (-1246.454) -- 0:02:02
      54500 -- (-1245.960) (-1249.176) (-1248.287) [-1251.885] * (-1251.583) (-1245.600) [-1247.552] (-1253.967) -- 0:02:18
      55000 -- (-1250.274) (-1248.895) [-1252.405] (-1250.716) * (-1246.163) (-1246.592) (-1251.206) [-1251.490] -- 0:02:17

      Average standard deviation of split frequencies: 0.008418

      55500 -- [-1253.305] (-1254.014) (-1246.094) (-1249.311) * (-1248.027) (-1247.112) [-1246.334] (-1247.083) -- 0:02:16
      56000 -- (-1244.763) [-1251.722] (-1246.124) (-1246.088) * (-1248.485) (-1245.831) (-1245.058) [-1244.731] -- 0:02:14
      56500 -- [-1243.983] (-1247.723) (-1245.434) (-1253.565) * (-1248.744) (-1244.076) (-1250.088) [-1246.112] -- 0:02:13
      57000 -- [-1248.094] (-1257.185) (-1242.332) (-1249.855) * (-1245.696) [-1245.750] (-1250.433) (-1243.986) -- 0:02:12
      57500 -- (-1249.354) (-1250.476) [-1243.115] (-1252.828) * (-1249.923) (-1243.446) [-1244.418] (-1247.599) -- 0:02:11
      58000 -- (-1249.560) [-1249.275] (-1245.810) (-1252.647) * (-1252.510) (-1250.529) (-1244.086) [-1243.575] -- 0:02:09
      58500 -- [-1249.687] (-1250.935) (-1249.865) (-1248.980) * (-1244.553) [-1248.290] (-1246.073) (-1249.414) -- 0:02:08
      59000 -- [-1246.368] (-1246.628) (-1252.748) (-1245.174) * (-1247.875) [-1240.383] (-1243.776) (-1251.228) -- 0:02:07
      59500 -- (-1245.127) (-1244.560) (-1251.009) [-1245.028] * (-1244.075) [-1248.701] (-1248.403) (-1251.565) -- 0:02:06
      60000 -- (-1247.386) [-1244.085] (-1267.618) (-1249.559) * (-1254.472) (-1248.993) (-1251.002) [-1246.908] -- 0:02:05

      Average standard deviation of split frequencies: 0.007770

      60500 -- [-1249.415] (-1244.864) (-1257.647) (-1247.020) * (-1247.380) (-1249.714) [-1249.881] (-1244.603) -- 0:02:04
      61000 -- (-1249.838) [-1245.434] (-1254.588) (-1250.890) * (-1255.283) (-1248.071) (-1252.372) [-1245.598] -- 0:02:03
      61500 -- [-1246.625] (-1246.430) (-1250.113) (-1243.203) * (-1254.633) [-1248.496] (-1247.290) (-1252.805) -- 0:02:17
      62000 -- (-1247.733) (-1242.312) [-1247.855] (-1249.401) * (-1251.567) [-1245.126] (-1249.547) (-1247.659) -- 0:02:16
      62500 -- (-1245.309) (-1246.511) (-1255.970) [-1243.364] * (-1256.149) [-1248.005] (-1248.026) (-1254.516) -- 0:02:15
      63000 -- (-1244.411) (-1248.493) (-1249.929) [-1244.067] * (-1262.858) [-1245.420] (-1243.758) (-1246.795) -- 0:02:13
      63500 -- (-1250.404) (-1246.721) (-1258.783) [-1243.142] * (-1248.674) (-1248.525) (-1253.877) [-1245.141] -- 0:02:12
      64000 -- [-1248.076] (-1244.713) (-1251.209) (-1246.699) * (-1251.707) (-1249.225) (-1250.533) [-1252.901] -- 0:02:11
      64500 -- [-1244.468] (-1251.551) (-1250.781) (-1245.687) * [-1249.070] (-1250.907) (-1250.046) (-1246.499) -- 0:02:10
      65000 -- [-1243.699] (-1249.046) (-1243.624) (-1252.968) * (-1245.905) [-1242.652] (-1249.838) (-1249.567) -- 0:02:09

      Average standard deviation of split frequencies: 0.007142

      65500 -- (-1251.658) [-1253.950] (-1245.509) (-1249.407) * (-1252.801) [-1248.567] (-1247.507) (-1248.570) -- 0:02:08
      66000 -- (-1252.771) [-1249.255] (-1246.246) (-1251.740) * (-1244.625) [-1247.503] (-1255.826) (-1249.408) -- 0:02:07
      66500 -- (-1244.170) (-1247.119) (-1246.519) [-1248.134] * (-1248.398) (-1253.792) [-1248.146] (-1244.164) -- 0:02:06
      67000 -- [-1248.806] (-1247.334) (-1249.679) (-1249.744) * (-1250.516) (-1243.386) (-1249.136) [-1246.673] -- 0:02:05
      67500 -- (-1248.272) (-1248.401) [-1244.383] (-1249.892) * [-1250.284] (-1242.879) (-1252.909) (-1246.923) -- 0:02:04
      68000 -- (-1248.617) [-1246.500] (-1252.429) (-1253.205) * [-1247.695] (-1248.978) (-1244.490) (-1245.464) -- 0:02:03
      68500 -- (-1244.840) (-1249.739) [-1249.862] (-1249.167) * (-1247.623) [-1253.073] (-1245.813) (-1246.187) -- 0:02:15
      69000 -- [-1247.878] (-1243.824) (-1248.201) (-1248.471) * (-1252.485) (-1242.887) [-1248.469] (-1255.192) -- 0:02:14
      69500 -- (-1247.693) (-1251.133) [-1246.638] (-1249.398) * (-1251.475) (-1247.559) (-1253.196) [-1251.346] -- 0:02:13
      70000 -- (-1254.533) (-1256.102) [-1248.895] (-1255.104) * [-1257.728] (-1245.091) (-1250.388) (-1254.691) -- 0:02:12

      Average standard deviation of split frequencies: 0.006671

      70500 -- (-1251.899) [-1250.831] (-1244.745) (-1247.533) * (-1253.802) [-1244.202] (-1248.155) (-1254.108) -- 0:02:11
      71000 -- (-1246.525) (-1247.144) [-1247.355] (-1245.903) * [-1252.863] (-1247.424) (-1243.354) (-1245.918) -- 0:02:10
      71500 -- [-1247.939] (-1255.114) (-1247.673) (-1245.269) * (-1250.443) (-1252.546) [-1245.436] (-1243.128) -- 0:02:09
      72000 -- (-1244.431) [-1244.141] (-1248.937) (-1245.860) * (-1246.675) (-1250.660) [-1243.982] (-1248.463) -- 0:02:08
      72500 -- (-1245.880) (-1242.238) (-1249.286) [-1248.262] * (-1254.132) (-1245.725) [-1244.102] (-1247.872) -- 0:02:07
      73000 -- (-1246.362) (-1253.387) [-1243.865] (-1245.721) * [-1246.054] (-1248.499) (-1248.580) (-1249.039) -- 0:02:06
      73500 -- (-1247.620) (-1247.528) [-1245.266] (-1245.318) * (-1247.240) [-1245.754] (-1252.894) (-1247.361) -- 0:02:06
      74000 -- (-1246.282) [-1246.366] (-1245.558) (-1244.790) * [-1244.294] (-1242.400) (-1247.324) (-1247.390) -- 0:02:05
      74500 -- (-1253.191) [-1248.920] (-1251.526) (-1254.608) * (-1245.983) [-1249.153] (-1249.381) (-1245.681) -- 0:02:04
      75000 -- (-1246.940) [-1248.056] (-1256.960) (-1250.701) * (-1242.261) [-1246.167] (-1245.468) (-1251.684) -- 0:02:03

      Average standard deviation of split frequencies: 0.006203

      75500 -- (-1244.643) [-1245.161] (-1250.955) (-1249.823) * (-1246.872) [-1246.867] (-1247.956) (-1247.904) -- 0:02:14
      76000 -- [-1243.799] (-1245.912) (-1248.355) (-1254.100) * [-1251.774] (-1245.980) (-1248.074) (-1246.847) -- 0:02:13
      76500 -- (-1245.736) (-1247.257) [-1245.764] (-1249.074) * [-1245.824] (-1247.903) (-1248.129) (-1246.812) -- 0:02:12
      77000 -- (-1245.800) (-1253.413) (-1250.759) [-1248.129] * (-1249.419) (-1248.948) [-1249.028] (-1248.522) -- 0:02:11
      77500 -- [-1245.529] (-1250.926) (-1248.080) (-1252.728) * (-1252.769) [-1245.371] (-1247.113) (-1248.937) -- 0:02:10
      78000 -- [-1249.037] (-1248.869) (-1252.344) (-1245.571) * (-1249.608) [-1245.964] (-1246.218) (-1254.528) -- 0:02:10
      78500 -- (-1249.574) [-1248.967] (-1248.311) (-1247.074) * (-1246.725) [-1245.395] (-1247.474) (-1245.528) -- 0:02:09
      79000 -- [-1248.016] (-1249.297) (-1249.604) (-1244.544) * (-1254.453) [-1248.556] (-1251.835) (-1246.287) -- 0:02:08
      79500 -- (-1252.414) [-1247.642] (-1245.579) (-1247.293) * (-1246.855) (-1246.622) (-1248.754) [-1253.106] -- 0:02:07
      80000 -- (-1252.056) (-1254.493) (-1247.266) [-1244.834] * (-1245.401) (-1246.196) (-1247.866) [-1249.789] -- 0:02:06

      Average standard deviation of split frequencies: 0.008766

      80500 -- (-1245.387) (-1246.638) [-1245.225] (-1248.121) * (-1247.472) (-1241.660) [-1244.351] (-1246.385) -- 0:02:05
      81000 -- (-1249.258) [-1246.765] (-1248.995) (-1242.863) * [-1244.396] (-1243.660) (-1244.014) (-1247.342) -- 0:02:04
      81500 -- (-1246.652) (-1253.862) (-1246.331) [-1244.590] * (-1247.698) [-1246.338] (-1246.154) (-1247.260) -- 0:02:03
      82000 -- (-1245.687) (-1255.382) (-1249.969) [-1254.069] * (-1246.309) (-1248.270) [-1249.961] (-1245.313) -- 0:02:03
      82500 -- (-1247.053) (-1247.892) [-1245.863] (-1248.572) * [-1250.088] (-1244.888) (-1247.569) (-1245.347) -- 0:02:13
      83000 -- (-1251.071) (-1247.696) [-1251.941] (-1252.639) * (-1253.928) (-1248.135) (-1249.601) [-1244.097] -- 0:02:12
      83500 -- (-1251.198) (-1245.979) (-1245.028) [-1245.672] * (-1252.563) (-1249.177) (-1250.594) [-1243.991] -- 0:02:11
      84000 -- (-1253.986) [-1247.921] (-1245.517) (-1244.414) * (-1255.383) (-1251.561) [-1246.405] (-1244.013) -- 0:02:10
      84500 -- (-1246.888) (-1249.284) (-1243.626) [-1243.454] * (-1250.429) [-1245.145] (-1253.237) (-1246.620) -- 0:02:10
      85000 -- [-1245.617] (-1250.533) (-1248.819) (-1245.851) * (-1254.180) [-1248.926] (-1245.492) (-1247.658) -- 0:02:09

      Average standard deviation of split frequencies: 0.008222

      85500 -- (-1247.192) (-1245.674) (-1248.936) [-1244.103] * (-1255.462) (-1246.989) (-1244.542) [-1252.025] -- 0:02:08
      86000 -- (-1245.010) (-1254.889) (-1250.971) [-1245.342] * (-1244.300) (-1251.147) [-1243.559] (-1246.922) -- 0:02:07
      86500 -- [-1246.551] (-1245.713) (-1246.276) (-1244.804) * (-1247.430) (-1244.937) (-1247.731) [-1245.868] -- 0:02:06
      87000 -- [-1241.645] (-1249.704) (-1248.410) (-1249.173) * (-1251.457) (-1249.117) [-1245.868] (-1253.669) -- 0:02:05
      87500 -- (-1243.344) (-1250.738) [-1247.705] (-1253.188) * (-1247.263) (-1245.422) [-1240.126] (-1252.950) -- 0:02:05
      88000 -- (-1248.183) (-1247.733) (-1253.766) [-1248.184] * [-1244.383] (-1246.716) (-1249.761) (-1245.586) -- 0:02:04
      88500 -- [-1249.384] (-1250.837) (-1249.304) (-1252.490) * (-1249.654) (-1256.248) [-1243.808] (-1245.484) -- 0:02:03
      89000 -- (-1248.159) (-1256.219) [-1246.431] (-1248.231) * (-1248.260) [-1247.015] (-1246.205) (-1247.128) -- 0:02:02
      89500 -- [-1244.940] (-1254.182) (-1245.454) (-1251.677) * (-1248.409) [-1246.112] (-1250.371) (-1244.348) -- 0:02:12
      90000 -- [-1245.013] (-1254.101) (-1251.121) (-1241.145) * (-1251.672) [-1247.796] (-1248.973) (-1246.016) -- 0:02:11

      Average standard deviation of split frequencies: 0.007799

      90500 -- (-1250.055) (-1251.204) [-1246.650] (-1243.781) * (-1252.179) [-1251.047] (-1245.292) (-1251.600) -- 0:02:10
      91000 -- (-1252.444) (-1247.377) [-1242.840] (-1254.573) * (-1243.750) (-1251.301) [-1243.046] (-1248.749) -- 0:02:09
      91500 -- (-1254.941) (-1249.835) [-1247.606] (-1255.767) * [-1247.449] (-1248.237) (-1247.001) (-1241.532) -- 0:02:09
      92000 -- (-1251.902) (-1250.341) (-1244.284) [-1245.957] * (-1256.263) [-1244.917] (-1250.575) (-1254.123) -- 0:02:08
      92500 -- (-1250.567) (-1260.122) (-1245.320) [-1245.491] * (-1244.840) (-1248.805) (-1253.154) [-1245.506] -- 0:02:07
      93000 -- (-1246.018) (-1258.985) [-1245.326] (-1249.062) * (-1246.365) (-1254.774) (-1253.336) [-1249.837] -- 0:02:06
      93500 -- [-1245.637] (-1252.074) (-1242.351) (-1251.070) * (-1249.262) (-1255.077) (-1251.334) [-1248.081] -- 0:02:06
      94000 -- (-1243.958) (-1251.240) [-1247.596] (-1255.838) * (-1244.898) (-1251.734) (-1249.801) [-1254.624] -- 0:02:05
      94500 -- [-1243.967] (-1250.814) (-1250.478) (-1250.228) * (-1255.736) [-1247.786] (-1253.779) (-1249.725) -- 0:02:04
      95000 -- (-1244.113) (-1251.261) [-1254.000] (-1251.421) * (-1250.831) [-1247.897] (-1254.542) (-1254.209) -- 0:02:03

      Average standard deviation of split frequencies: 0.004910

      95500 -- (-1245.909) [-1251.092] (-1245.398) (-1252.994) * (-1253.831) [-1244.687] (-1255.090) (-1247.979) -- 0:02:03
      96000 -- (-1248.496) [-1246.976] (-1247.702) (-1252.018) * (-1254.004) (-1246.075) (-1251.479) [-1245.928] -- 0:02:02
      96500 -- (-1254.651) [-1246.465] (-1246.230) (-1248.942) * [-1250.291] (-1244.004) (-1249.984) (-1248.037) -- 0:02:11
      97000 -- (-1249.566) [-1243.370] (-1245.172) (-1249.140) * (-1252.624) (-1252.578) [-1250.511] (-1246.975) -- 0:02:10
      97500 -- (-1249.952) [-1246.301] (-1243.822) (-1249.869) * (-1248.986) (-1245.508) [-1248.269] (-1246.542) -- 0:02:09
      98000 -- [-1248.954] (-1244.646) (-1247.349) (-1247.521) * [-1251.858] (-1252.398) (-1245.823) (-1248.803) -- 0:02:08
      98500 -- (-1245.410) (-1244.989) (-1243.374) [-1247.079] * (-1249.644) (-1254.586) [-1250.048] (-1251.182) -- 0:02:08
      99000 -- [-1242.470] (-1253.651) (-1246.853) (-1247.884) * (-1246.385) [-1244.644] (-1246.356) (-1247.564) -- 0:02:07
      99500 -- [-1243.439] (-1243.176) (-1243.093) (-1248.126) * [-1244.666] (-1250.178) (-1253.153) (-1248.067) -- 0:02:06
      100000 -- (-1251.530) [-1245.761] (-1249.362) (-1244.152) * (-1244.180) (-1252.216) [-1247.603] (-1251.282) -- 0:02:05

      Average standard deviation of split frequencies: 0.004683

      100500 -- (-1246.049) [-1247.426] (-1248.958) (-1247.293) * (-1247.745) (-1244.635) [-1244.635] (-1251.474) -- 0:02:05
      101000 -- (-1249.287) (-1245.101) (-1250.257) [-1250.664] * (-1244.987) (-1251.958) (-1252.754) [-1243.922] -- 0:02:04
      101500 -- (-1245.904) [-1248.076] (-1250.828) (-1252.398) * [-1252.759] (-1252.809) (-1252.344) (-1245.715) -- 0:02:03
      102000 -- (-1249.114) (-1246.780) [-1245.544] (-1250.022) * (-1254.528) (-1251.903) (-1246.720) [-1243.892] -- 0:02:03
      102500 -- (-1248.332) [-1247.814] (-1242.273) (-1249.254) * (-1250.824) (-1250.604) [-1252.805] (-1247.671) -- 0:02:02
      103000 -- [-1248.764] (-1247.743) (-1246.641) (-1247.561) * (-1242.375) (-1250.329) [-1250.439] (-1247.195) -- 0:02:01
      103500 -- (-1254.116) (-1251.100) (-1246.116) [-1244.766] * (-1245.391) (-1249.817) [-1249.272] (-1250.143) -- 0:02:01
      104000 -- (-1253.553) [-1242.965] (-1245.080) (-1243.836) * (-1248.195) [-1250.844] (-1250.900) (-1249.542) -- 0:02:09
      104500 -- (-1248.748) (-1246.847) [-1244.759] (-1244.416) * (-1244.987) [-1247.406] (-1246.630) (-1252.834) -- 0:02:08
      105000 -- (-1245.436) (-1251.877) (-1247.953) [-1249.211] * [-1244.365] (-1253.476) (-1253.207) (-1243.351) -- 0:02:07

      Average standard deviation of split frequencies: 0.004447

      105500 -- [-1247.177] (-1250.985) (-1247.867) (-1254.063) * [-1245.805] (-1254.847) (-1252.338) (-1250.743) -- 0:02:07
      106000 -- (-1252.410) (-1246.826) (-1250.395) [-1248.122] * (-1245.440) [-1242.412] (-1255.613) (-1247.035) -- 0:02:06
      106500 -- (-1252.611) (-1255.623) (-1244.613) [-1246.423] * (-1248.201) [-1247.391] (-1254.702) (-1244.193) -- 0:02:05
      107000 -- (-1248.160) (-1244.468) (-1257.947) [-1245.090] * (-1248.243) [-1248.081] (-1254.284) (-1243.453) -- 0:02:05
      107500 -- (-1252.378) (-1250.757) (-1253.952) [-1243.136] * (-1247.064) (-1251.453) (-1256.785) [-1248.165] -- 0:02:04
      108000 -- (-1249.362) (-1254.475) (-1249.682) [-1243.567] * (-1254.118) (-1246.988) (-1248.454) [-1246.263] -- 0:02:03
      108500 -- (-1252.232) (-1247.945) (-1248.851) [-1243.894] * (-1245.316) [-1246.999] (-1252.264) (-1246.398) -- 0:02:03
      109000 -- (-1255.757) (-1247.757) (-1249.587) [-1243.778] * [-1246.838] (-1250.890) (-1246.893) (-1248.871) -- 0:02:02
      109500 -- (-1255.150) [-1249.461] (-1248.831) (-1247.933) * (-1248.863) (-1247.360) [-1248.013] (-1252.191) -- 0:02:01
      110000 -- (-1258.697) (-1251.065) (-1248.609) [-1245.378] * (-1251.615) (-1249.445) (-1247.911) [-1249.979] -- 0:02:01

      Average standard deviation of split frequencies: 0.004260

      110500 -- [-1245.987] (-1253.716) (-1251.598) (-1245.584) * (-1245.812) (-1249.368) [-1247.475] (-1250.878) -- 0:02:00
      111000 -- (-1246.429) [-1246.672] (-1253.928) (-1245.088) * (-1246.912) (-1244.764) (-1245.802) [-1250.400] -- 0:02:00
      111500 -- (-1242.806) (-1250.499) [-1247.996] (-1245.875) * [-1242.364] (-1246.886) (-1245.596) (-1251.359) -- 0:02:07
      112000 -- (-1242.011) (-1251.469) [-1241.918] (-1247.605) * (-1240.794) [-1250.204] (-1242.417) (-1248.028) -- 0:02:06
      112500 -- (-1245.954) [-1253.378] (-1245.826) (-1250.402) * [-1245.914] (-1242.328) (-1243.590) (-1253.392) -- 0:02:06
      113000 -- (-1244.703) (-1246.757) (-1250.472) [-1254.002] * (-1247.538) [-1241.868] (-1247.478) (-1248.632) -- 0:02:05
      113500 -- (-1246.039) [-1247.994] (-1244.164) (-1257.021) * [-1245.304] (-1252.875) (-1248.816) (-1251.503) -- 0:02:04
      114000 -- [-1245.756] (-1245.870) (-1248.315) (-1250.010) * (-1252.627) [-1248.110] (-1246.163) (-1245.932) -- 0:02:04
      114500 -- [-1244.213] (-1250.724) (-1251.363) (-1250.248) * (-1252.214) (-1246.099) (-1246.206) [-1252.978] -- 0:02:03
      115000 -- [-1246.756] (-1245.980) (-1248.553) (-1254.783) * (-1254.486) (-1245.923) [-1248.053] (-1248.874) -- 0:02:03

      Average standard deviation of split frequencies: 0.002032

      115500 -- (-1253.283) [-1245.421] (-1247.828) (-1249.883) * [-1250.795] (-1246.064) (-1245.649) (-1248.552) -- 0:02:02
      116000 -- (-1251.329) (-1247.793) [-1250.323] (-1245.069) * (-1254.496) [-1248.336] (-1244.918) (-1257.068) -- 0:02:01
      116500 -- (-1250.224) [-1247.777] (-1245.652) (-1248.081) * (-1246.316) (-1247.306) (-1243.698) [-1251.481] -- 0:02:01
      117000 -- (-1250.689) (-1247.145) [-1249.622] (-1249.657) * (-1249.674) (-1249.665) [-1248.164] (-1248.544) -- 0:02:00
      117500 -- (-1250.826) (-1246.554) [-1250.211] (-1252.128) * (-1248.163) (-1246.599) (-1249.513) [-1247.918] -- 0:02:00
      118000 -- [-1245.475] (-1252.702) (-1248.955) (-1252.780) * [-1246.775] (-1249.506) (-1250.023) (-1248.666) -- 0:01:59
      118500 -- [-1248.120] (-1249.364) (-1256.050) (-1257.856) * (-1245.107) [-1254.137] (-1244.223) (-1253.362) -- 0:02:06
      119000 -- (-1247.347) (-1248.335) [-1249.742] (-1249.618) * [-1248.459] (-1254.435) (-1250.000) (-1250.114) -- 0:02:05
      119500 -- (-1243.776) (-1251.365) [-1248.479] (-1247.933) * [-1245.867] (-1248.264) (-1250.616) (-1250.609) -- 0:02:05
      120000 -- [-1242.148] (-1251.516) (-1246.462) (-1252.004) * [-1245.287] (-1247.417) (-1251.182) (-1252.577) -- 0:02:04

      Average standard deviation of split frequencies: 0.001953

      120500 -- (-1248.081) (-1246.416) (-1247.280) [-1246.174] * (-1245.333) (-1245.445) (-1251.976) [-1248.150] -- 0:02:04
      121000 -- (-1252.900) (-1244.263) [-1245.240] (-1244.827) * (-1246.930) (-1258.279) [-1252.190] (-1243.951) -- 0:02:03
      121500 -- [-1249.507] (-1249.110) (-1240.706) (-1247.988) * (-1247.108) [-1247.185] (-1251.181) (-1246.199) -- 0:02:02
      122000 -- (-1253.947) (-1249.127) [-1241.937] (-1244.852) * [-1248.111] (-1245.302) (-1249.647) (-1246.553) -- 0:02:02
      122500 -- (-1245.482) [-1246.049] (-1242.809) (-1250.093) * [-1255.155] (-1250.073) (-1246.266) (-1247.224) -- 0:02:01
      123000 -- (-1253.140) (-1247.629) [-1244.164] (-1247.829) * (-1252.585) (-1248.873) (-1246.912) [-1245.039] -- 0:02:01
      123500 -- (-1250.671) [-1254.660] (-1248.813) (-1252.709) * (-1253.588) (-1245.428) [-1246.808] (-1246.454) -- 0:02:00
      124000 -- [-1243.335] (-1256.752) (-1242.567) (-1248.473) * (-1248.996) (-1247.864) (-1249.355) [-1246.710] -- 0:02:00
      124500 -- [-1244.088] (-1251.197) (-1245.461) (-1253.242) * [-1247.110] (-1247.804) (-1252.980) (-1248.108) -- 0:01:59
      125000 -- (-1247.996) (-1257.131) [-1244.690] (-1247.005) * (-1245.860) (-1249.612) [-1247.416] (-1250.049) -- 0:01:59

      Average standard deviation of split frequencies: 0.000000

      125500 -- (-1246.695) (-1249.008) [-1245.547] (-1250.229) * [-1244.323] (-1244.048) (-1247.045) (-1252.484) -- 0:01:58
      126000 -- [-1254.031] (-1251.972) (-1251.047) (-1248.551) * [-1250.242] (-1246.510) (-1249.146) (-1251.668) -- 0:02:04
      126500 -- (-1248.376) (-1245.915) (-1247.989) [-1249.637] * (-1248.329) (-1250.134) (-1245.960) [-1244.803] -- 0:02:04
      127000 -- [-1243.788] (-1243.573) (-1249.522) (-1245.494) * (-1246.787) (-1252.824) (-1255.571) [-1244.921] -- 0:02:03
      127500 -- (-1243.906) (-1249.167) (-1243.053) [-1246.461] * (-1245.017) (-1249.968) [-1245.227] (-1245.222) -- 0:02:03
      128000 -- (-1248.005) [-1244.722] (-1245.297) (-1248.835) * (-1251.148) (-1248.993) [-1245.411] (-1250.183) -- 0:02:02
      128500 -- [-1248.911] (-1256.025) (-1245.659) (-1248.031) * (-1245.597) (-1247.922) [-1244.627] (-1246.938) -- 0:02:02
      129000 -- (-1259.741) (-1246.952) [-1250.543] (-1257.031) * (-1252.592) (-1251.319) [-1246.725] (-1248.057) -- 0:02:01
      129500 -- (-1248.662) [-1245.154] (-1243.760) (-1247.454) * (-1263.225) [-1246.604] (-1248.585) (-1246.938) -- 0:02:00
      130000 -- (-1249.754) (-1249.703) (-1248.664) [-1244.873] * (-1248.019) (-1248.952) [-1246.009] (-1248.790) -- 0:02:00

      Average standard deviation of split frequencies: 0.000000

      130500 -- [-1248.376] (-1249.180) (-1247.854) (-1245.964) * (-1247.365) (-1243.709) [-1243.767] (-1251.381) -- 0:01:59
      131000 -- (-1251.662) (-1248.111) (-1247.639) [-1244.723] * (-1246.974) (-1248.735) [-1246.860] (-1242.749) -- 0:01:59
      131500 -- (-1251.198) [-1245.078] (-1249.473) (-1252.173) * (-1248.561) [-1247.760] (-1244.158) (-1251.581) -- 0:01:58
      132000 -- (-1249.361) (-1254.676) [-1247.079] (-1248.969) * (-1247.964) (-1249.886) (-1246.595) [-1243.243] -- 0:01:58
      132500 -- [-1246.909] (-1250.313) (-1250.449) (-1241.384) * [-1248.993] (-1242.610) (-1245.062) (-1248.002) -- 0:01:57
      133000 -- (-1250.896) (-1254.753) (-1254.409) [-1250.236] * (-1247.399) (-1247.211) (-1251.817) [-1247.841] -- 0:01:57
      133500 -- (-1251.203) (-1253.045) [-1251.530] (-1245.121) * (-1250.840) [-1247.144] (-1252.374) (-1244.768) -- 0:02:03
      134000 -- [-1245.593] (-1253.852) (-1258.348) (-1252.347) * [-1247.824] (-1247.666) (-1250.406) (-1249.495) -- 0:02:02
      134500 -- (-1252.150) [-1251.783] (-1251.396) (-1246.700) * (-1244.907) [-1247.896] (-1248.619) (-1247.454) -- 0:02:02
      135000 -- (-1243.920) (-1250.610) (-1250.325) [-1243.271] * (-1251.793) [-1246.187] (-1248.478) (-1256.015) -- 0:02:01

      Average standard deviation of split frequencies: 0.001733

      135500 -- (-1244.303) (-1249.068) (-1250.722) [-1246.026] * (-1249.771) (-1247.589) [-1250.724] (-1253.025) -- 0:02:01
      136000 -- (-1254.208) (-1254.563) [-1253.710] (-1247.027) * [-1247.510] (-1252.657) (-1253.462) (-1246.624) -- 0:02:00
      136500 -- (-1245.633) [-1253.651] (-1248.304) (-1250.368) * (-1245.433) [-1248.890] (-1244.188) (-1245.171) -- 0:02:00
      137000 -- [-1248.031] (-1249.100) (-1244.200) (-1251.177) * [-1253.513] (-1247.696) (-1245.168) (-1250.882) -- 0:01:59
      137500 -- [-1245.851] (-1255.716) (-1254.773) (-1247.870) * (-1249.314) (-1245.447) (-1251.439) [-1249.132] -- 0:01:59
      138000 -- [-1253.755] (-1255.140) (-1253.626) (-1248.718) * (-1244.470) (-1250.952) [-1246.833] (-1252.479) -- 0:01:58
      138500 -- (-1250.961) [-1247.317] (-1255.048) (-1251.287) * [-1248.435] (-1245.146) (-1249.801) (-1250.272) -- 0:01:58
      139000 -- [-1245.763] (-1249.216) (-1252.087) (-1248.610) * (-1252.959) (-1249.069) [-1242.707] (-1252.581) -- 0:01:57
      139500 -- [-1246.018] (-1246.741) (-1244.836) (-1246.458) * (-1247.139) [-1252.402] (-1247.227) (-1253.517) -- 0:01:57
      140000 -- [-1247.706] (-1246.766) (-1250.733) (-1248.110) * (-1251.927) (-1243.958) (-1259.769) [-1249.090] -- 0:01:56

      Average standard deviation of split frequencies: 0.003351

      140500 -- (-1250.731) (-1247.799) [-1246.008] (-1248.003) * (-1246.224) (-1246.343) (-1253.627) [-1249.826] -- 0:01:56
      141000 -- (-1243.618) [-1253.114] (-1252.733) (-1244.045) * (-1249.258) (-1250.349) (-1244.305) [-1249.141] -- 0:02:01
      141500 -- [-1249.274] (-1251.173) (-1252.537) (-1245.112) * (-1249.698) (-1243.822) (-1250.443) [-1248.734] -- 0:02:01
      142000 -- [-1246.947] (-1249.411) (-1252.304) (-1246.751) * (-1246.219) (-1250.602) (-1252.908) [-1246.258] -- 0:02:00
      142500 -- (-1244.634) [-1248.793] (-1254.401) (-1242.400) * (-1248.190) (-1256.282) (-1259.432) [-1243.366] -- 0:02:00
      143000 -- (-1247.727) [-1249.157] (-1246.107) (-1249.643) * (-1251.550) [-1249.756] (-1254.581) (-1244.979) -- 0:01:59
      143500 -- (-1244.829) (-1250.587) [-1246.143] (-1249.110) * (-1252.428) (-1253.681) (-1249.885) [-1245.882] -- 0:01:59
      144000 -- (-1248.997) (-1249.168) [-1241.969] (-1248.393) * (-1248.547) (-1252.203) [-1246.895] (-1249.982) -- 0:01:58
      144500 -- (-1254.074) [-1245.341] (-1249.272) (-1245.126) * (-1248.664) (-1251.645) (-1254.273) [-1245.038] -- 0:01:58
      145000 -- (-1253.489) (-1245.949) (-1251.532) [-1243.391] * [-1248.072] (-1253.450) (-1255.031) (-1249.816) -- 0:01:57

      Average standard deviation of split frequencies: 0.003229

      145500 -- (-1254.961) (-1245.707) (-1245.547) [-1243.229] * (-1245.064) [-1247.502] (-1253.951) (-1245.135) -- 0:01:57
      146000 -- (-1250.151) (-1251.644) [-1251.176] (-1248.850) * (-1253.769) (-1248.265) (-1251.429) [-1246.771] -- 0:01:56
      146500 -- (-1247.216) (-1250.887) (-1248.561) [-1247.372] * [-1255.660] (-1256.233) (-1249.724) (-1249.912) -- 0:01:56
      147000 -- (-1250.118) (-1252.005) (-1249.106) [-1245.679] * (-1252.742) (-1249.886) [-1246.878] (-1250.078) -- 0:01:56
      147500 -- [-1249.724] (-1250.410) (-1246.316) (-1249.641) * (-1250.945) (-1249.224) [-1248.592] (-1249.022) -- 0:01:55
      148000 -- [-1249.183] (-1246.079) (-1249.992) (-1248.828) * (-1248.008) [-1244.824] (-1248.542) (-1249.924) -- 0:02:00
      148500 -- (-1250.262) [-1252.460] (-1244.794) (-1246.131) * (-1246.139) [-1247.604] (-1247.897) (-1256.832) -- 0:02:00
      149000 -- (-1246.014) (-1249.318) (-1245.465) [-1247.878] * (-1247.081) (-1248.909) [-1244.195] (-1247.607) -- 0:01:59
      149500 -- (-1252.862) (-1248.482) (-1246.509) [-1245.681] * (-1250.510) (-1248.631) [-1248.944] (-1246.462) -- 0:01:59
      150000 -- (-1254.176) [-1253.530] (-1248.020) (-1248.763) * (-1248.461) (-1256.330) [-1247.676] (-1246.303) -- 0:01:58

      Average standard deviation of split frequencies: 0.003129

      150500 -- (-1250.346) (-1257.341) [-1248.960] (-1248.341) * (-1253.194) [-1251.124] (-1256.721) (-1244.475) -- 0:01:58
      151000 -- [-1245.838] (-1256.622) (-1251.890) (-1247.008) * (-1249.626) (-1251.367) [-1249.623] (-1247.676) -- 0:01:58
      151500 -- (-1246.456) (-1258.174) [-1249.307] (-1253.585) * (-1253.303) (-1253.117) (-1253.047) [-1245.313] -- 0:01:57
      152000 -- (-1246.436) [-1246.909] (-1248.740) (-1246.632) * (-1255.026) (-1250.482) (-1251.438) [-1247.266] -- 0:01:57
      152500 -- [-1246.999] (-1250.475) (-1246.882) (-1248.931) * (-1256.039) [-1245.751] (-1253.009) (-1250.164) -- 0:01:56
      153000 -- (-1253.062) (-1244.642) (-1244.719) [-1249.633] * (-1258.746) (-1248.777) (-1246.842) [-1245.728] -- 0:01:56
      153500 -- (-1254.952) (-1242.356) (-1247.461) [-1251.497] * (-1257.248) (-1253.111) (-1248.448) [-1241.449] -- 0:01:55
      154000 -- (-1257.959) (-1245.177) (-1251.312) [-1249.767] * (-1255.614) [-1247.617] (-1250.117) (-1244.705) -- 0:01:55
      154500 -- (-1256.664) [-1244.549] (-1247.300) (-1245.691) * (-1248.942) [-1248.057] (-1247.109) (-1247.196) -- 0:01:54
      155000 -- (-1251.679) (-1244.645) (-1249.927) [-1245.489] * [-1249.374] (-1247.775) (-1249.670) (-1248.460) -- 0:01:54

      Average standard deviation of split frequencies: 0.003022

      155500 -- (-1254.541) (-1243.321) (-1249.163) [-1241.949] * (-1250.080) [-1250.836] (-1245.032) (-1249.053) -- 0:01:59
      156000 -- (-1249.719) (-1248.882) (-1246.952) [-1245.575] * (-1244.820) [-1253.610] (-1250.305) (-1251.044) -- 0:01:59
      156500 -- (-1249.974) (-1251.137) [-1246.155] (-1242.923) * (-1249.956) [-1246.879] (-1251.868) (-1245.028) -- 0:01:58
      157000 -- (-1254.674) [-1242.899] (-1249.720) (-1249.046) * [-1253.356] (-1249.094) (-1251.508) (-1246.447) -- 0:01:58
      157500 -- (-1248.886) [-1251.909] (-1253.893) (-1247.971) * [-1252.362] (-1252.254) (-1250.797) (-1244.392) -- 0:01:57
      158000 -- [-1246.132] (-1247.749) (-1251.463) (-1258.367) * (-1245.448) (-1246.783) [-1249.452] (-1248.287) -- 0:01:57
      158500 -- (-1244.209) [-1247.732] (-1247.573) (-1247.702) * (-1250.018) (-1245.696) [-1245.145] (-1249.330) -- 0:01:56
      159000 -- (-1249.890) [-1246.409] (-1246.562) (-1252.766) * (-1244.466) (-1246.150) [-1250.382] (-1250.558) -- 0:01:56
      159500 -- (-1247.744) (-1249.698) [-1249.886] (-1250.441) * (-1244.514) [-1246.298] (-1248.173) (-1244.863) -- 0:01:55
      160000 -- (-1243.778) [-1248.481] (-1246.954) (-1243.499) * (-1242.350) [-1247.674] (-1243.956) (-1245.960) -- 0:01:55

      Average standard deviation of split frequencies: 0.002934

      160500 -- (-1246.975) (-1250.530) (-1252.370) [-1242.681] * (-1248.676) (-1248.068) [-1245.504] (-1248.601) -- 0:01:55
      161000 -- [-1247.715] (-1251.824) (-1247.285) (-1248.436) * (-1246.993) (-1248.758) [-1247.993] (-1246.547) -- 0:01:54
      161500 -- (-1245.907) [-1253.908] (-1245.920) (-1251.426) * (-1244.579) [-1251.888] (-1243.267) (-1245.538) -- 0:01:54
      162000 -- (-1250.240) (-1254.882) (-1247.098) [-1243.277] * (-1244.395) (-1253.672) [-1248.253] (-1248.170) -- 0:01:53
      162500 -- (-1250.691) [-1251.736] (-1248.564) (-1259.674) * (-1251.269) (-1250.649) [-1246.938] (-1248.473) -- 0:01:53
      163000 -- (-1248.282) [-1246.300] (-1244.349) (-1248.629) * (-1253.054) [-1248.786] (-1251.616) (-1247.873) -- 0:01:58
      163500 -- (-1253.702) (-1248.915) (-1247.296) [-1245.843] * (-1250.393) [-1250.844] (-1251.775) (-1250.199) -- 0:01:57
      164000 -- (-1254.204) [-1249.029] (-1249.038) (-1250.405) * [-1246.511] (-1250.479) (-1243.175) (-1244.871) -- 0:01:57
      164500 -- (-1251.619) (-1242.777) (-1250.141) [-1242.009] * (-1245.140) (-1247.790) [-1242.770] (-1250.295) -- 0:01:56
      165000 -- (-1247.817) (-1243.229) [-1245.183] (-1246.755) * (-1247.227) (-1248.755) (-1246.138) [-1241.710] -- 0:01:56

      Average standard deviation of split frequencies: 0.002840

      165500 -- (-1251.944) (-1245.890) (-1248.665) [-1247.676] * (-1249.113) (-1248.142) (-1246.951) [-1250.280] -- 0:01:55
      166000 -- (-1250.896) [-1245.171] (-1251.882) (-1248.470) * [-1252.750] (-1242.586) (-1245.823) (-1247.198) -- 0:01:55
      166500 -- (-1251.803) [-1248.805] (-1250.509) (-1244.398) * (-1248.733) [-1247.643] (-1245.527) (-1251.285) -- 0:01:55
      167000 -- (-1249.056) (-1247.110) [-1249.704] (-1245.980) * [-1249.195] (-1249.682) (-1250.985) (-1250.455) -- 0:01:54
      167500 -- (-1249.805) [-1246.529] (-1246.475) (-1244.883) * (-1254.264) (-1250.362) [-1246.863] (-1246.809) -- 0:01:54
      168000 -- (-1251.019) (-1249.654) [-1247.924] (-1249.939) * [-1247.903] (-1248.034) (-1250.506) (-1252.972) -- 0:01:53
      168500 -- (-1252.169) (-1246.162) [-1247.145] (-1252.651) * (-1248.489) [-1243.201] (-1244.499) (-1248.852) -- 0:01:53
      169000 -- (-1249.250) (-1252.144) (-1258.008) [-1247.831] * (-1247.089) (-1248.063) (-1247.725) [-1249.069] -- 0:01:53
      169500 -- [-1251.340] (-1256.147) (-1263.178) (-1247.466) * (-1250.198) (-1246.791) [-1246.936] (-1249.001) -- 0:01:52
      170000 -- (-1254.642) [-1250.358] (-1248.051) (-1247.435) * [-1244.928] (-1251.095) (-1243.974) (-1250.145) -- 0:01:52

      Average standard deviation of split frequencies: 0.002762

      170500 -- (-1254.245) [-1252.819] (-1246.721) (-1242.832) * [-1249.734] (-1245.212) (-1245.392) (-1250.901) -- 0:01:56
      171000 -- (-1253.968) (-1247.815) (-1246.623) [-1248.871] * (-1255.644) (-1247.122) [-1249.203] (-1249.774) -- 0:01:56
      171500 -- [-1248.631] (-1255.181) (-1249.570) (-1256.344) * (-1253.143) (-1250.902) [-1246.616] (-1249.796) -- 0:01:55
      172000 -- (-1243.951) [-1252.370] (-1248.896) (-1245.698) * [-1250.525] (-1244.234) (-1242.026) (-1244.335) -- 0:01:55
      172500 -- (-1250.302) [-1245.376] (-1261.092) (-1255.125) * (-1244.787) (-1245.281) [-1244.013] (-1247.128) -- 0:01:55
      173000 -- (-1242.886) (-1247.664) (-1246.379) [-1250.240] * (-1246.468) [-1252.121] (-1250.919) (-1248.007) -- 0:01:54
      173500 -- [-1252.486] (-1247.365) (-1250.058) (-1251.037) * (-1250.183) (-1256.964) [-1248.663] (-1247.548) -- 0:01:54
      174000 -- (-1246.325) (-1246.308) [-1245.438] (-1252.298) * (-1259.257) [-1247.319] (-1251.297) (-1246.611) -- 0:01:53
      174500 -- (-1240.558) [-1246.073] (-1245.034) (-1253.478) * [-1250.299] (-1254.133) (-1251.105) (-1248.727) -- 0:01:53
      175000 -- [-1251.518] (-1249.433) (-1245.304) (-1251.757) * (-1255.619) [-1246.987] (-1256.396) (-1251.326) -- 0:01:53

      Average standard deviation of split frequencies: 0.004018

      175500 -- [-1247.177] (-1259.889) (-1248.698) (-1245.598) * (-1253.351) [-1243.155] (-1254.017) (-1252.567) -- 0:01:52
      176000 -- [-1242.172] (-1254.528) (-1251.734) (-1243.661) * (-1249.035) (-1245.364) (-1251.510) [-1245.921] -- 0:01:52
      176500 -- (-1248.996) (-1253.150) (-1245.636) [-1246.310] * (-1250.330) (-1250.837) (-1253.756) [-1246.817] -- 0:01:51
      177000 -- (-1252.694) (-1250.298) (-1252.032) [-1242.999] * (-1249.360) (-1246.675) (-1246.323) [-1241.365] -- 0:01:51
      177500 -- (-1245.951) [-1245.983] (-1250.081) (-1248.641) * (-1245.095) (-1246.486) (-1242.147) [-1243.954] -- 0:01:55
      178000 -- (-1255.664) (-1249.201) (-1250.795) [-1245.921] * (-1249.820) (-1250.538) (-1245.367) [-1247.206] -- 0:01:55
      178500 -- (-1254.677) (-1248.821) (-1253.348) [-1245.573] * (-1246.745) [-1241.927] (-1242.351) (-1262.181) -- 0:01:55
      179000 -- (-1247.443) (-1248.212) (-1246.888) [-1242.457] * (-1246.700) [-1240.538] (-1245.474) (-1253.866) -- 0:01:54
      179500 -- (-1249.973) (-1254.913) (-1246.788) [-1243.534] * (-1251.455) (-1245.259) [-1245.580] (-1246.677) -- 0:01:54
      180000 -- (-1253.627) (-1246.550) (-1249.135) [-1247.035] * (-1251.346) [-1244.398] (-1252.712) (-1246.368) -- 0:01:53

      Average standard deviation of split frequencies: 0.003914

      180500 -- (-1249.128) (-1254.845) (-1247.254) [-1248.576] * (-1251.542) [-1245.042] (-1249.419) (-1249.919) -- 0:01:53
      181000 -- (-1244.072) (-1249.225) (-1251.822) [-1250.319] * (-1248.854) [-1244.856] (-1246.142) (-1245.896) -- 0:01:53
      181500 -- (-1247.011) (-1249.054) (-1246.377) [-1246.923] * (-1246.981) (-1250.151) [-1246.304] (-1250.732) -- 0:01:52
      182000 -- (-1253.599) (-1244.576) (-1247.550) [-1251.039] * (-1245.570) (-1254.495) [-1250.554] (-1253.952) -- 0:01:52
      182500 -- (-1254.590) [-1245.011] (-1245.251) (-1248.386) * (-1244.139) [-1247.831] (-1248.294) (-1247.986) -- 0:01:51
      183000 -- (-1247.421) (-1251.190) [-1248.787] (-1250.128) * [-1249.278] (-1250.058) (-1245.538) (-1244.617) -- 0:01:51
      183500 -- (-1246.427) (-1247.451) [-1256.057] (-1259.246) * (-1248.737) [-1250.751] (-1250.911) (-1253.287) -- 0:01:51
      184000 -- (-1246.411) [-1246.046] (-1258.300) (-1251.706) * (-1249.088) [-1244.989] (-1246.872) (-1246.945) -- 0:01:50
      184500 -- [-1245.849] (-1246.727) (-1252.800) (-1251.569) * (-1248.104) (-1245.215) [-1250.682] (-1244.377) -- 0:01:50
      185000 -- [-1250.264] (-1245.367) (-1245.094) (-1251.342) * (-1248.754) [-1244.257] (-1246.435) (-1244.600) -- 0:01:54

      Average standard deviation of split frequencies: 0.005069

      185500 -- [-1245.860] (-1249.536) (-1247.657) (-1252.614) * (-1246.305) (-1248.180) (-1248.818) [-1248.248] -- 0:01:54
      186000 -- (-1248.153) (-1247.760) (-1243.587) [-1252.612] * [-1248.340] (-1250.525) (-1249.937) (-1251.890) -- 0:01:53
      186500 -- (-1250.132) (-1244.704) (-1246.504) [-1254.835] * (-1243.064) [-1249.048] (-1245.044) (-1249.442) -- 0:01:53
      187000 -- [-1245.361] (-1246.331) (-1246.675) (-1252.016) * (-1253.959) (-1248.973) (-1249.588) [-1246.035] -- 0:01:53
      187500 -- (-1249.303) (-1245.122) [-1247.668] (-1251.855) * (-1246.047) (-1253.729) (-1251.038) [-1250.229] -- 0:01:52
      188000 -- [-1247.538] (-1251.050) (-1248.466) (-1248.591) * (-1253.034) (-1247.085) [-1251.112] (-1247.982) -- 0:01:52
      188500 -- (-1246.915) (-1243.742) [-1246.850] (-1251.927) * (-1245.797) (-1244.785) [-1254.693] (-1245.004) -- 0:01:51
      189000 -- (-1246.358) (-1244.692) [-1248.701] (-1251.547) * (-1246.443) (-1251.593) (-1250.844) [-1244.417] -- 0:01:51
      189500 -- (-1251.689) [-1245.553] (-1254.832) (-1248.571) * (-1246.705) [-1255.221] (-1253.747) (-1246.046) -- 0:01:51
      190000 -- [-1249.887] (-1246.654) (-1258.503) (-1256.663) * (-1248.714) [-1247.637] (-1249.103) (-1250.639) -- 0:01:50

      Average standard deviation of split frequencies: 0.002472

      190500 -- (-1247.364) [-1248.101] (-1251.966) (-1252.851) * (-1252.451) (-1243.038) [-1248.364] (-1252.880) -- 0:01:50
      191000 -- (-1247.314) [-1251.854] (-1253.364) (-1247.381) * (-1249.442) (-1246.221) (-1250.808) [-1246.948] -- 0:01:50
      191500 -- (-1243.011) (-1246.812) [-1248.402] (-1249.609) * (-1250.802) [-1251.619] (-1241.806) (-1249.074) -- 0:01:49
      192000 -- (-1248.571) [-1251.386] (-1249.403) (-1250.640) * (-1250.287) [-1245.779] (-1247.935) (-1249.663) -- 0:01:49
      192500 -- (-1255.578) (-1245.777) (-1248.233) [-1253.056] * (-1251.068) (-1248.495) (-1255.273) [-1245.503] -- 0:01:53
      193000 -- (-1251.166) (-1253.838) [-1246.898] (-1250.413) * (-1259.866) [-1245.819] (-1249.988) (-1247.126) -- 0:01:52
      193500 -- (-1255.324) [-1250.718] (-1250.669) (-1248.635) * (-1253.425) (-1245.054) (-1248.512) [-1246.893] -- 0:01:52
      194000 -- [-1244.204] (-1250.485) (-1249.140) (-1246.638) * (-1257.105) (-1245.446) [-1248.679] (-1246.646) -- 0:01:52
      194500 -- [-1250.599] (-1246.074) (-1254.290) (-1247.506) * (-1251.124) [-1244.103] (-1257.846) (-1250.183) -- 0:01:51
      195000 -- (-1246.509) (-1252.284) [-1246.064] (-1247.022) * (-1251.198) (-1251.900) (-1247.292) [-1245.093] -- 0:01:51

      Average standard deviation of split frequencies: 0.002405

      195500 -- (-1246.752) (-1249.407) [-1244.586] (-1247.922) * (-1257.012) (-1253.049) (-1247.688) [-1241.824] -- 0:01:51
      196000 -- (-1253.322) (-1248.080) (-1249.234) [-1248.691] * (-1252.765) [-1246.883] (-1250.912) (-1249.160) -- 0:01:50
      196500 -- (-1243.897) [-1245.505] (-1253.927) (-1247.730) * (-1263.403) (-1250.701) (-1246.913) [-1244.585] -- 0:01:50
      197000 -- (-1242.980) (-1247.068) (-1249.234) [-1241.757] * (-1256.557) (-1246.210) [-1249.358] (-1246.631) -- 0:01:50
      197500 -- (-1253.798) [-1240.769] (-1252.548) (-1250.425) * (-1254.050) (-1246.492) [-1249.347] (-1249.458) -- 0:01:49
      198000 -- (-1249.942) [-1246.492] (-1246.165) (-1244.277) * (-1253.970) (-1241.586) (-1250.246) [-1248.354] -- 0:01:49
      198500 -- [-1248.035] (-1247.329) (-1253.956) (-1246.170) * (-1252.567) [-1248.678] (-1246.218) (-1248.724) -- 0:01:49
      199000 -- (-1252.815) (-1247.999) (-1246.778) [-1243.828] * (-1257.213) [-1248.023] (-1250.384) (-1249.229) -- 0:01:48
      199500 -- (-1253.228) [-1243.955] (-1255.292) (-1247.234) * (-1253.970) (-1245.425) [-1246.702] (-1253.810) -- 0:01:48
      200000 -- (-1253.668) [-1249.139] (-1245.920) (-1242.786) * [-1251.945] (-1258.665) (-1248.348) (-1248.541) -- 0:01:51

      Average standard deviation of split frequencies: 0.001175

      200500 -- [-1249.410] (-1253.231) (-1246.304) (-1246.410) * (-1258.449) (-1248.233) (-1245.399) [-1248.454] -- 0:01:51
      201000 -- (-1250.276) (-1254.286) [-1252.784] (-1246.027) * [-1250.536] (-1256.485) (-1251.650) (-1252.930) -- 0:01:51
      201500 -- (-1251.828) [-1249.345] (-1244.829) (-1247.246) * (-1249.119) (-1251.331) (-1262.022) [-1247.153] -- 0:01:50
      202000 -- (-1254.144) (-1244.007) [-1245.545] (-1249.766) * (-1251.673) (-1251.407) (-1246.099) [-1241.916] -- 0:01:50
      202500 -- (-1256.356) (-1251.876) (-1249.380) [-1242.805] * (-1245.382) (-1250.037) (-1246.729) [-1243.412] -- 0:01:50
      203000 -- (-1249.725) [-1246.711] (-1249.703) (-1248.653) * (-1250.388) (-1249.030) (-1249.422) [-1242.973] -- 0:01:49
      203500 -- (-1248.335) [-1245.675] (-1247.946) (-1249.435) * (-1249.304) (-1243.346) [-1243.481] (-1247.792) -- 0:01:49
      204000 -- (-1251.809) (-1251.063) [-1241.621] (-1253.175) * (-1245.573) (-1246.376) (-1249.654) [-1245.509] -- 0:01:49
      204500 -- [-1251.184] (-1248.453) (-1245.687) (-1249.054) * [-1246.938] (-1252.073) (-1247.061) (-1249.332) -- 0:01:48
      205000 -- [-1248.503] (-1247.283) (-1253.845) (-1250.351) * (-1253.671) (-1247.998) (-1249.926) [-1251.659] -- 0:01:48

      Average standard deviation of split frequencies: 0.002288

      205500 -- (-1243.957) [-1245.701] (-1244.327) (-1248.826) * [-1246.652] (-1242.367) (-1242.997) (-1247.603) -- 0:01:48
      206000 -- (-1246.287) (-1244.394) (-1246.384) [-1250.225] * (-1249.492) (-1249.086) [-1245.211] (-1252.825) -- 0:01:47
      206500 -- (-1245.046) [-1248.864] (-1246.434) (-1243.834) * (-1249.200) (-1243.558) (-1246.900) [-1243.665] -- 0:01:47
      207000 -- (-1243.538) [-1244.391] (-1244.668) (-1254.222) * [-1253.731] (-1250.818) (-1251.886) (-1255.519) -- 0:01:51
      207500 -- (-1242.963) (-1245.260) [-1242.773] (-1248.941) * [-1247.451] (-1252.405) (-1249.807) (-1249.075) -- 0:01:50
      208000 -- (-1245.180) [-1246.942] (-1242.462) (-1255.449) * (-1248.667) [-1243.260] (-1245.989) (-1255.596) -- 0:01:50
      208500 -- [-1251.260] (-1248.379) (-1244.022) (-1249.769) * [-1251.042] (-1256.106) (-1248.116) (-1246.195) -- 0:01:50
      209000 -- [-1248.821] (-1245.648) (-1245.141) (-1249.596) * (-1247.393) [-1249.342] (-1247.983) (-1251.127) -- 0:01:49
      209500 -- (-1253.522) (-1248.217) (-1245.595) [-1247.627] * (-1253.249) [-1251.934] (-1240.881) (-1245.004) -- 0:01:49
      210000 -- (-1250.115) (-1249.716) (-1246.096) [-1244.408] * (-1251.809) (-1249.130) [-1241.756] (-1243.005) -- 0:01:49

      Average standard deviation of split frequencies: 0.001119

      210500 -- (-1246.673) (-1253.453) [-1241.341] (-1252.788) * [-1251.631] (-1247.910) (-1248.698) (-1249.188) -- 0:01:48
      211000 -- (-1252.315) (-1250.815) (-1249.463) [-1243.317] * (-1250.054) (-1247.398) (-1246.429) [-1251.844] -- 0:01:48
      211500 -- (-1252.743) (-1249.816) [-1243.876] (-1247.163) * (-1246.375) (-1247.719) (-1246.491) [-1246.239] -- 0:01:48
      212000 -- [-1249.922] (-1247.026) (-1244.909) (-1246.994) * (-1251.330) [-1247.907] (-1244.256) (-1251.164) -- 0:01:47
      212500 -- [-1245.125] (-1251.015) (-1245.990) (-1244.734) * [-1246.883] (-1246.776) (-1252.574) (-1250.979) -- 0:01:47
      213000 -- (-1248.702) (-1244.480) (-1250.062) [-1243.669] * (-1245.653) [-1246.278] (-1244.000) (-1250.435) -- 0:01:47
      213500 -- (-1245.363) [-1243.221] (-1248.444) (-1250.914) * (-1247.933) (-1253.089) (-1247.458) [-1247.548] -- 0:01:46
      214000 -- [-1246.149] (-1248.738) (-1247.786) (-1253.955) * (-1252.480) (-1247.068) (-1251.205) [-1246.045] -- 0:01:46
      214500 -- (-1247.219) (-1249.900) [-1242.094] (-1248.441) * [-1252.378] (-1247.979) (-1252.649) (-1246.208) -- 0:01:49
      215000 -- (-1249.456) (-1242.700) (-1248.320) [-1246.104] * (-1249.697) (-1248.639) [-1252.799] (-1244.618) -- 0:01:49

      Average standard deviation of split frequencies: 0.001091

      215500 -- (-1252.131) [-1247.880] (-1243.831) (-1248.414) * [-1244.701] (-1247.205) (-1253.954) (-1254.780) -- 0:01:49
      216000 -- (-1247.266) (-1245.043) [-1251.732] (-1249.940) * (-1249.273) (-1251.316) (-1257.692) [-1248.589] -- 0:01:48
      216500 -- [-1243.986] (-1249.849) (-1251.508) (-1249.829) * (-1257.449) [-1244.446] (-1258.887) (-1251.154) -- 0:01:48
      217000 -- (-1246.988) [-1250.076] (-1248.078) (-1244.438) * (-1247.846) (-1242.798) [-1251.114] (-1243.436) -- 0:01:48
      217500 -- (-1251.933) (-1246.910) [-1245.940] (-1244.950) * (-1247.526) (-1244.081) (-1249.843) [-1246.635] -- 0:01:47
      218000 -- [-1249.210] (-1248.580) (-1245.256) (-1244.666) * (-1243.468) (-1246.672) (-1251.402) [-1249.455] -- 0:01:47
      218500 -- [-1243.362] (-1255.586) (-1246.028) (-1249.448) * (-1253.349) (-1250.328) (-1247.566) [-1246.122] -- 0:01:47
      219000 -- (-1245.568) (-1255.900) (-1247.842) [-1244.789] * (-1255.658) [-1247.672] (-1253.072) (-1254.480) -- 0:01:46
      219500 -- (-1258.351) (-1255.625) [-1254.151] (-1248.313) * (-1252.552) [-1248.168] (-1248.040) (-1248.231) -- 0:01:46
      220000 -- (-1247.645) (-1247.907) (-1247.391) [-1248.394] * (-1246.605) [-1243.111] (-1247.660) (-1247.759) -- 0:01:46

      Average standard deviation of split frequencies: 0.001068

      220500 -- [-1246.603] (-1253.841) (-1249.366) (-1243.960) * (-1246.066) [-1245.608] (-1247.856) (-1254.231) -- 0:01:46
      221000 -- (-1259.220) [-1247.971] (-1250.724) (-1246.845) * (-1245.546) [-1246.680] (-1248.736) (-1252.925) -- 0:01:45
      221500 -- (-1248.097) [-1246.272] (-1256.672) (-1249.612) * [-1249.581] (-1248.260) (-1245.102) (-1251.165) -- 0:01:45
      222000 -- (-1244.812) (-1243.587) (-1251.709) [-1244.738] * (-1250.421) (-1247.011) (-1251.192) [-1247.728] -- 0:01:48
      222500 -- (-1242.671) [-1250.690] (-1249.537) (-1260.736) * (-1252.343) (-1245.251) [-1248.477] (-1245.532) -- 0:01:48
      223000 -- [-1248.429] (-1250.432) (-1247.688) (-1249.312) * [-1247.914] (-1242.251) (-1247.759) (-1252.961) -- 0:01:48
      223500 -- (-1247.939) (-1252.500) (-1248.557) [-1245.224] * [-1250.303] (-1247.540) (-1246.687) (-1247.131) -- 0:01:47
      224000 -- (-1245.485) [-1247.638] (-1246.264) (-1242.869) * [-1252.586] (-1250.173) (-1249.296) (-1251.244) -- 0:01:47
      224500 -- (-1248.596) (-1250.616) [-1240.359] (-1248.156) * (-1245.168) (-1246.216) [-1248.780] (-1251.176) -- 0:01:47
      225000 -- (-1250.889) (-1242.444) (-1242.435) [-1241.760] * (-1244.775) (-1249.320) (-1246.811) [-1248.254] -- 0:01:46

      Average standard deviation of split frequencies: 0.001043

      225500 -- (-1246.010) (-1256.441) [-1242.368] (-1245.208) * (-1249.792) (-1247.530) [-1251.689] (-1251.339) -- 0:01:46
      226000 -- (-1248.712) (-1247.554) (-1245.574) [-1248.634] * (-1243.920) (-1249.143) (-1260.839) [-1248.335] -- 0:01:46
      226500 -- (-1245.412) [-1245.285] (-1244.768) (-1243.436) * (-1249.250) [-1252.735] (-1253.567) (-1250.927) -- 0:01:45
      227000 -- (-1252.270) (-1244.659) [-1244.972] (-1250.781) * (-1244.180) (-1245.912) (-1247.844) [-1251.848] -- 0:01:45
      227500 -- (-1252.032) (-1243.707) (-1243.783) [-1251.198] * [-1245.743] (-1246.641) (-1251.427) (-1246.023) -- 0:01:45
      228000 -- (-1253.376) (-1248.261) [-1249.110] (-1249.867) * (-1242.877) [-1248.529] (-1250.870) (-1245.299) -- 0:01:44
      228500 -- (-1259.223) [-1257.405] (-1245.573) (-1251.396) * [-1249.664] (-1244.417) (-1251.703) (-1243.094) -- 0:01:44
      229000 -- (-1249.691) (-1261.783) [-1245.411] (-1249.695) * [-1252.549] (-1242.919) (-1247.178) (-1251.021) -- 0:01:44
      229500 -- (-1247.401) (-1254.843) [-1253.427] (-1249.467) * (-1251.275) (-1243.406) (-1251.572) [-1241.888] -- 0:01:47
      230000 -- (-1248.324) [-1253.998] (-1253.340) (-1249.151) * (-1243.770) (-1248.017) [-1245.958] (-1248.228) -- 0:01:47

      Average standard deviation of split frequencies: 0.000000

      230500 -- [-1248.185] (-1247.840) (-1247.957) (-1255.464) * [-1244.480] (-1256.335) (-1248.362) (-1254.249) -- 0:01:46
      231000 -- (-1249.786) [-1248.183] (-1241.841) (-1253.416) * [-1243.201] (-1241.888) (-1254.784) (-1251.581) -- 0:01:46
      231500 -- (-1249.577) (-1247.828) (-1243.817) [-1247.738] * [-1244.947] (-1250.519) (-1245.729) (-1245.800) -- 0:01:46
      232000 -- (-1251.439) (-1251.086) (-1242.670) [-1252.323] * (-1245.968) (-1249.549) [-1245.296] (-1244.936) -- 0:01:45
      232500 -- [-1258.377] (-1249.411) (-1244.118) (-1247.142) * [-1247.462] (-1247.073) (-1241.243) (-1249.715) -- 0:01:45
      233000 -- (-1249.251) (-1256.500) (-1247.436) [-1245.273] * [-1243.400] (-1249.713) (-1248.311) (-1241.607) -- 0:01:45
      233500 -- (-1259.941) (-1252.392) (-1250.112) [-1244.348] * (-1250.622) (-1243.044) (-1256.607) [-1242.545] -- 0:01:45
      234000 -- (-1245.972) [-1244.535] (-1247.031) (-1247.559) * (-1248.541) (-1250.241) (-1247.325) [-1243.116] -- 0:01:44
      234500 -- (-1253.647) [-1248.062] (-1246.090) (-1249.229) * (-1243.335) (-1242.121) (-1254.881) [-1246.982] -- 0:01:44
      235000 -- (-1248.868) (-1251.561) (-1246.080) [-1248.949] * [-1245.787] (-1245.905) (-1244.184) (-1247.907) -- 0:01:44

      Average standard deviation of split frequencies: 0.000000

      235500 -- [-1246.960] (-1248.007) (-1245.034) (-1254.345) * (-1244.748) (-1252.487) (-1241.449) [-1248.276] -- 0:01:43
      236000 -- (-1253.442) [-1249.473] (-1247.868) (-1246.559) * (-1245.061) [-1251.259] (-1251.245) (-1251.731) -- 0:01:43
      236500 -- (-1254.692) (-1247.401) (-1246.105) [-1244.751] * (-1242.392) [-1251.289] (-1246.200) (-1260.381) -- 0:01:46
      237000 -- [-1249.684] (-1257.007) (-1246.664) (-1245.877) * [-1244.095] (-1254.368) (-1253.729) (-1253.647) -- 0:01:46
      237500 -- (-1256.221) (-1249.993) [-1244.467] (-1244.511) * [-1256.034] (-1245.445) (-1243.655) (-1257.203) -- 0:01:45
      238000 -- (-1252.688) [-1251.081] (-1249.188) (-1243.894) * (-1248.493) [-1240.913] (-1251.207) (-1256.374) -- 0:01:45
      238500 -- [-1244.488] (-1249.651) (-1246.935) (-1241.307) * (-1245.070) (-1248.939) (-1245.523) [-1249.144] -- 0:01:45
      239000 -- (-1247.269) [-1243.743] (-1252.659) (-1248.124) * [-1246.539] (-1249.090) (-1245.815) (-1253.715) -- 0:01:45
      239500 -- [-1246.580] (-1250.512) (-1246.094) (-1244.539) * (-1248.518) [-1246.474] (-1251.031) (-1249.378) -- 0:01:44
      240000 -- (-1245.653) [-1242.298] (-1249.934) (-1249.247) * [-1245.258] (-1246.265) (-1246.205) (-1246.707) -- 0:01:44

      Average standard deviation of split frequencies: 0.000000

      240500 -- [-1241.996] (-1245.439) (-1253.768) (-1248.413) * [-1240.943] (-1250.899) (-1255.936) (-1248.759) -- 0:01:44
      241000 -- (-1246.965) [-1248.875] (-1247.263) (-1264.525) * [-1246.494] (-1249.084) (-1250.680) (-1253.074) -- 0:01:43
      241500 -- [-1249.390] (-1245.776) (-1243.920) (-1257.867) * (-1250.689) [-1247.882] (-1246.411) (-1250.578) -- 0:01:43
      242000 -- (-1243.668) [-1244.525] (-1250.025) (-1246.163) * (-1248.461) (-1250.888) (-1245.574) [-1246.972] -- 0:01:43
      242500 -- (-1251.511) [-1249.342] (-1250.813) (-1248.151) * (-1246.660) [-1245.564] (-1249.344) (-1247.011) -- 0:01:43
      243000 -- (-1253.056) (-1243.760) (-1255.049) [-1247.451] * (-1251.646) (-1254.417) [-1240.894] (-1246.352) -- 0:01:42
      243500 -- (-1251.176) (-1249.873) [-1249.657] (-1254.102) * (-1248.259) (-1251.194) (-1248.627) [-1250.793] -- 0:01:42
      244000 -- (-1260.065) (-1254.684) [-1244.955] (-1245.791) * [-1248.899] (-1253.835) (-1250.760) (-1242.054) -- 0:01:45
      244500 -- (-1257.540) (-1249.370) (-1244.991) [-1255.131] * (-1248.656) (-1255.610) (-1255.764) [-1244.380] -- 0:01:45
      245000 -- (-1255.611) [-1246.610] (-1253.442) (-1247.941) * (-1248.462) (-1254.184) [-1248.805] (-1246.678) -- 0:01:44

      Average standard deviation of split frequencies: 0.000000

      245500 -- [-1253.028] (-1243.427) (-1243.935) (-1247.736) * (-1250.928) (-1255.643) [-1250.348] (-1244.773) -- 0:01:44
      246000 -- (-1249.474) (-1245.327) (-1248.510) [-1251.562] * [-1245.209] (-1247.919) (-1240.114) (-1249.792) -- 0:01:44
      246500 -- (-1252.420) (-1251.298) [-1252.267] (-1254.196) * [-1244.334] (-1249.782) (-1245.893) (-1243.759) -- 0:01:43
      247000 -- (-1255.861) (-1254.727) (-1249.331) [-1252.650] * (-1249.548) (-1247.818) (-1246.713) [-1245.102] -- 0:01:43
      247500 -- (-1248.764) [-1245.544] (-1246.192) (-1246.603) * [-1244.339] (-1249.016) (-1247.803) (-1247.807) -- 0:01:43
      248000 -- (-1253.854) (-1249.560) [-1246.763] (-1241.824) * (-1251.563) (-1246.345) (-1251.001) [-1244.001] -- 0:01:43
      248500 -- (-1249.380) (-1247.549) (-1245.717) [-1247.815] * (-1248.030) (-1257.923) [-1242.483] (-1251.880) -- 0:01:42
      249000 -- (-1251.811) [-1248.546] (-1250.222) (-1248.402) * (-1245.255) (-1248.824) [-1249.081] (-1251.445) -- 0:01:42
      249500 -- (-1253.018) (-1248.413) [-1241.059] (-1244.440) * [-1244.596] (-1254.756) (-1247.847) (-1247.232) -- 0:01:42
      250000 -- (-1247.160) [-1246.293] (-1244.537) (-1247.622) * (-1250.989) [-1250.887] (-1250.007) (-1244.061) -- 0:01:42

      Average standard deviation of split frequencies: 0.000940

      250500 -- [-1256.564] (-1248.812) (-1243.427) (-1254.351) * (-1247.770) [-1250.050] (-1252.931) (-1258.271) -- 0:01:41
      251000 -- (-1249.156) (-1247.425) [-1242.200] (-1251.667) * [-1243.638] (-1247.791) (-1251.590) (-1246.312) -- 0:01:44
      251500 -- (-1249.650) (-1249.920) [-1247.246] (-1249.690) * (-1252.152) (-1251.653) [-1243.275] (-1253.821) -- 0:01:44
      252000 -- (-1249.731) (-1245.173) [-1247.748] (-1245.427) * (-1249.715) (-1259.155) (-1244.640) [-1249.050] -- 0:01:43
      252500 -- (-1244.888) (-1243.031) (-1249.046) [-1247.091] * [-1246.208] (-1252.010) (-1244.720) (-1245.282) -- 0:01:43
      253000 -- (-1248.657) (-1245.737) (-1251.232) [-1243.477] * [-1247.083] (-1246.704) (-1252.004) (-1247.479) -- 0:01:43
      253500 -- [-1248.901] (-1251.799) (-1251.837) (-1245.645) * (-1244.165) (-1252.340) [-1245.597] (-1248.094) -- 0:01:43
      254000 -- (-1250.376) (-1250.879) [-1249.335] (-1253.092) * [-1245.251] (-1247.828) (-1252.354) (-1247.671) -- 0:01:42
      254500 -- (-1252.584) (-1245.978) (-1251.628) [-1246.325] * [-1248.146] (-1245.836) (-1250.103) (-1251.753) -- 0:01:42
      255000 -- (-1252.176) (-1250.661) [-1254.942] (-1247.435) * (-1245.720) (-1256.440) (-1247.688) [-1247.609] -- 0:01:42

      Average standard deviation of split frequencies: 0.000921

      255500 -- [-1248.806] (-1247.505) (-1248.790) (-1244.140) * (-1250.995) [-1248.234] (-1247.614) (-1247.522) -- 0:01:41
      256000 -- (-1245.348) (-1247.242) (-1252.523) [-1249.827] * (-1246.915) [-1255.674] (-1248.334) (-1250.333) -- 0:01:41
      256500 -- (-1254.152) (-1256.231) (-1244.234) [-1246.198] * (-1253.584) (-1244.009) [-1243.714] (-1247.056) -- 0:01:41
      257000 -- (-1251.951) (-1252.092) (-1246.890) [-1243.075] * (-1247.820) (-1242.045) (-1245.080) [-1251.610] -- 0:01:41
      257500 -- (-1253.714) [-1251.356] (-1248.722) (-1241.659) * (-1253.963) [-1243.745] (-1244.861) (-1253.161) -- 0:01:40
      258000 -- (-1246.226) (-1246.975) (-1244.063) [-1246.355] * (-1254.776) (-1246.852) [-1249.019] (-1249.438) -- 0:01:40
      258500 -- (-1254.658) (-1246.126) (-1252.378) [-1245.404] * (-1245.575) (-1243.119) [-1243.836] (-1249.175) -- 0:01:43
      259000 -- [-1244.679] (-1253.053) (-1247.905) (-1245.734) * (-1246.132) [-1243.332] (-1247.067) (-1253.247) -- 0:01:42
      259500 -- (-1252.244) (-1248.302) (-1243.478) [-1251.660] * [-1247.414] (-1249.107) (-1244.948) (-1254.314) -- 0:01:42
      260000 -- (-1251.451) (-1250.872) (-1252.144) [-1252.386] * (-1245.521) [-1247.088] (-1252.210) (-1253.932) -- 0:01:42

      Average standard deviation of split frequencies: 0.000904

      260500 -- [-1249.331] (-1250.074) (-1252.264) (-1246.264) * [-1247.934] (-1246.315) (-1247.746) (-1253.500) -- 0:01:42
      261000 -- (-1250.787) (-1244.769) [-1247.050] (-1242.383) * (-1243.369) [-1247.658] (-1248.928) (-1254.999) -- 0:01:41
      261500 -- (-1250.277) (-1246.100) [-1253.299] (-1245.848) * (-1250.227) [-1253.548] (-1252.990) (-1251.790) -- 0:01:41
      262000 -- [-1251.562] (-1251.625) (-1249.988) (-1246.971) * (-1245.811) (-1247.692) (-1250.520) [-1249.231] -- 0:01:41
      262500 -- (-1258.868) [-1245.263] (-1253.520) (-1246.015) * (-1251.925) (-1246.110) [-1252.469] (-1253.422) -- 0:01:41
      263000 -- [-1245.975] (-1249.661) (-1249.975) (-1247.092) * (-1247.719) (-1244.296) (-1246.005) [-1250.231] -- 0:01:40
      263500 -- [-1248.963] (-1248.937) (-1249.607) (-1251.745) * (-1245.550) [-1243.578] (-1255.354) (-1258.794) -- 0:01:40
      264000 -- (-1250.502) (-1246.925) [-1248.665] (-1243.340) * (-1249.425) [-1242.870] (-1248.864) (-1250.293) -- 0:01:40
      264500 -- (-1254.860) (-1252.036) (-1248.941) [-1244.321] * (-1251.713) (-1243.012) (-1243.655) [-1245.810] -- 0:01:40
      265000 -- [-1254.467] (-1253.232) (-1256.131) (-1250.867) * [-1247.606] (-1247.764) (-1247.254) (-1251.601) -- 0:01:39

      Average standard deviation of split frequencies: 0.000000

      265500 -- (-1249.514) (-1256.615) [-1247.928] (-1251.043) * (-1248.345) (-1247.145) [-1247.395] (-1247.899) -- 0:01:39
      266000 -- [-1253.168] (-1255.474) (-1247.984) (-1250.103) * [-1251.725] (-1244.338) (-1247.615) (-1244.314) -- 0:01:42
      266500 -- (-1249.428) (-1251.980) (-1248.227) [-1252.091] * [-1245.151] (-1242.424) (-1247.374) (-1246.008) -- 0:01:41
      267000 -- [-1252.303] (-1250.031) (-1253.381) (-1248.531) * (-1253.764) [-1241.996] (-1249.390) (-1244.671) -- 0:01:41
      267500 -- [-1246.969] (-1250.883) (-1246.033) (-1256.907) * [-1247.621] (-1245.895) (-1251.573) (-1248.596) -- 0:01:41
      268000 -- [-1249.790] (-1258.318) (-1248.682) (-1246.534) * [-1248.569] (-1248.151) (-1245.430) (-1251.277) -- 0:01:41
      268500 -- (-1250.932) (-1247.291) [-1249.132] (-1251.149) * (-1247.184) [-1249.400] (-1245.575) (-1253.333) -- 0:01:40
      269000 -- (-1252.453) (-1254.013) (-1252.413) [-1247.948] * (-1247.332) [-1246.066] (-1246.901) (-1258.042) -- 0:01:40
      269500 -- (-1249.225) [-1249.130] (-1257.581) (-1251.138) * [-1250.157] (-1242.825) (-1248.821) (-1255.384) -- 0:01:40
      270000 -- (-1248.567) (-1250.579) (-1250.188) [-1245.764] * (-1254.808) (-1247.190) (-1250.217) [-1249.472] -- 0:01:40

      Average standard deviation of split frequencies: 0.000871

      270500 -- (-1252.864) (-1246.026) [-1253.366] (-1246.641) * (-1247.088) [-1245.140] (-1248.235) (-1247.605) -- 0:01:39
      271000 -- (-1249.410) [-1249.051] (-1255.440) (-1248.106) * (-1250.004) (-1251.741) (-1255.522) [-1245.255] -- 0:01:39
      271500 -- (-1248.638) [-1246.479] (-1248.108) (-1252.270) * (-1250.655) (-1248.553) (-1254.266) [-1250.729] -- 0:01:41
      272000 -- (-1245.869) (-1248.940) (-1247.066) [-1250.305] * [-1242.893] (-1252.182) (-1246.751) (-1247.032) -- 0:01:41
      272500 -- (-1247.563) [-1250.347] (-1247.637) (-1253.919) * (-1244.942) (-1244.629) (-1247.180) [-1244.645] -- 0:01:41
      273000 -- [-1244.556] (-1248.065) (-1245.117) (-1244.373) * (-1255.129) [-1251.071] (-1251.916) (-1250.212) -- 0:01:41
      273500 -- (-1250.015) (-1248.576) (-1245.883) [-1245.883] * (-1249.813) [-1250.080] (-1255.477) (-1246.521) -- 0:01:40
      274000 -- (-1244.993) (-1252.331) [-1244.616] (-1245.425) * (-1254.876) (-1253.583) [-1249.742] (-1247.386) -- 0:01:40
      274500 -- (-1249.583) [-1244.486] (-1243.749) (-1246.699) * (-1246.630) [-1258.076] (-1244.964) (-1255.050) -- 0:01:40
      275000 -- (-1246.539) (-1244.503) [-1249.123] (-1247.364) * (-1251.675) (-1255.718) (-1247.156) [-1247.370] -- 0:01:40

      Average standard deviation of split frequencies: 0.000854

      275500 -- (-1252.317) (-1244.545) [-1245.413] (-1250.890) * [-1243.814] (-1251.925) (-1250.000) (-1249.623) -- 0:01:39
      276000 -- (-1244.947) [-1246.743] (-1248.090) (-1248.778) * (-1247.336) (-1251.494) [-1247.902] (-1250.262) -- 0:01:39
      276500 -- (-1249.351) (-1244.890) (-1253.583) [-1251.897] * [-1255.195] (-1252.934) (-1246.467) (-1252.295) -- 0:01:42
      277000 -- [-1241.687] (-1244.875) (-1248.313) (-1249.941) * [-1257.828] (-1244.495) (-1251.800) (-1254.233) -- 0:01:41
      277500 -- [-1246.941] (-1245.160) (-1244.736) (-1253.424) * (-1250.867) (-1245.609) (-1248.370) [-1247.466] -- 0:01:41
      278000 -- (-1247.628) (-1245.766) (-1248.193) [-1244.901] * (-1250.874) (-1245.013) (-1248.317) [-1244.341] -- 0:01:41
      278500 -- (-1252.498) (-1244.955) [-1246.422] (-1250.241) * [-1252.051] (-1246.904) (-1247.727) (-1246.926) -- 0:01:41
      279000 -- (-1246.506) (-1247.734) [-1243.021] (-1250.147) * [-1246.566] (-1248.617) (-1245.006) (-1251.390) -- 0:01:40
      279500 -- [-1245.288] (-1245.482) (-1246.695) (-1250.610) * (-1248.895) [-1245.529] (-1251.175) (-1251.269) -- 0:01:40
      280000 -- [-1246.812] (-1245.082) (-1251.260) (-1245.272) * (-1247.688) (-1248.916) [-1245.180] (-1251.645) -- 0:01:40

      Average standard deviation of split frequencies: 0.000840

      280500 -- (-1244.498) (-1248.236) [-1246.089] (-1244.080) * (-1248.242) [-1248.537] (-1248.330) (-1261.521) -- 0:01:40
      281000 -- (-1246.768) [-1252.177] (-1246.762) (-1249.991) * (-1250.927) [-1250.765] (-1245.320) (-1249.325) -- 0:01:39
      281500 -- (-1241.304) (-1254.618) [-1243.936] (-1257.452) * (-1247.171) (-1247.808) [-1242.652] (-1253.979) -- 0:01:39
      282000 -- (-1240.916) (-1250.628) (-1245.734) [-1247.741] * (-1249.555) (-1256.919) [-1251.148] (-1245.813) -- 0:01:39
      282500 -- (-1245.267) [-1243.200] (-1245.946) (-1245.808) * (-1249.378) (-1244.862) (-1244.587) [-1246.404] -- 0:01:41
      283000 -- (-1249.144) [-1250.036] (-1243.035) (-1255.782) * (-1243.959) (-1244.244) (-1248.544) [-1245.233] -- 0:01:41
      283500 -- (-1245.335) (-1251.819) (-1256.996) [-1248.118] * (-1247.208) (-1248.565) (-1251.225) [-1247.414] -- 0:01:41
      284000 -- (-1253.205) (-1249.864) (-1250.779) [-1248.671] * (-1250.324) (-1255.258) (-1246.399) [-1251.581] -- 0:01:40
      284500 -- (-1244.239) [-1244.422] (-1243.766) (-1251.834) * (-1246.170) (-1258.107) [-1242.992] (-1244.925) -- 0:01:40
      285000 -- (-1246.957) (-1245.972) [-1246.508] (-1249.039) * (-1243.219) (-1246.877) [-1250.297] (-1246.240) -- 0:01:40

      Average standard deviation of split frequencies: 0.000824

      285500 -- (-1247.927) [-1248.957] (-1252.535) (-1242.417) * (-1252.029) (-1248.848) [-1252.436] (-1243.997) -- 0:01:40
      286000 -- (-1247.534) [-1244.011] (-1250.665) (-1253.244) * (-1250.350) [-1243.548] (-1247.918) (-1246.722) -- 0:01:39
      286500 -- (-1245.916) [-1245.950] (-1250.159) (-1244.428) * (-1249.053) [-1248.784] (-1248.778) (-1246.086) -- 0:01:39
      287000 -- (-1245.731) (-1245.492) [-1245.727] (-1245.178) * (-1248.536) (-1245.704) (-1250.482) [-1245.477] -- 0:01:39
      287500 -- (-1244.427) (-1243.874) (-1245.695) [-1244.128] * (-1249.385) (-1252.036) (-1249.392) [-1243.112] -- 0:01:39
      288000 -- [-1244.084] (-1246.195) (-1249.808) (-1246.108) * (-1246.246) (-1256.068) (-1243.971) [-1246.094] -- 0:01:38
      288500 -- (-1241.888) (-1256.024) [-1243.714] (-1243.596) * [-1245.501] (-1258.555) (-1251.598) (-1248.481) -- 0:01:38
      289000 -- (-1248.638) (-1251.358) (-1251.556) [-1243.558] * [-1249.457] (-1253.566) (-1255.004) (-1242.352) -- 0:01:38
      289500 -- (-1253.716) (-1249.242) [-1249.072] (-1250.166) * (-1243.355) (-1247.854) (-1244.444) [-1249.767] -- 0:01:38
      290000 -- (-1246.721) [-1248.242] (-1249.654) (-1248.157) * [-1242.679] (-1247.048) (-1248.082) (-1254.775) -- 0:01:40

      Average standard deviation of split frequencies: 0.000811

      290500 -- (-1252.409) [-1244.406] (-1250.187) (-1247.726) * (-1242.818) (-1249.305) (-1245.780) [-1246.374] -- 0:01:40
      291000 -- (-1249.072) [-1243.996] (-1254.676) (-1248.339) * (-1245.207) (-1248.346) [-1246.908] (-1252.874) -- 0:01:39
      291500 -- (-1252.068) [-1244.947] (-1246.812) (-1246.657) * (-1256.444) (-1247.299) [-1245.202] (-1245.264) -- 0:01:39
      292000 -- (-1250.538) (-1244.217) (-1252.703) [-1248.355] * (-1249.315) (-1250.883) (-1247.927) [-1246.351] -- 0:01:39
      292500 -- (-1247.660) (-1247.503) (-1248.513) [-1245.036] * (-1243.588) (-1245.230) (-1245.585) [-1245.302] -- 0:01:39
      293000 -- (-1247.086) (-1248.361) (-1244.816) [-1242.564] * (-1250.539) [-1253.064] (-1245.301) (-1247.886) -- 0:01:38
      293500 -- (-1250.775) (-1252.282) (-1243.896) [-1245.468] * (-1247.168) (-1250.474) [-1254.823] (-1246.668) -- 0:01:38
      294000 -- (-1251.352) [-1247.878] (-1246.486) (-1246.267) * (-1243.518) (-1251.123) (-1259.794) [-1247.654] -- 0:01:38
      294500 -- (-1244.225) [-1243.005] (-1247.747) (-1250.729) * (-1245.126) (-1244.665) (-1248.572) [-1253.838] -- 0:01:38
      295000 -- [-1250.779] (-1250.671) (-1249.213) (-1249.757) * (-1243.819) [-1246.086] (-1246.546) (-1251.824) -- 0:01:37

      Average standard deviation of split frequencies: 0.000796

      295500 -- (-1249.217) (-1246.129) [-1250.024] (-1251.219) * [-1248.134] (-1247.163) (-1248.085) (-1249.044) -- 0:01:37
      296000 -- (-1250.717) [-1244.282] (-1252.867) (-1256.965) * (-1250.952) (-1240.996) (-1249.191) [-1247.784] -- 0:01:37
      296500 -- (-1244.931) [-1242.970] (-1248.192) (-1246.127) * (-1250.421) (-1244.378) [-1250.733] (-1247.904) -- 0:01:37
      297000 -- (-1254.905) (-1243.029) (-1252.783) [-1245.820] * (-1242.074) [-1253.116] (-1247.651) (-1243.376) -- 0:01:37
      297500 -- (-1248.542) (-1246.508) [-1253.388] (-1250.952) * [-1243.731] (-1252.806) (-1248.403) (-1246.700) -- 0:01:39
      298000 -- [-1246.810] (-1247.365) (-1243.265) (-1249.764) * (-1248.763) (-1256.174) (-1252.221) [-1252.193] -- 0:01:38
      298500 -- [-1248.790] (-1245.253) (-1249.253) (-1249.553) * (-1247.200) (-1257.170) [-1252.097] (-1248.156) -- 0:01:38
      299000 -- (-1247.238) [-1244.969] (-1247.068) (-1247.460) * (-1249.101) (-1247.306) (-1251.227) [-1246.914] -- 0:01:38
      299500 -- (-1249.144) (-1246.574) (-1247.046) [-1248.902] * (-1246.280) (-1248.097) (-1248.484) [-1252.147] -- 0:01:38
      300000 -- (-1246.834) (-1247.082) (-1244.073) [-1252.404] * (-1250.583) (-1250.174) (-1242.432) [-1246.102] -- 0:01:37

      Average standard deviation of split frequencies: 0.000784

      300500 -- (-1247.915) [-1246.921] (-1245.537) (-1247.360) * (-1250.692) [-1244.927] (-1245.792) (-1245.604) -- 0:01:37
      301000 -- (-1253.518) (-1248.264) [-1247.133] (-1246.003) * (-1253.685) [-1245.290] (-1248.956) (-1249.402) -- 0:01:37
      301500 -- (-1246.818) (-1248.293) (-1244.584) [-1246.785] * (-1249.946) [-1246.214] (-1245.637) (-1251.943) -- 0:01:37
      302000 -- [-1250.726] (-1255.671) (-1254.319) (-1248.238) * (-1251.422) (-1249.797) [-1246.317] (-1253.348) -- 0:01:37
      302500 -- [-1245.377] (-1253.852) (-1250.512) (-1256.783) * (-1250.146) (-1245.818) [-1249.734] (-1249.489) -- 0:01:36
      303000 -- (-1245.561) (-1255.147) (-1247.596) [-1251.968] * (-1253.469) [-1246.039] (-1248.457) (-1248.877) -- 0:01:36
      303500 -- (-1251.171) (-1248.303) [-1247.238] (-1248.187) * (-1249.923) (-1249.181) (-1245.348) [-1248.432] -- 0:01:36
      304000 -- (-1246.129) (-1250.666) [-1252.336] (-1247.627) * (-1251.900) (-1243.800) (-1246.660) [-1246.128] -- 0:01:36
      304500 -- (-1249.810) (-1247.091) (-1246.702) [-1247.425] * (-1243.760) (-1245.836) (-1247.396) [-1243.214] -- 0:01:35
      305000 -- (-1251.966) (-1248.321) [-1246.249] (-1254.863) * (-1250.575) [-1248.930] (-1251.770) (-1257.270) -- 0:01:37

      Average standard deviation of split frequencies: 0.000770

      305500 -- [-1242.927] (-1244.990) (-1250.959) (-1251.052) * (-1248.959) [-1245.246] (-1254.848) (-1253.143) -- 0:01:37
      306000 -- (-1247.538) (-1252.451) (-1264.017) [-1248.299] * (-1251.063) (-1246.720) (-1253.728) [-1247.734] -- 0:01:37
      306500 -- [-1245.948] (-1249.342) (-1249.098) (-1250.292) * (-1244.075) (-1248.154) (-1249.684) [-1241.338] -- 0:01:37
      307000 -- (-1251.816) (-1248.338) [-1245.014] (-1248.027) * (-1245.203) [-1244.192] (-1246.045) (-1250.029) -- 0:01:37
      307500 -- (-1249.212) (-1249.973) (-1254.468) [-1245.535] * (-1250.468) [-1249.486] (-1244.260) (-1248.010) -- 0:01:36
      308000 -- [-1245.800] (-1244.695) (-1249.796) (-1250.045) * (-1247.899) (-1247.531) (-1247.155) [-1251.001] -- 0:01:36
      308500 -- (-1249.311) (-1247.631) [-1251.445] (-1249.678) * (-1245.992) (-1245.045) [-1246.562] (-1249.482) -- 0:01:36
      309000 -- [-1247.081] (-1248.590) (-1249.194) (-1255.159) * (-1249.769) (-1246.675) [-1246.711] (-1252.082) -- 0:01:36
      309500 -- (-1246.673) (-1244.485) [-1259.311] (-1255.157) * (-1254.002) (-1250.886) [-1247.835] (-1246.869) -- 0:01:35
      310000 -- (-1248.671) (-1245.536) (-1250.804) [-1244.751] * (-1254.104) [-1253.267] (-1242.025) (-1247.679) -- 0:01:35

      Average standard deviation of split frequencies: 0.002276

      310500 -- (-1246.958) (-1245.788) (-1258.425) [-1244.265] * [-1249.520] (-1251.169) (-1248.525) (-1245.722) -- 0:01:35
      311000 -- (-1248.176) [-1246.743] (-1250.031) (-1249.699) * (-1252.862) [-1249.936] (-1246.274) (-1243.936) -- 0:01:35
      311500 -- (-1247.812) (-1250.198) [-1250.577] (-1253.206) * (-1257.085) (-1250.900) [-1243.659] (-1243.135) -- 0:01:35
      312000 -- (-1244.146) (-1248.956) [-1251.718] (-1244.788) * (-1251.429) [-1250.484] (-1244.567) (-1248.861) -- 0:01:37
      312500 -- [-1244.686] (-1250.424) (-1248.185) (-1242.290) * (-1256.017) (-1248.428) (-1243.672) [-1250.546] -- 0:01:36
      313000 -- (-1249.224) (-1248.779) [-1247.913] (-1250.131) * (-1246.008) (-1244.466) [-1248.478] (-1249.743) -- 0:01:36
      313500 -- [-1246.057] (-1246.589) (-1254.030) (-1245.046) * [-1246.153] (-1246.404) (-1245.857) (-1244.133) -- 0:01:36
      314000 -- (-1244.142) (-1248.873) [-1251.913] (-1255.150) * (-1244.603) [-1247.480] (-1243.992) (-1244.155) -- 0:01:36
      314500 -- (-1254.037) (-1245.342) (-1251.769) [-1253.923] * (-1248.986) (-1254.606) [-1245.901] (-1252.342) -- 0:01:35
      315000 -- (-1250.046) (-1246.413) (-1256.189) [-1244.815] * (-1252.137) (-1244.591) (-1248.162) [-1250.605] -- 0:01:35

      Average standard deviation of split frequencies: 0.002238

      315500 -- (-1250.381) (-1249.596) (-1249.620) [-1247.270] * (-1247.562) [-1244.846] (-1244.504) (-1254.703) -- 0:01:35
      316000 -- (-1245.737) (-1249.279) (-1247.058) [-1244.932] * [-1245.468] (-1246.668) (-1248.149) (-1257.361) -- 0:01:35
      316500 -- (-1244.783) (-1253.025) [-1248.954] (-1243.332) * [-1246.088] (-1253.167) (-1251.047) (-1247.405) -- 0:01:35
      317000 -- (-1248.662) [-1245.521] (-1245.802) (-1253.188) * (-1252.619) (-1249.576) [-1247.121] (-1250.952) -- 0:01:34
      317500 -- (-1252.878) [-1242.916] (-1248.508) (-1249.940) * (-1250.545) (-1247.590) (-1250.563) [-1247.537] -- 0:01:34
      318000 -- (-1247.676) (-1243.251) [-1247.667] (-1250.764) * (-1247.865) [-1249.596] (-1243.829) (-1249.071) -- 0:01:34
      318500 -- (-1248.941) [-1253.526] (-1243.137) (-1250.230) * (-1251.561) (-1248.358) (-1253.299) [-1246.075] -- 0:01:34
      319000 -- (-1246.526) (-1253.121) [-1246.729] (-1248.019) * (-1258.139) (-1246.643) [-1244.137] (-1249.533) -- 0:01:33
      319500 -- [-1244.776] (-1247.538) (-1250.735) (-1245.892) * (-1244.749) [-1246.633] (-1247.066) (-1239.886) -- 0:01:35
      320000 -- (-1244.950) [-1243.967] (-1244.183) (-1245.295) * (-1249.457) (-1258.228) (-1254.496) [-1248.827] -- 0:01:35

      Average standard deviation of split frequencies: 0.002205

      320500 -- (-1256.856) (-1248.046) [-1242.590] (-1252.469) * (-1250.805) [-1248.356] (-1247.222) (-1243.194) -- 0:01:35
      321000 -- (-1246.147) (-1249.651) [-1248.275] (-1248.016) * (-1263.034) [-1247.118] (-1249.250) (-1241.701) -- 0:01:35
      321500 -- (-1253.277) [-1246.917] (-1252.080) (-1246.816) * (-1246.099) (-1248.130) [-1253.403] (-1247.196) -- 0:01:34
      322000 -- (-1250.658) (-1246.066) [-1252.084] (-1246.567) * (-1249.150) [-1243.845] (-1247.578) (-1251.393) -- 0:01:34
      322500 -- [-1243.961] (-1242.728) (-1255.349) (-1244.880) * (-1245.024) [-1248.022] (-1248.061) (-1245.236) -- 0:01:34
      323000 -- (-1250.035) (-1251.693) [-1245.699] (-1250.079) * [-1245.248] (-1244.954) (-1244.552) (-1245.419) -- 0:01:34
      323500 -- (-1251.019) (-1242.116) [-1246.568] (-1243.018) * (-1245.974) (-1245.911) (-1250.781) [-1243.157] -- 0:01:34
      324000 -- (-1245.690) [-1255.066] (-1246.394) (-1247.591) * [-1244.693] (-1246.213) (-1255.737) (-1244.087) -- 0:01:33
      324500 -- (-1248.894) [-1249.024] (-1247.534) (-1247.385) * [-1247.730] (-1245.538) (-1250.116) (-1248.861) -- 0:01:33
      325000 -- (-1249.262) [-1245.600] (-1243.056) (-1252.305) * [-1247.734] (-1249.080) (-1252.690) (-1248.816) -- 0:01:33

      Average standard deviation of split frequencies: 0.002169

      325500 -- (-1251.820) [-1249.705] (-1252.642) (-1247.589) * (-1246.254) (-1249.509) [-1249.073] (-1248.335) -- 0:01:33
      326000 -- (-1249.110) [-1250.643] (-1245.394) (-1258.080) * (-1252.420) (-1250.563) (-1254.710) [-1246.711] -- 0:01:33
      326500 -- [-1249.516] (-1248.963) (-1250.742) (-1251.597) * (-1244.069) [-1248.317] (-1251.957) (-1246.638) -- 0:01:32
      327000 -- (-1249.367) (-1246.995) [-1251.730] (-1245.085) * (-1255.136) (-1247.993) [-1248.111] (-1246.871) -- 0:01:34
      327500 -- [-1247.443] (-1251.338) (-1256.419) (-1253.550) * [-1243.562] (-1251.279) (-1253.796) (-1249.700) -- 0:01:34
      328000 -- (-1247.297) [-1251.287] (-1247.657) (-1251.319) * (-1243.198) [-1246.053] (-1252.935) (-1254.917) -- 0:01:34
      328500 -- [-1252.926] (-1248.982) (-1243.204) (-1244.219) * [-1244.533] (-1246.085) (-1249.973) (-1250.845) -- 0:01:34
      329000 -- (-1254.116) (-1248.953) (-1246.266) [-1245.495] * (-1246.932) [-1249.029] (-1249.384) (-1250.707) -- 0:01:33
      329500 -- (-1251.852) [-1249.890] (-1249.689) (-1248.013) * (-1246.561) [-1248.873] (-1251.889) (-1249.566) -- 0:01:33
      330000 -- [-1245.860] (-1242.351) (-1255.075) (-1243.786) * [-1247.990] (-1252.981) (-1253.811) (-1249.512) -- 0:01:33

      Average standard deviation of split frequencies: 0.002138

      330500 -- (-1247.860) (-1242.187) (-1251.449) [-1247.215] * (-1248.297) [-1246.480] (-1250.834) (-1248.479) -- 0:01:33
      331000 -- (-1245.499) (-1243.325) (-1248.417) [-1242.728] * (-1247.413) [-1242.457] (-1249.854) (-1249.789) -- 0:01:32
      331500 -- (-1246.755) (-1247.182) (-1244.356) [-1244.090] * (-1247.068) [-1243.469] (-1244.439) (-1248.164) -- 0:01:32
      332000 -- (-1247.963) (-1248.881) (-1250.704) [-1247.704] * [-1251.619] (-1248.144) (-1250.704) (-1250.986) -- 0:01:32
      332500 -- (-1248.945) [-1244.985] (-1249.393) (-1245.354) * (-1251.121) (-1245.186) [-1252.572] (-1249.718) -- 0:01:32
      333000 -- (-1246.132) (-1255.335) [-1244.423] (-1248.739) * [-1247.472] (-1250.543) (-1246.052) (-1253.032) -- 0:01:32
      333500 -- (-1244.468) (-1259.582) [-1243.518] (-1246.531) * [-1248.239] (-1244.886) (-1250.045) (-1252.009) -- 0:01:31
      334000 -- (-1245.763) (-1251.779) [-1246.008] (-1245.723) * (-1245.484) [-1247.006] (-1246.578) (-1253.139) -- 0:01:31
      334500 -- (-1253.389) (-1258.817) (-1249.303) [-1249.200] * (-1245.993) (-1250.597) [-1245.096] (-1250.422) -- 0:01:33
      335000 -- (-1251.968) [-1251.805] (-1248.755) (-1254.141) * (-1246.007) [-1252.437] (-1251.650) (-1249.177) -- 0:01:33

      Average standard deviation of split frequencies: 0.002104

      335500 -- (-1250.004) (-1252.869) [-1249.931] (-1253.844) * (-1245.296) (-1254.856) [-1246.255] (-1246.004) -- 0:01:33
      336000 -- (-1248.936) (-1251.143) [-1254.906] (-1249.232) * (-1248.503) (-1254.059) (-1245.380) [-1245.784] -- 0:01:32
      336500 -- (-1253.208) [-1250.226] (-1245.040) (-1246.319) * (-1254.349) (-1245.056) [-1247.752] (-1244.546) -- 0:01:32
      337000 -- (-1251.611) (-1254.611) (-1243.625) [-1249.029] * (-1243.555) (-1251.900) [-1246.302] (-1250.233) -- 0:01:32
      337500 -- (-1245.969) (-1257.448) [-1244.433] (-1244.712) * (-1243.998) (-1251.308) (-1249.197) [-1245.241] -- 0:01:32
      338000 -- (-1246.551) (-1245.530) (-1252.248) [-1241.196] * [-1245.162] (-1250.237) (-1245.369) (-1245.983) -- 0:01:32
      338500 -- [-1246.881] (-1242.939) (-1244.402) (-1243.178) * (-1247.625) (-1251.028) (-1245.309) [-1246.605] -- 0:01:31
      339000 -- (-1247.833) (-1247.985) (-1245.781) [-1246.632] * (-1250.617) (-1247.657) [-1244.414] (-1253.904) -- 0:01:31
      339500 -- [-1247.678] (-1252.489) (-1247.107) (-1244.171) * (-1250.870) (-1244.594) [-1251.768] (-1257.404) -- 0:01:31
      340000 -- (-1249.939) [-1243.984] (-1253.837) (-1245.760) * [-1243.489] (-1250.353) (-1245.611) (-1253.615) -- 0:01:31

      Average standard deviation of split frequencies: 0.002076

      340500 -- (-1255.115) (-1251.302) (-1243.329) [-1242.930] * (-1254.197) (-1244.597) (-1256.587) [-1248.279] -- 0:01:31
      341000 -- (-1250.549) [-1248.383] (-1249.457) (-1245.556) * (-1245.361) (-1249.167) [-1247.432] (-1245.303) -- 0:01:30
      341500 -- (-1257.416) (-1250.083) (-1256.776) [-1246.317] * (-1245.928) [-1248.151] (-1247.918) (-1245.635) -- 0:01:30
      342000 -- (-1252.785) (-1251.185) (-1251.569) [-1252.406] * [-1254.903] (-1247.293) (-1248.559) (-1249.916) -- 0:01:32
      342500 -- (-1251.483) (-1248.986) (-1248.195) [-1247.225] * (-1247.270) [-1245.118] (-1244.308) (-1248.562) -- 0:01:32
      343000 -- (-1245.311) (-1253.302) (-1255.953) [-1241.146] * (-1255.596) (-1245.490) [-1243.114] (-1244.031) -- 0:01:31
      343500 -- (-1250.179) (-1248.985) (-1255.873) [-1243.766] * (-1242.550) [-1251.797] (-1241.928) (-1244.691) -- 0:01:31
      344000 -- [-1250.121] (-1247.567) (-1254.149) (-1248.114) * (-1246.184) (-1247.850) (-1250.627) [-1250.881] -- 0:01:31
      344500 -- (-1251.158) (-1247.161) (-1252.937) [-1245.535] * (-1250.684) [-1250.402] (-1257.909) (-1245.637) -- 0:01:31
      345000 -- (-1249.588) [-1247.566] (-1255.376) (-1248.843) * (-1246.411) (-1257.401) (-1249.958) [-1247.658] -- 0:01:31

      Average standard deviation of split frequencies: 0.002725

      345500 -- (-1243.883) (-1253.880) [-1251.005] (-1246.036) * (-1248.411) (-1255.371) [-1245.452] (-1246.258) -- 0:01:30
      346000 -- (-1241.643) [-1248.584] (-1258.360) (-1242.700) * (-1244.740) (-1245.620) (-1252.065) [-1247.770] -- 0:01:30
      346500 -- [-1244.142] (-1249.666) (-1248.373) (-1248.720) * (-1249.978) [-1249.532] (-1250.833) (-1241.600) -- 0:01:30
      347000 -- (-1246.499) [-1248.670] (-1250.726) (-1252.988) * [-1247.482] (-1251.710) (-1247.806) (-1242.597) -- 0:01:30
      347500 -- (-1253.602) (-1247.833) (-1248.118) [-1248.368] * [-1249.422] (-1248.940) (-1248.622) (-1246.665) -- 0:01:30
      348000 -- (-1258.388) (-1255.922) (-1248.453) [-1245.337] * (-1247.405) [-1247.784] (-1248.412) (-1247.489) -- 0:01:29
      348500 -- (-1254.444) (-1254.022) [-1244.889] (-1248.821) * (-1258.478) (-1248.725) (-1241.680) [-1241.512] -- 0:01:29
      349000 -- (-1251.499) (-1246.116) (-1242.613) [-1247.203] * (-1253.154) (-1247.843) [-1249.604] (-1247.296) -- 0:01:29
      349500 -- (-1252.563) (-1247.235) [-1245.200] (-1242.722) * (-1244.638) (-1248.796) (-1255.064) [-1242.322] -- 0:01:31
      350000 -- (-1249.067) (-1242.148) (-1254.479) [-1244.281] * [-1248.362] (-1245.603) (-1251.039) (-1242.670) -- 0:01:30

      Average standard deviation of split frequencies: 0.002689

      350500 -- (-1253.763) [-1244.963] (-1245.279) (-1245.532) * (-1251.354) (-1248.884) [-1245.445] (-1248.536) -- 0:01:30
      351000 -- (-1246.415) [-1244.923] (-1248.282) (-1246.792) * (-1253.658) [-1254.410] (-1245.470) (-1244.800) -- 0:01:30
      351500 -- (-1250.812) (-1248.124) (-1252.495) [-1246.806] * (-1250.912) (-1243.678) [-1245.647] (-1247.405) -- 0:01:30
      352000 -- (-1248.818) (-1252.795) [-1249.846] (-1247.439) * (-1249.034) (-1247.998) [-1240.456] (-1246.464) -- 0:01:30
      352500 -- (-1243.905) (-1251.637) [-1253.583] (-1244.305) * (-1246.122) [-1244.019] (-1243.619) (-1247.599) -- 0:01:30
      353000 -- [-1241.152] (-1248.519) (-1245.872) (-1257.259) * (-1251.313) [-1247.772] (-1249.510) (-1250.077) -- 0:01:29
      353500 -- (-1244.501) (-1254.920) [-1249.069] (-1249.637) * [-1249.993] (-1250.666) (-1246.027) (-1251.160) -- 0:01:29
      354000 -- (-1246.052) [-1248.933] (-1247.819) (-1244.828) * (-1245.222) [-1251.740] (-1244.040) (-1252.564) -- 0:01:29
      354500 -- (-1254.242) (-1253.818) (-1247.596) [-1249.330] * [-1246.666] (-1246.877) (-1243.808) (-1257.973) -- 0:01:29
      355000 -- (-1245.029) (-1253.507) [-1245.541] (-1247.059) * (-1253.347) [-1245.199] (-1249.730) (-1252.611) -- 0:01:29

      Average standard deviation of split frequencies: 0.003310

      355500 -- (-1244.587) [-1255.565] (-1250.433) (-1246.093) * [-1243.495] (-1250.122) (-1254.192) (-1247.132) -- 0:01:28
      356000 -- [-1242.980] (-1247.506) (-1242.807) (-1245.152) * (-1246.042) (-1248.447) [-1249.967] (-1252.323) -- 0:01:28
      356500 -- [-1248.289] (-1244.086) (-1247.784) (-1251.033) * (-1244.662) (-1248.084) (-1249.068) [-1249.690] -- 0:01:28
      357000 -- (-1247.625) [-1251.692] (-1249.670) (-1245.088) * (-1251.036) (-1247.629) [-1247.195] (-1245.712) -- 0:01:30
      357500 -- (-1250.454) (-1244.044) [-1245.046] (-1249.764) * (-1251.551) (-1247.772) [-1244.200] (-1254.125) -- 0:01:29
      358000 -- (-1244.144) [-1245.607] (-1248.046) (-1252.751) * (-1246.744) (-1247.068) [-1244.042] (-1243.690) -- 0:01:29
      358500 -- [-1245.187] (-1248.315) (-1254.390) (-1250.610) * (-1253.463) [-1245.905] (-1247.124) (-1243.531) -- 0:01:29
      359000 -- (-1249.547) (-1242.839) [-1245.302] (-1253.010) * (-1251.196) (-1253.626) [-1249.608] (-1245.103) -- 0:01:29
      359500 -- (-1251.068) (-1250.994) (-1248.912) [-1246.224] * (-1251.881) (-1244.632) [-1244.666] (-1249.873) -- 0:01:29
      360000 -- (-1247.693) (-1251.364) [-1247.007] (-1249.072) * (-1250.570) (-1248.703) (-1247.304) [-1248.935] -- 0:01:28

      Average standard deviation of split frequencies: 0.003268

      360500 -- [-1252.518] (-1246.222) (-1241.875) (-1244.535) * (-1245.113) [-1251.888] (-1247.829) (-1247.115) -- 0:01:28
      361000 -- [-1252.758] (-1245.186) (-1251.829) (-1240.691) * (-1252.656) (-1240.478) [-1248.838] (-1248.588) -- 0:01:28
      361500 -- (-1256.774) (-1242.514) (-1248.076) [-1247.700] * (-1246.340) [-1241.592] (-1255.356) (-1247.863) -- 0:01:28
      362000 -- (-1249.001) (-1252.107) (-1247.849) [-1245.043] * (-1248.928) [-1248.759] (-1246.876) (-1250.955) -- 0:01:28
      362500 -- (-1249.632) [-1247.913] (-1256.400) (-1249.751) * [-1245.727] (-1248.248) (-1245.527) (-1255.744) -- 0:01:27
      363000 -- (-1257.470) [-1248.620] (-1248.805) (-1243.581) * (-1250.870) (-1245.195) (-1250.526) [-1250.948] -- 0:01:27
      363500 -- (-1246.005) [-1249.571] (-1250.303) (-1253.616) * (-1250.274) (-1255.637) [-1240.304] (-1252.394) -- 0:01:27
      364000 -- (-1249.339) (-1247.295) (-1249.064) [-1248.887] * (-1255.870) (-1249.067) (-1247.596) [-1247.118] -- 0:01:29
      364500 -- (-1246.717) (-1245.069) (-1251.949) [-1244.612] * (-1246.617) (-1249.810) (-1242.400) [-1241.741] -- 0:01:28
      365000 -- [-1244.825] (-1252.048) (-1243.661) (-1246.040) * (-1247.245) (-1243.989) (-1249.241) [-1244.866] -- 0:01:28

      Average standard deviation of split frequencies: 0.002576

      365500 -- (-1248.662) (-1242.747) (-1241.372) [-1253.203] * (-1249.923) (-1245.335) (-1246.652) [-1246.410] -- 0:01:28
      366000 -- (-1249.676) (-1242.101) (-1256.186) [-1245.195] * [-1244.535] (-1247.511) (-1254.569) (-1256.800) -- 0:01:28
      366500 -- (-1247.426) (-1244.202) (-1245.562) [-1244.630] * (-1251.606) (-1245.355) [-1245.418] (-1251.562) -- 0:01:28
      367000 -- (-1251.784) (-1244.143) [-1250.744] (-1247.630) * [-1246.091] (-1251.850) (-1244.299) (-1249.558) -- 0:01:27
      367500 -- [-1247.002] (-1244.479) (-1246.781) (-1249.407) * (-1252.234) [-1246.001] (-1247.651) (-1246.726) -- 0:01:27
      368000 -- (-1242.713) (-1245.048) [-1247.805] (-1245.253) * (-1253.395) (-1248.915) [-1249.910] (-1252.727) -- 0:01:27
      368500 -- (-1246.282) (-1258.514) [-1249.845] (-1249.297) * (-1249.712) [-1246.740] (-1247.111) (-1250.015) -- 0:01:27
      369000 -- (-1256.908) [-1244.706] (-1254.276) (-1250.703) * [-1249.386] (-1249.054) (-1250.912) (-1249.366) -- 0:01:27
      369500 -- [-1248.408] (-1251.562) (-1253.051) (-1253.700) * (-1251.933) (-1249.419) [-1244.025] (-1252.456) -- 0:01:27
      370000 -- [-1244.380] (-1254.399) (-1245.552) (-1250.967) * (-1247.623) (-1246.458) [-1247.532] (-1253.598) -- 0:01:26

      Average standard deviation of split frequencies: 0.002544

      370500 -- (-1245.540) (-1257.397) [-1248.649] (-1245.048) * (-1243.359) [-1248.750] (-1251.275) (-1251.067) -- 0:01:26
      371000 -- (-1247.392) [-1249.668] (-1247.997) (-1245.353) * (-1253.139) (-1253.349) [-1245.443] (-1253.373) -- 0:01:26
      371500 -- [-1250.141] (-1247.184) (-1244.782) (-1251.113) * (-1252.771) (-1251.067) (-1246.359) [-1252.071] -- 0:01:27
      372000 -- (-1250.654) [-1249.583] (-1247.004) (-1247.161) * (-1255.338) (-1252.551) (-1240.849) [-1244.137] -- 0:01:27
      372500 -- (-1251.779) (-1249.655) [-1245.880] (-1247.255) * (-1243.860) (-1252.978) (-1245.428) [-1241.032] -- 0:01:27
      373000 -- (-1252.217) (-1246.400) [-1254.067] (-1248.273) * (-1246.061) (-1252.178) (-1254.755) [-1247.759] -- 0:01:27
      373500 -- (-1253.838) (-1256.157) [-1257.427] (-1253.808) * (-1247.303) (-1249.025) (-1244.139) [-1243.821] -- 0:01:27
      374000 -- (-1254.332) (-1244.104) [-1246.638] (-1249.878) * (-1246.572) (-1249.455) (-1246.993) [-1247.283] -- 0:01:27
      374500 -- (-1251.581) (-1254.542) [-1251.912] (-1252.809) * (-1245.512) (-1250.699) [-1249.038] (-1244.967) -- 0:01:26
      375000 -- (-1259.531) (-1242.113) (-1247.581) [-1251.303] * (-1250.043) (-1246.429) (-1255.378) [-1241.898] -- 0:01:26

      Average standard deviation of split frequencies: 0.002507

      375500 -- (-1255.449) [-1246.981] (-1247.966) (-1248.094) * (-1245.615) (-1247.934) (-1255.455) [-1249.318] -- 0:01:26
      376000 -- (-1255.817) (-1244.914) (-1251.301) [-1246.776] * [-1247.367] (-1247.155) (-1257.761) (-1249.614) -- 0:01:26
      376500 -- (-1243.124) [-1245.939] (-1247.466) (-1249.339) * (-1250.151) [-1241.415] (-1251.520) (-1250.862) -- 0:01:26
      377000 -- (-1246.901) (-1247.699) (-1247.654) [-1249.465] * [-1249.119] (-1249.241) (-1250.443) (-1246.935) -- 0:01:25
      377500 -- (-1247.258) (-1245.398) [-1249.505] (-1251.331) * (-1254.943) [-1246.737] (-1255.591) (-1246.490) -- 0:01:25
      378000 -- (-1251.910) (-1246.299) [-1247.302] (-1248.146) * [-1245.676] (-1249.970) (-1255.042) (-1250.192) -- 0:01:25
      378500 -- (-1252.770) (-1253.545) (-1247.040) [-1247.394] * (-1244.110) (-1260.351) (-1250.246) [-1246.071] -- 0:01:25
      379000 -- (-1249.213) (-1253.348) (-1243.645) [-1244.693] * (-1243.917) (-1250.315) [-1247.459] (-1250.177) -- 0:01:26
      379500 -- [-1251.611] (-1250.719) (-1248.411) (-1247.227) * (-1250.171) (-1245.223) [-1250.478] (-1246.128) -- 0:01:26
      380000 -- (-1246.729) (-1253.664) [-1247.715] (-1247.734) * [-1250.551] (-1245.489) (-1254.220) (-1242.773) -- 0:01:26

      Average standard deviation of split frequencies: 0.002477

      380500 -- [-1253.010] (-1256.843) (-1251.044) (-1252.600) * (-1246.206) (-1247.864) [-1246.681] (-1245.030) -- 0:01:26
      381000 -- (-1253.922) (-1247.236) (-1252.845) [-1244.281] * (-1251.694) [-1243.107] (-1252.331) (-1247.034) -- 0:01:26
      381500 -- (-1252.735) (-1253.606) (-1249.557) [-1246.544] * (-1244.981) [-1249.775] (-1247.646) (-1243.079) -- 0:01:25
      382000 -- (-1253.902) (-1250.909) (-1249.097) [-1246.652] * (-1246.833) (-1244.577) [-1246.761] (-1244.566) -- 0:01:25
      382500 -- (-1250.870) (-1247.434) [-1245.765] (-1252.677) * (-1248.595) (-1246.221) [-1244.425] (-1247.289) -- 0:01:25
      383000 -- [-1250.254] (-1245.007) (-1249.100) (-1248.103) * (-1242.662) [-1244.374] (-1249.683) (-1249.445) -- 0:01:25
      383500 -- (-1248.318) (-1246.550) [-1246.403] (-1245.524) * [-1249.595] (-1246.060) (-1244.308) (-1246.389) -- 0:01:25
      384000 -- (-1252.457) [-1244.137] (-1246.344) (-1245.707) * [-1242.155] (-1247.164) (-1246.612) (-1251.319) -- 0:01:25
      384500 -- (-1252.934) [-1247.252] (-1244.497) (-1249.326) * (-1262.283) [-1243.790] (-1249.121) (-1243.245) -- 0:01:24
      385000 -- (-1256.373) [-1243.886] (-1246.756) (-1246.181) * (-1253.806) (-1245.931) [-1247.488] (-1246.846) -- 0:01:24

      Average standard deviation of split frequencies: 0.002443

      385500 -- (-1254.086) [-1246.735] (-1242.007) (-1248.650) * (-1249.076) (-1242.262) (-1247.819) [-1249.219] -- 0:01:24
      386000 -- (-1253.432) (-1246.855) (-1249.222) [-1248.522] * (-1248.201) [-1240.286] (-1245.026) (-1247.139) -- 0:01:24
      386500 -- (-1251.266) (-1246.598) (-1246.344) [-1248.895] * (-1249.993) [-1245.810] (-1245.658) (-1246.131) -- 0:01:25
      387000 -- [-1249.455] (-1252.468) (-1250.327) (-1250.227) * (-1250.769) (-1242.036) [-1243.297] (-1247.001) -- 0:01:25
      387500 -- (-1253.729) (-1246.160) [-1250.662] (-1247.577) * (-1256.238) (-1252.235) (-1246.955) [-1244.955] -- 0:01:25
      388000 -- [-1252.874] (-1246.085) (-1250.558) (-1246.694) * (-1252.505) (-1249.843) [-1247.291] (-1245.228) -- 0:01:25
      388500 -- (-1247.213) [-1247.697] (-1247.879) (-1250.730) * (-1251.265) (-1254.896) (-1244.349) [-1246.978] -- 0:01:24
      389000 -- (-1251.329) (-1252.607) [-1246.072] (-1246.143) * [-1251.517] (-1253.299) (-1245.124) (-1247.979) -- 0:01:24
      389500 -- (-1247.426) (-1243.199) [-1245.505] (-1253.523) * (-1254.406) (-1255.084) (-1244.351) [-1249.611] -- 0:01:24
      390000 -- (-1247.147) (-1249.328) (-1249.972) [-1249.282] * (-1247.131) (-1253.333) (-1252.065) [-1245.516] -- 0:01:24

      Average standard deviation of split frequencies: 0.001810

      390500 -- (-1249.066) (-1245.888) [-1247.416] (-1248.035) * (-1252.554) (-1252.536) [-1249.782] (-1251.919) -- 0:01:24
      391000 -- [-1242.147] (-1249.051) (-1248.928) (-1250.469) * (-1252.344) [-1251.372] (-1245.646) (-1251.287) -- 0:01:24
      391500 -- (-1243.470) [-1247.930] (-1248.682) (-1248.385) * (-1252.077) [-1247.371] (-1247.025) (-1245.437) -- 0:01:23
      392000 -- [-1247.271] (-1245.936) (-1251.576) (-1249.079) * [-1242.930] (-1246.456) (-1246.661) (-1254.663) -- 0:01:23
      392500 -- (-1249.304) [-1245.656] (-1249.734) (-1246.244) * [-1244.222] (-1244.462) (-1247.395) (-1245.732) -- 0:01:23
      393000 -- (-1247.809) [-1245.846] (-1248.747) (-1253.669) * [-1246.441] (-1245.661) (-1244.075) (-1247.497) -- 0:01:23
      393500 -- [-1244.445] (-1247.466) (-1249.984) (-1243.969) * [-1249.671] (-1248.253) (-1242.674) (-1247.321) -- 0:01:23
      394000 -- (-1246.339) (-1252.900) [-1247.527] (-1250.364) * (-1248.341) [-1246.535] (-1246.792) (-1246.154) -- 0:01:24
      394500 -- (-1253.980) [-1243.800] (-1245.735) (-1249.103) * [-1243.900] (-1248.169) (-1250.779) (-1246.850) -- 0:01:24
      395000 -- (-1249.565) [-1245.249] (-1248.472) (-1245.774) * (-1246.638) [-1252.520] (-1249.625) (-1249.437) -- 0:01:24

      Average standard deviation of split frequencies: 0.001786

      395500 -- (-1250.309) (-1247.988) [-1246.237] (-1246.511) * (-1241.433) [-1246.648] (-1245.976) (-1247.016) -- 0:01:24
      396000 -- (-1253.174) (-1244.149) (-1248.836) [-1244.861] * [-1251.191] (-1253.189) (-1247.577) (-1243.608) -- 0:01:23
      396500 -- [-1251.799] (-1244.267) (-1246.745) (-1248.015) * [-1243.871] (-1250.679) (-1246.462) (-1244.878) -- 0:01:23
      397000 -- [-1246.925] (-1242.304) (-1253.432) (-1248.012) * (-1245.721) (-1242.665) (-1245.703) [-1243.548] -- 0:01:23
      397500 -- (-1255.912) (-1245.637) [-1248.039] (-1248.832) * [-1244.778] (-1242.639) (-1252.917) (-1252.553) -- 0:01:23
      398000 -- (-1248.891) [-1244.454] (-1250.763) (-1249.671) * (-1244.000) [-1245.070] (-1257.854) (-1251.072) -- 0:01:23
      398500 -- (-1247.117) [-1248.719] (-1251.684) (-1248.974) * (-1245.775) [-1246.218] (-1245.083) (-1248.403) -- 0:01:23
      399000 -- (-1249.579) (-1246.873) (-1256.433) [-1247.654] * (-1253.033) (-1247.467) (-1248.437) [-1247.198] -- 0:01:22
      399500 -- (-1251.918) (-1252.402) (-1249.223) [-1247.296] * (-1255.059) [-1247.183] (-1249.090) (-1248.083) -- 0:01:22
      400000 -- (-1244.874) (-1247.572) [-1251.251] (-1245.117) * (-1248.540) (-1251.270) (-1250.108) [-1249.921] -- 0:01:22

      Average standard deviation of split frequencies: 0.001765

      400500 -- (-1251.470) [-1242.408] (-1246.365) (-1247.269) * (-1249.290) (-1242.558) [-1247.251] (-1244.608) -- 0:01:22
      401000 -- (-1249.246) (-1245.900) [-1246.914] (-1249.323) * (-1246.219) [-1247.148] (-1247.666) (-1244.675) -- 0:01:22
      401500 -- (-1251.897) (-1250.387) [-1245.916] (-1247.168) * (-1249.291) (-1249.401) (-1253.713) [-1243.543] -- 0:01:23
      402000 -- (-1251.058) (-1253.067) (-1244.236) [-1245.453] * (-1250.062) (-1246.839) [-1247.919] (-1256.017) -- 0:01:23
      402500 -- (-1254.627) (-1247.183) [-1249.609] (-1247.379) * (-1257.491) (-1252.082) (-1247.550) [-1245.788] -- 0:01:23
      403000 -- [-1258.690] (-1246.788) (-1256.197) (-1251.787) * (-1250.087) (-1255.322) (-1247.562) [-1242.432] -- 0:01:22
      403500 -- (-1247.336) (-1247.773) [-1247.303] (-1241.446) * (-1246.180) [-1247.255] (-1245.325) (-1250.784) -- 0:01:22
      404000 -- (-1252.954) (-1242.664) [-1254.829] (-1245.224) * [-1247.167] (-1248.589) (-1246.171) (-1245.440) -- 0:01:22
      404500 -- [-1248.425] (-1242.068) (-1250.690) (-1245.833) * (-1242.873) (-1252.863) [-1241.689] (-1249.809) -- 0:01:22
      405000 -- [-1248.195] (-1248.707) (-1246.615) (-1250.748) * (-1254.922) (-1252.380) (-1246.986) [-1250.311] -- 0:01:22

      Average standard deviation of split frequencies: 0.001161

      405500 -- (-1250.918) [-1241.593] (-1245.503) (-1244.313) * (-1252.679) [-1250.595] (-1256.766) (-1252.737) -- 0:01:22
      406000 -- [-1252.485] (-1248.214) (-1248.841) (-1250.355) * (-1249.984) [-1249.748] (-1249.072) (-1251.899) -- 0:01:21
      406500 -- (-1249.567) [-1250.011] (-1250.024) (-1251.417) * (-1250.487) (-1245.275) [-1247.273] (-1250.335) -- 0:01:21
      407000 -- (-1252.403) [-1243.432] (-1250.355) (-1251.279) * [-1253.468] (-1250.452) (-1247.332) (-1247.855) -- 0:01:21
      407500 -- (-1250.718) [-1244.135] (-1246.855) (-1247.674) * [-1252.060] (-1252.019) (-1248.151) (-1246.077) -- 0:01:21
      408000 -- (-1250.597) (-1245.446) (-1252.967) [-1242.101] * [-1251.333] (-1252.328) (-1246.711) (-1252.838) -- 0:01:21
      408500 -- [-1251.892] (-1247.638) (-1253.664) (-1243.149) * [-1245.866] (-1257.109) (-1250.556) (-1250.045) -- 0:01:22
      409000 -- (-1250.601) (-1244.973) (-1249.880) [-1245.763] * (-1247.361) (-1254.420) (-1248.966) [-1249.117] -- 0:01:22
      409500 -- (-1258.578) (-1244.941) (-1247.678) [-1249.494] * [-1248.598] (-1255.029) (-1247.586) (-1247.664) -- 0:01:22
      410000 -- (-1249.165) (-1245.046) (-1248.949) [-1249.601] * (-1248.813) (-1255.307) [-1246.869] (-1250.398) -- 0:01:22

      Average standard deviation of split frequencies: 0.001148

      410500 -- [-1249.413] (-1247.102) (-1248.672) (-1248.129) * (-1249.795) (-1253.834) (-1242.583) [-1254.467] -- 0:01:21
      411000 -- [-1247.005] (-1256.607) (-1248.258) (-1252.256) * [-1242.436] (-1259.473) (-1254.671) (-1248.984) -- 0:01:21
      411500 -- (-1251.031) (-1248.582) [-1258.242] (-1246.225) * (-1245.511) (-1251.079) [-1243.482] (-1247.655) -- 0:01:21
      412000 -- [-1244.055] (-1253.198) (-1250.148) (-1249.763) * (-1253.114) (-1243.944) [-1243.232] (-1245.502) -- 0:01:21
      412500 -- (-1249.413) (-1250.553) [-1247.953] (-1251.633) * (-1253.534) (-1248.075) [-1245.691] (-1251.775) -- 0:01:21
      413000 -- [-1244.279] (-1246.157) (-1244.996) (-1250.078) * (-1244.103) (-1253.086) (-1246.036) [-1248.641] -- 0:01:21
      413500 -- (-1245.492) [-1245.977] (-1250.520) (-1249.718) * (-1242.839) (-1252.106) (-1243.560) [-1245.740] -- 0:01:20
      414000 -- (-1245.063) (-1247.700) (-1251.942) [-1247.904] * (-1251.138) (-1247.194) (-1255.731) [-1245.094] -- 0:01:20
      414500 -- [-1248.774] (-1247.730) (-1245.288) (-1249.026) * (-1250.117) (-1249.078) [-1245.607] (-1252.259) -- 0:01:20
      415000 -- (-1243.317) (-1250.929) [-1243.612] (-1251.351) * [-1251.312] (-1247.876) (-1246.000) (-1246.646) -- 0:01:20

      Average standard deviation of split frequencies: 0.001133

      415500 -- (-1250.969) (-1247.416) [-1242.753] (-1248.554) * [-1244.639] (-1246.564) (-1248.077) (-1248.985) -- 0:01:20
      416000 -- [-1248.618] (-1252.494) (-1245.313) (-1246.023) * [-1244.184] (-1247.902) (-1250.600) (-1244.604) -- 0:01:21
      416500 -- [-1243.085] (-1249.498) (-1248.540) (-1255.412) * (-1243.155) [-1251.159] (-1248.030) (-1251.368) -- 0:01:21
      417000 -- (-1253.601) [-1243.180] (-1241.927) (-1249.309) * [-1243.288] (-1248.734) (-1253.284) (-1244.661) -- 0:01:21
      417500 -- (-1249.894) (-1245.838) [-1247.253] (-1252.753) * (-1245.599) (-1252.982) [-1244.465] (-1244.249) -- 0:01:20
      418000 -- (-1246.099) [-1244.181] (-1250.605) (-1251.947) * (-1251.012) (-1248.534) (-1247.973) [-1246.917] -- 0:01:20
      418500 -- (-1244.495) [-1243.117] (-1255.629) (-1250.986) * (-1252.864) (-1248.932) [-1249.837] (-1244.799) -- 0:01:20
      419000 -- (-1249.682) (-1246.117) [-1244.717] (-1248.855) * (-1246.807) (-1251.093) [-1242.540] (-1246.958) -- 0:01:20
      419500 -- [-1245.902] (-1242.351) (-1250.478) (-1254.870) * (-1250.941) (-1249.786) (-1245.507) [-1243.389] -- 0:01:20
      420000 -- [-1248.334] (-1248.217) (-1252.844) (-1265.471) * [-1245.590] (-1248.093) (-1242.117) (-1247.447) -- 0:01:20

      Average standard deviation of split frequencies: 0.001121

      420500 -- [-1250.087] (-1248.272) (-1251.705) (-1250.734) * [-1247.617] (-1252.759) (-1242.950) (-1249.695) -- 0:01:19
      421000 -- (-1249.329) [-1252.474] (-1247.198) (-1247.458) * (-1244.171) (-1247.920) (-1245.680) [-1248.681] -- 0:01:19
      421500 -- (-1254.221) [-1247.833] (-1251.711) (-1246.690) * [-1245.909] (-1244.070) (-1246.528) (-1244.456) -- 0:01:19
      422000 -- (-1246.485) (-1254.649) [-1244.054] (-1247.236) * (-1245.729) [-1247.989] (-1249.732) (-1247.273) -- 0:01:19
      422500 -- [-1245.790] (-1246.099) (-1248.840) (-1250.269) * (-1244.912) [-1242.458] (-1246.734) (-1246.465) -- 0:01:19
      423000 -- (-1243.218) (-1251.506) [-1245.448] (-1249.129) * (-1247.420) [-1241.186] (-1249.563) (-1243.278) -- 0:01:19
      423500 -- (-1252.621) [-1246.769] (-1244.166) (-1246.281) * (-1247.143) [-1246.406] (-1253.781) (-1253.620) -- 0:01:18
      424000 -- (-1243.514) (-1246.644) (-1252.292) [-1249.909] * (-1251.773) (-1249.886) (-1246.057) [-1248.563] -- 0:01:20
      424500 -- (-1248.496) [-1244.026] (-1252.669) (-1244.690) * (-1249.455) (-1245.051) (-1248.024) [-1243.530] -- 0:01:19
      425000 -- (-1245.350) (-1247.475) (-1248.574) [-1247.269] * (-1248.184) (-1244.947) [-1243.756] (-1250.254) -- 0:01:19

      Average standard deviation of split frequencies: 0.000553

      425500 -- (-1245.910) (-1243.031) (-1255.112) [-1242.814] * (-1249.904) (-1245.547) [-1243.970] (-1246.330) -- 0:01:19
      426000 -- (-1250.809) [-1248.042] (-1248.261) (-1248.033) * (-1248.958) [-1249.068] (-1246.671) (-1249.112) -- 0:01:19
      426500 -- (-1248.230) (-1245.978) [-1251.697] (-1244.813) * (-1243.234) (-1250.679) (-1242.836) [-1247.838] -- 0:01:19
      427000 -- (-1245.897) (-1248.325) (-1254.231) [-1248.266] * [-1246.931] (-1241.731) (-1245.411) (-1245.312) -- 0:01:19
      427500 -- (-1241.136) [-1244.447] (-1249.180) (-1250.304) * [-1248.997] (-1246.366) (-1248.300) (-1248.591) -- 0:01:19
      428000 -- (-1241.669) (-1248.023) (-1252.104) [-1251.396] * (-1246.893) [-1247.507] (-1254.478) (-1247.286) -- 0:01:18
      428500 -- (-1243.747) (-1245.467) [-1241.806] (-1247.141) * [-1246.808] (-1256.529) (-1253.958) (-1248.890) -- 0:01:18
      429000 -- [-1248.693] (-1243.411) (-1245.837) (-1246.564) * (-1252.970) (-1245.303) (-1253.592) [-1252.166] -- 0:01:18
      429500 -- (-1245.629) (-1245.863) [-1250.341] (-1254.803) * [-1243.984] (-1245.765) (-1251.701) (-1256.307) -- 0:01:18
      430000 -- (-1244.468) (-1242.103) [-1250.425] (-1251.582) * (-1246.890) (-1249.720) [-1250.202] (-1253.688) -- 0:01:18

      Average standard deviation of split frequencies: 0.000547

      430500 -- (-1245.220) (-1247.355) [-1244.648] (-1248.710) * (-1244.593) [-1250.052] (-1247.671) (-1244.035) -- 0:01:18
      431000 -- [-1247.628] (-1254.342) (-1251.303) (-1248.787) * (-1249.636) (-1249.823) (-1244.790) [-1248.324] -- 0:01:17
      431500 -- [-1246.660] (-1257.731) (-1243.003) (-1250.160) * (-1244.129) (-1245.660) [-1245.653] (-1255.367) -- 0:01:19
      432000 -- [-1248.072] (-1248.402) (-1246.506) (-1248.768) * (-1248.232) (-1241.356) (-1243.916) [-1249.150] -- 0:01:18
      432500 -- (-1250.476) (-1247.422) (-1247.463) [-1243.421] * (-1252.071) (-1248.194) (-1243.460) [-1250.272] -- 0:01:18
      433000 -- (-1251.359) (-1248.525) (-1245.773) [-1246.369] * (-1255.480) [-1243.575] (-1254.173) (-1243.877) -- 0:01:18
      433500 -- (-1254.214) [-1247.465] (-1245.294) (-1244.158) * (-1248.757) [-1243.393] (-1247.710) (-1250.451) -- 0:01:18
      434000 -- (-1250.103) (-1248.742) [-1245.256] (-1250.532) * (-1249.872) [-1252.605] (-1246.767) (-1248.998) -- 0:01:18
      434500 -- [-1249.132] (-1249.141) (-1245.273) (-1245.681) * (-1250.707) (-1245.438) (-1248.046) [-1249.025] -- 0:01:18
      435000 -- (-1247.040) (-1248.413) (-1251.841) [-1244.982] * (-1243.156) [-1243.387] (-1247.380) (-1249.494) -- 0:01:17

      Average standard deviation of split frequencies: 0.000541

      435500 -- [-1253.796] (-1247.149) (-1256.210) (-1255.319) * (-1253.148) [-1248.239] (-1250.039) (-1252.900) -- 0:01:17
      436000 -- [-1245.240] (-1245.766) (-1250.364) (-1250.427) * (-1247.251) [-1247.111] (-1248.504) (-1245.925) -- 0:01:17
      436500 -- (-1249.535) (-1248.016) (-1251.114) [-1244.203] * (-1254.849) (-1248.627) (-1248.259) [-1244.577] -- 0:01:17
      437000 -- [-1244.265] (-1253.208) (-1249.705) (-1245.106) * (-1247.654) (-1249.409) [-1247.633] (-1247.024) -- 0:01:17
      437500 -- (-1249.001) [-1249.569] (-1247.431) (-1247.673) * [-1242.392] (-1251.988) (-1249.441) (-1244.718) -- 0:01:17
      438000 -- (-1254.169) [-1240.822] (-1249.956) (-1247.478) * (-1247.599) [-1248.767] (-1251.444) (-1249.624) -- 0:01:16
      438500 -- [-1249.265] (-1245.153) (-1245.309) (-1250.048) * [-1245.575] (-1244.419) (-1252.482) (-1246.985) -- 0:01:16
      439000 -- (-1249.923) (-1255.201) [-1248.743] (-1251.429) * (-1248.342) (-1250.028) (-1243.800) [-1246.533] -- 0:01:17
      439500 -- [-1244.530] (-1247.271) (-1248.277) (-1253.160) * (-1254.068) (-1251.692) [-1246.615] (-1243.795) -- 0:01:17
      440000 -- (-1246.242) (-1252.476) [-1245.949] (-1250.604) * (-1247.920) (-1245.382) (-1254.103) [-1250.490] -- 0:01:17

      Average standard deviation of split frequencies: 0.000535

      440500 -- [-1244.452] (-1245.676) (-1252.319) (-1253.445) * [-1244.979] (-1250.225) (-1247.911) (-1248.622) -- 0:01:17
      441000 -- [-1244.229] (-1252.269) (-1245.627) (-1259.668) * [-1248.366] (-1253.664) (-1246.375) (-1246.275) -- 0:01:17
      441500 -- (-1243.645) [-1249.446] (-1241.941) (-1248.584) * (-1246.915) (-1247.215) [-1247.058] (-1245.470) -- 0:01:17
      442000 -- (-1246.085) (-1246.639) [-1245.618] (-1249.542) * [-1246.858] (-1261.768) (-1248.600) (-1250.280) -- 0:01:17
      442500 -- [-1253.867] (-1246.081) (-1252.517) (-1245.039) * (-1251.707) (-1251.192) (-1247.403) [-1246.119] -- 0:01:16
      443000 -- [-1244.207] (-1249.400) (-1245.233) (-1249.632) * (-1251.328) (-1242.476) [-1247.966] (-1244.758) -- 0:01:16
      443500 -- (-1245.679) (-1253.412) (-1245.430) [-1244.030] * (-1250.636) (-1245.124) (-1248.193) [-1244.418] -- 0:01:16
      444000 -- [-1241.937] (-1252.689) (-1245.567) (-1246.959) * (-1252.580) (-1246.125) [-1245.903] (-1243.981) -- 0:01:16
      444500 -- (-1247.451) (-1246.444) (-1250.130) [-1248.656] * (-1255.274) [-1243.629] (-1245.882) (-1243.502) -- 0:01:16
      445000 -- (-1244.908) [-1243.492] (-1252.208) (-1244.470) * (-1247.183) (-1245.246) [-1246.299] (-1248.352) -- 0:01:16

      Average standard deviation of split frequencies: 0.000528

      445500 -- (-1243.753) [-1245.833] (-1256.241) (-1245.524) * (-1249.129) (-1247.704) (-1244.521) [-1247.782] -- 0:01:15
      446000 -- [-1244.831] (-1249.065) (-1248.075) (-1251.421) * [-1246.985] (-1244.028) (-1243.045) (-1247.885) -- 0:01:17
      446500 -- (-1249.482) (-1245.639) (-1258.012) [-1243.660] * [-1240.582] (-1253.990) (-1248.386) (-1248.267) -- 0:01:16
      447000 -- (-1251.714) [-1247.434] (-1248.115) (-1247.873) * [-1243.998] (-1248.152) (-1244.661) (-1244.692) -- 0:01:16
      447500 -- (-1250.266) (-1252.176) (-1252.007) [-1244.935] * [-1247.995] (-1254.507) (-1246.579) (-1248.546) -- 0:01:16
      448000 -- (-1254.438) (-1247.508) [-1249.613] (-1253.439) * (-1243.634) (-1248.148) [-1244.179] (-1246.917) -- 0:01:16
      448500 -- (-1252.074) [-1253.246] (-1249.873) (-1243.475) * (-1246.071) [-1248.441] (-1247.165) (-1247.483) -- 0:01:16
      449000 -- (-1245.033) (-1250.211) (-1247.811) [-1247.034] * (-1246.180) (-1256.628) [-1247.583] (-1255.073) -- 0:01:16
      449500 -- (-1247.800) (-1251.739) [-1252.316] (-1251.524) * (-1245.281) (-1251.184) (-1251.807) [-1253.040] -- 0:01:15
      450000 -- (-1255.331) (-1245.821) (-1254.420) [-1249.751] * (-1244.120) (-1250.258) [-1252.032] (-1248.524) -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      450500 -- (-1246.895) (-1249.536) (-1246.861) [-1252.865] * [-1243.578] (-1252.432) (-1242.585) (-1246.044) -- 0:01:15
      451000 -- (-1252.328) (-1246.327) (-1247.545) [-1248.382] * (-1258.901) (-1250.278) (-1244.548) [-1248.566] -- 0:01:15
      451500 -- (-1248.441) [-1254.273] (-1247.170) (-1253.330) * (-1251.034) [-1249.153] (-1253.784) (-1241.524) -- 0:01:15
      452000 -- (-1248.437) (-1251.028) (-1256.003) [-1251.459] * [-1249.272] (-1254.214) (-1257.884) (-1246.508) -- 0:01:15
      452500 -- [-1249.055] (-1250.600) (-1249.673) (-1246.146) * [-1246.868] (-1249.466) (-1245.571) (-1243.112) -- 0:01:15
      453000 -- (-1251.013) (-1247.484) (-1249.321) [-1246.166] * (-1250.273) (-1249.918) (-1245.297) [-1246.055] -- 0:01:14
      453500 -- [-1247.973] (-1246.162) (-1252.879) (-1250.193) * [-1244.907] (-1250.705) (-1245.945) (-1254.459) -- 0:01:15
      454000 -- [-1250.274] (-1249.989) (-1248.620) (-1243.246) * (-1256.143) (-1249.563) (-1250.383) [-1243.924] -- 0:01:15
      454500 -- [-1247.999] (-1245.933) (-1251.106) (-1247.491) * (-1248.189) [-1247.858] (-1255.989) (-1244.905) -- 0:01:15
      455000 -- [-1250.907] (-1248.388) (-1258.448) (-1250.189) * (-1252.219) [-1248.292] (-1252.924) (-1245.952) -- 0:01:15

      Average standard deviation of split frequencies: 0.000000

      455500 -- (-1251.581) (-1250.248) [-1245.095] (-1256.030) * (-1247.867) [-1251.740] (-1243.586) (-1247.597) -- 0:01:15
      456000 -- (-1243.905) (-1243.084) [-1244.027] (-1247.149) * (-1256.697) (-1248.592) [-1248.091] (-1246.686) -- 0:01:15
      456500 -- (-1246.853) [-1244.348] (-1251.314) (-1253.444) * [-1243.765] (-1247.028) (-1249.351) (-1251.134) -- 0:01:15
      457000 -- (-1247.174) (-1248.187) (-1246.636) [-1244.795] * (-1250.019) (-1250.920) (-1250.036) [-1242.612] -- 0:01:14
      457500 -- (-1248.858) [-1245.553] (-1243.110) (-1244.868) * (-1248.788) (-1244.952) [-1246.447] (-1249.009) -- 0:01:14
      458000 -- (-1250.375) [-1250.473] (-1246.392) (-1251.084) * [-1249.240] (-1253.162) (-1246.513) (-1249.499) -- 0:01:14
      458500 -- (-1248.430) (-1247.971) [-1249.087] (-1247.943) * (-1250.267) [-1249.437] (-1251.271) (-1244.565) -- 0:01:14
      459000 -- (-1249.988) [-1244.489] (-1246.453) (-1247.359) * (-1252.308) (-1251.630) [-1248.211] (-1247.723) -- 0:01:14
      459500 -- [-1243.333] (-1248.953) (-1247.223) (-1244.810) * (-1249.516) (-1253.031) (-1251.491) [-1241.183] -- 0:01:14
      460000 -- (-1252.805) [-1247.896] (-1247.016) (-1256.595) * (-1252.689) (-1253.683) [-1249.194] (-1253.527) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      460500 -- (-1250.802) (-1244.990) [-1250.421] (-1248.829) * (-1256.624) (-1252.849) (-1249.147) [-1243.415] -- 0:01:13
      461000 -- [-1244.724] (-1247.039) (-1252.045) (-1246.528) * (-1251.757) (-1249.282) (-1247.440) [-1243.925] -- 0:01:14
      461500 -- [-1243.264] (-1245.168) (-1246.849) (-1246.573) * (-1249.525) [-1253.498] (-1249.459) (-1245.003) -- 0:01:14
      462000 -- (-1243.465) (-1244.169) [-1246.408] (-1246.479) * [-1247.921] (-1252.086) (-1247.080) (-1251.862) -- 0:01:14
      462500 -- (-1247.976) (-1244.387) [-1248.900] (-1245.967) * (-1250.059) [-1243.844] (-1243.957) (-1245.766) -- 0:01:14
      463000 -- (-1253.609) [-1251.700] (-1250.533) (-1249.525) * [-1247.671] (-1244.735) (-1254.441) (-1249.129) -- 0:01:14
      463500 -- [-1251.744] (-1242.777) (-1248.750) (-1256.492) * (-1252.267) (-1248.907) [-1248.720] (-1251.834) -- 0:01:14
      464000 -- [-1243.832] (-1247.178) (-1247.913) (-1247.315) * (-1254.849) (-1243.529) [-1245.226] (-1256.526) -- 0:01:13
      464500 -- [-1244.942] (-1245.750) (-1254.983) (-1243.665) * (-1254.980) (-1249.425) (-1245.832) [-1251.935] -- 0:01:13
      465000 -- [-1241.794] (-1248.298) (-1259.679) (-1252.175) * [-1245.344] (-1243.515) (-1244.808) (-1252.938) -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      465500 -- (-1244.687) (-1247.148) [-1248.127] (-1245.872) * (-1253.940) [-1247.811] (-1243.886) (-1250.100) -- 0:01:13
      466000 -- [-1244.373] (-1248.654) (-1252.428) (-1245.879) * (-1248.718) [-1246.205] (-1250.702) (-1251.369) -- 0:01:13
      466500 -- [-1244.398] (-1244.215) (-1251.136) (-1243.883) * (-1250.941) [-1248.049] (-1245.373) (-1244.451) -- 0:01:13
      467000 -- (-1251.776) (-1244.877) [-1246.022] (-1246.812) * [-1244.506] (-1251.505) (-1251.466) (-1246.547) -- 0:01:13
      467500 -- (-1253.060) [-1248.513] (-1254.761) (-1250.636) * (-1246.540) (-1248.407) [-1246.960] (-1251.774) -- 0:01:12
      468000 -- (-1256.921) (-1244.443) (-1243.944) [-1243.299] * (-1245.458) [-1243.601] (-1253.594) (-1247.711) -- 0:01:13
      468500 -- (-1247.405) [-1247.144] (-1250.542) (-1244.241) * [-1243.070] (-1248.577) (-1252.124) (-1246.497) -- 0:01:13
      469000 -- [-1246.296] (-1263.004) (-1244.318) (-1244.333) * [-1242.706] (-1244.697) (-1258.520) (-1243.355) -- 0:01:13
      469500 -- (-1248.035) (-1250.086) [-1243.862] (-1253.251) * [-1246.904] (-1247.654) (-1268.749) (-1245.618) -- 0:01:13
      470000 -- (-1247.104) (-1246.409) [-1247.223] (-1253.167) * (-1243.369) (-1246.228) (-1250.285) [-1245.842] -- 0:01:13

      Average standard deviation of split frequencies: 0.000000

      470500 -- (-1251.767) (-1250.142) [-1244.682] (-1248.683) * [-1244.574] (-1248.331) (-1252.733) (-1245.094) -- 0:01:13
      471000 -- (-1253.880) (-1251.555) [-1249.356] (-1247.872) * (-1246.996) [-1248.014] (-1257.975) (-1243.490) -- 0:01:13
      471500 -- (-1249.316) (-1252.539) (-1253.249) [-1251.815] * [-1247.225] (-1249.532) (-1257.258) (-1246.759) -- 0:01:12
      472000 -- (-1253.423) [-1248.056] (-1250.323) (-1252.217) * (-1246.462) (-1249.433) [-1249.528] (-1246.444) -- 0:01:12
      472500 -- (-1250.608) (-1249.064) (-1250.718) [-1251.284] * [-1249.077] (-1254.052) (-1258.340) (-1252.179) -- 0:01:12
      473000 -- [-1247.724] (-1250.144) (-1243.424) (-1262.569) * (-1249.104) (-1246.558) [-1254.444] (-1251.500) -- 0:01:12
      473500 -- (-1246.213) (-1250.210) (-1246.922) [-1244.834] * (-1245.038) [-1246.280] (-1255.445) (-1254.566) -- 0:01:12
      474000 -- (-1245.922) (-1257.435) [-1251.393] (-1246.694) * [-1242.413] (-1246.864) (-1257.033) (-1246.569) -- 0:01:12
      474500 -- (-1242.772) [-1246.103] (-1252.356) (-1258.323) * (-1243.611) (-1248.503) [-1250.333] (-1249.088) -- 0:01:11
      475000 -- (-1242.575) (-1247.545) [-1243.605] (-1245.521) * (-1246.397) [-1247.571] (-1252.701) (-1249.964) -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      475500 -- (-1246.621) [-1250.078] (-1246.512) (-1248.848) * (-1245.099) (-1249.200) (-1261.945) [-1244.917] -- 0:01:12
      476000 -- (-1250.384) (-1244.961) (-1244.829) [-1253.563] * (-1247.309) (-1247.475) [-1254.816] (-1246.690) -- 0:01:12
      476500 -- (-1247.591) [-1244.819] (-1249.667) (-1249.737) * (-1254.770) [-1244.975] (-1253.080) (-1247.398) -- 0:01:12
      477000 -- (-1252.906) (-1246.217) (-1250.150) [-1244.992] * (-1251.361) (-1246.669) [-1250.620] (-1251.479) -- 0:01:12
      477500 -- (-1246.724) (-1246.038) [-1248.290] (-1245.095) * (-1250.192) (-1245.285) [-1249.849] (-1247.098) -- 0:01:12
      478000 -- [-1247.003] (-1242.675) (-1254.356) (-1247.080) * [-1246.570] (-1249.737) (-1246.905) (-1253.590) -- 0:01:12
      478500 -- (-1249.929) (-1245.029) (-1249.808) [-1248.341] * (-1249.944) (-1249.274) [-1252.129] (-1257.207) -- 0:01:11
      479000 -- (-1251.926) (-1246.807) (-1253.417) [-1246.656] * (-1249.102) [-1243.532] (-1248.951) (-1250.975) -- 0:01:11
      479500 -- (-1246.962) [-1249.021] (-1252.885) (-1248.482) * (-1245.503) [-1244.214] (-1250.722) (-1248.628) -- 0:01:11
      480000 -- (-1249.187) (-1242.771) (-1250.619) [-1251.772] * (-1247.453) (-1243.472) (-1251.438) [-1246.967] -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      480500 -- [-1244.294] (-1248.859) (-1256.952) (-1254.530) * (-1245.454) (-1249.781) (-1250.513) [-1248.574] -- 0:01:11
      481000 -- (-1247.437) (-1253.826) (-1245.415) [-1248.420] * (-1249.334) (-1245.442) [-1248.992] (-1245.331) -- 0:01:11
      481500 -- (-1258.239) (-1251.342) (-1246.693) [-1250.072] * (-1250.809) (-1248.025) (-1248.577) [-1246.163] -- 0:01:11
      482000 -- (-1247.090) (-1254.913) [-1242.963] (-1250.502) * [-1249.786] (-1246.458) (-1255.947) (-1242.910) -- 0:01:10
      482500 -- (-1248.368) (-1245.298) (-1249.339) [-1246.002] * (-1247.465) (-1252.114) (-1248.448) [-1251.120] -- 0:01:10
      483000 -- (-1247.421) [-1247.214] (-1250.329) (-1247.626) * (-1245.660) (-1255.517) [-1244.455] (-1248.264) -- 0:01:11
      483500 -- [-1246.790] (-1247.616) (-1241.979) (-1260.387) * (-1242.613) (-1248.559) (-1244.577) [-1249.163] -- 0:01:11
      484000 -- (-1252.141) [-1250.921] (-1251.530) (-1251.062) * [-1247.239] (-1250.823) (-1249.590) (-1243.679) -- 0:01:11
      484500 -- (-1252.387) (-1250.307) (-1251.694) [-1250.059] * [-1245.605] (-1244.228) (-1247.007) (-1250.010) -- 0:01:11
      485000 -- (-1249.649) (-1243.490) [-1245.889] (-1251.432) * (-1243.600) (-1248.420) (-1254.074) [-1250.429] -- 0:01:11

      Average standard deviation of split frequencies: 0.000000

      485500 -- [-1246.586] (-1251.055) (-1245.199) (-1257.262) * (-1255.229) (-1246.305) [-1243.522] (-1243.684) -- 0:01:11
      486000 -- (-1248.611) (-1247.898) (-1245.537) [-1253.578] * [-1245.397] (-1246.562) (-1241.564) (-1249.047) -- 0:01:10
      486500 -- (-1249.213) (-1244.657) (-1250.658) [-1247.308] * (-1251.728) (-1251.529) (-1248.661) [-1243.867] -- 0:01:10
      487000 -- (-1249.670) [-1249.133] (-1244.746) (-1247.289) * (-1247.948) (-1250.699) [-1244.203] (-1245.053) -- 0:01:10
      487500 -- (-1248.218) (-1250.997) [-1245.801] (-1250.827) * [-1249.984] (-1250.108) (-1247.453) (-1244.674) -- 0:01:10
      488000 -- (-1253.405) (-1251.747) [-1245.865] (-1247.823) * (-1246.834) (-1255.634) (-1248.454) [-1245.942] -- 0:01:10
      488500 -- (-1252.821) (-1257.774) (-1247.265) [-1247.754] * [-1251.083] (-1253.954) (-1256.240) (-1249.486) -- 0:01:10
      489000 -- (-1248.888) (-1246.774) (-1243.434) [-1246.748] * (-1247.356) (-1244.883) (-1256.709) [-1250.020] -- 0:01:10
      489500 -- (-1246.416) (-1245.511) (-1249.443) [-1254.165] * (-1256.997) (-1245.437) (-1250.614) [-1250.943] -- 0:01:09
      490000 -- (-1250.840) (-1251.991) [-1245.067] (-1250.561) * [-1249.498] (-1245.423) (-1255.117) (-1246.410) -- 0:01:09

      Average standard deviation of split frequencies: 0.000000

      490500 -- [-1244.562] (-1249.538) (-1247.462) (-1250.041) * (-1251.481) [-1248.494] (-1256.176) (-1252.614) -- 0:01:10
      491000 -- (-1246.229) (-1252.079) [-1242.519] (-1252.313) * [-1249.841] (-1247.906) (-1249.700) (-1251.260) -- 0:01:10
      491500 -- (-1245.823) [-1247.359] (-1244.744) (-1252.568) * (-1256.211) (-1248.763) [-1247.445] (-1248.056) -- 0:01:10
      492000 -- [-1245.502] (-1249.483) (-1247.062) (-1251.064) * (-1253.536) (-1249.140) (-1250.450) [-1245.815] -- 0:01:10
      492500 -- (-1245.262) (-1244.648) (-1250.947) [-1243.703] * (-1249.219) (-1254.252) [-1250.768] (-1247.392) -- 0:01:10
      493000 -- [-1247.907] (-1242.010) (-1254.655) (-1244.091) * (-1257.137) (-1247.913) [-1245.754] (-1251.445) -- 0:01:09
      493500 -- (-1255.473) [-1241.472] (-1255.722) (-1248.211) * (-1245.222) (-1256.012) (-1246.466) [-1248.801] -- 0:01:09
      494000 -- (-1244.331) [-1250.441] (-1249.186) (-1245.196) * (-1247.469) [-1244.922] (-1244.468) (-1250.555) -- 0:01:09
      494500 -- (-1256.425) [-1244.266] (-1246.544) (-1245.101) * [-1244.266] (-1247.810) (-1247.635) (-1253.280) -- 0:01:09
      495000 -- (-1257.785) (-1243.231) (-1254.235) [-1245.224] * [-1248.395] (-1254.132) (-1245.766) (-1247.486) -- 0:01:09

      Average standard deviation of split frequencies: 0.000000

      495500 -- (-1253.432) (-1243.191) [-1249.642] (-1245.568) * (-1244.092) [-1247.083] (-1252.205) (-1247.518) -- 0:01:09
      496000 -- (-1246.159) [-1246.621] (-1250.914) (-1251.728) * [-1244.641] (-1244.143) (-1258.243) (-1252.248) -- 0:01:09
      496500 -- (-1245.347) (-1243.396) (-1248.877) [-1251.504] * (-1250.321) [-1243.842] (-1251.987) (-1251.718) -- 0:01:08
      497000 -- (-1250.173) (-1244.511) [-1246.782] (-1244.658) * (-1254.162) [-1248.116] (-1254.213) (-1252.267) -- 0:01:08
      497500 -- (-1248.385) (-1248.927) [-1248.970] (-1245.679) * (-1251.787) (-1243.735) [-1262.457] (-1252.002) -- 0:01:08
      498000 -- (-1244.645) [-1243.392] (-1247.686) (-1247.623) * (-1250.291) [-1251.094] (-1258.705) (-1248.839) -- 0:01:09
      498500 -- (-1243.507) (-1243.301) [-1246.070] (-1244.233) * [-1251.444] (-1248.762) (-1261.161) (-1248.371) -- 0:01:09
      499000 -- (-1248.181) (-1248.840) (-1245.910) [-1246.827] * [-1248.099] (-1250.333) (-1251.208) (-1252.052) -- 0:01:09
      499500 -- [-1247.228] (-1248.143) (-1245.980) (-1247.236) * (-1254.436) [-1241.899] (-1257.111) (-1246.614) -- 0:01:09
      500000 -- (-1246.151) (-1252.842) [-1247.373] (-1246.263) * [-1248.487] (-1245.769) (-1248.069) (-1245.898) -- 0:01:09

      Average standard deviation of split frequencies: 0.000000

      500500 -- [-1255.091] (-1249.195) (-1248.976) (-1244.786) * (-1254.412) (-1243.482) (-1259.868) [-1249.488] -- 0:01:08
      501000 -- [-1247.597] (-1248.232) (-1254.378) (-1246.025) * (-1251.119) [-1246.323] (-1252.150) (-1250.935) -- 0:01:08
      501500 -- (-1245.481) [-1252.802] (-1251.276) (-1249.052) * [-1252.198] (-1244.686) (-1253.502) (-1256.225) -- 0:01:08
      502000 -- (-1247.743) (-1249.950) [-1245.109] (-1252.689) * (-1245.582) (-1244.857) (-1257.143) [-1245.929] -- 0:01:08
      502500 -- [-1243.365] (-1251.253) (-1247.203) (-1248.047) * (-1245.523) (-1244.636) [-1253.997] (-1246.800) -- 0:01:08
      503000 -- (-1244.155) (-1247.891) [-1246.439] (-1247.756) * [-1247.787] (-1249.701) (-1252.634) (-1244.817) -- 0:01:08
      503500 -- (-1246.625) (-1249.473) [-1246.621] (-1251.158) * [-1246.725] (-1248.988) (-1257.518) (-1249.097) -- 0:01:08
      504000 -- [-1242.071] (-1248.763) (-1247.597) (-1249.612) * (-1255.889) (-1244.920) (-1251.210) [-1249.050] -- 0:01:07
      504500 -- (-1254.289) [-1248.763] (-1252.521) (-1249.269) * (-1243.642) [-1246.498] (-1252.072) (-1245.487) -- 0:01:07
      505000 -- (-1250.676) (-1249.563) [-1246.605] (-1247.349) * [-1247.602] (-1246.178) (-1251.031) (-1252.204) -- 0:01:07

      Average standard deviation of split frequencies: 0.000000

      505500 -- (-1252.463) (-1258.972) [-1247.089] (-1259.703) * [-1244.410] (-1243.661) (-1250.744) (-1255.557) -- 0:01:08
      506000 -- (-1249.384) [-1248.869] (-1250.131) (-1245.688) * [-1245.857] (-1245.527) (-1250.403) (-1250.385) -- 0:01:08
      506500 -- [-1249.155] (-1250.685) (-1247.905) (-1250.510) * (-1247.678) (-1243.972) (-1253.218) [-1246.936] -- 0:01:08
      507000 -- (-1250.632) (-1249.019) (-1246.864) [-1252.906] * (-1248.600) (-1244.763) (-1252.912) [-1244.848] -- 0:01:08
      507500 -- (-1252.395) (-1246.927) (-1251.076) [-1250.534] * (-1245.935) [-1243.264] (-1253.771) (-1245.111) -- 0:01:07
      508000 -- (-1256.156) [-1248.630] (-1248.425) (-1252.576) * (-1248.649) (-1244.803) (-1254.578) [-1247.351] -- 0:01:07
      508500 -- [-1247.963] (-1254.117) (-1248.475) (-1249.260) * (-1246.771) (-1242.884) (-1251.972) [-1243.033] -- 0:01:07
      509000 -- (-1252.169) (-1247.551) [-1245.034] (-1250.051) * (-1245.803) [-1242.632] (-1247.821) (-1249.467) -- 0:01:07
      509500 -- (-1255.060) [-1248.355] (-1246.579) (-1251.142) * [-1247.749] (-1251.414) (-1242.166) (-1248.613) -- 0:01:07
      510000 -- [-1250.965] (-1248.209) (-1247.120) (-1245.403) * (-1256.362) (-1254.583) [-1249.162] (-1254.716) -- 0:01:07

      Average standard deviation of split frequencies: 0.000000

      510500 -- (-1255.533) (-1251.125) [-1252.531] (-1250.163) * (-1248.733) (-1249.447) (-1248.844) [-1251.969] -- 0:01:07
      511000 -- (-1251.092) [-1245.690] (-1246.182) (-1248.321) * (-1251.794) (-1252.003) [-1242.032] (-1250.538) -- 0:01:06
      511500 -- [-1254.795] (-1248.688) (-1248.655) (-1247.029) * (-1247.517) (-1254.253) (-1244.833) [-1251.894] -- 0:01:06
      512000 -- (-1260.223) (-1245.505) [-1248.208] (-1244.179) * (-1243.307) (-1244.603) [-1243.450] (-1250.379) -- 0:01:06
      512500 -- [-1242.396] (-1247.450) (-1254.973) (-1246.360) * (-1244.952) [-1244.346] (-1253.535) (-1248.454) -- 0:01:06
      513000 -- [-1244.867] (-1244.933) (-1246.699) (-1248.738) * (-1248.002) [-1245.845] (-1246.118) (-1251.436) -- 0:01:07
      513500 -- (-1246.538) (-1246.470) [-1244.241] (-1245.556) * [-1245.578] (-1246.799) (-1246.213) (-1254.232) -- 0:01:07
      514000 -- (-1246.353) [-1244.964] (-1252.751) (-1246.308) * (-1246.313) [-1253.474] (-1243.420) (-1257.075) -- 0:01:07
      514500 -- (-1251.418) (-1250.255) [-1249.336] (-1246.550) * [-1246.886] (-1252.429) (-1247.270) (-1249.442) -- 0:01:06
      515000 -- (-1248.647) (-1245.324) [-1242.468] (-1250.860) * [-1242.546] (-1250.117) (-1256.374) (-1250.538) -- 0:01:06

      Average standard deviation of split frequencies: 0.000000

      515500 -- (-1251.739) (-1249.175) [-1243.674] (-1256.428) * (-1244.660) (-1253.593) [-1247.715] (-1245.079) -- 0:01:06
      516000 -- (-1261.265) (-1245.692) [-1244.280] (-1244.062) * (-1246.711) (-1250.424) [-1248.349] (-1244.564) -- 0:01:06
      516500 -- (-1247.781) (-1246.080) (-1249.013) [-1245.854] * (-1244.710) (-1246.115) (-1244.543) [-1244.260] -- 0:01:06
      517000 -- (-1248.901) (-1242.838) (-1246.357) [-1249.592] * (-1254.073) (-1245.476) [-1248.247] (-1249.590) -- 0:01:06
      517500 -- (-1243.200) [-1248.871] (-1247.649) (-1253.263) * (-1245.864) (-1247.430) (-1246.912) [-1246.027] -- 0:01:06
      518000 -- [-1249.537] (-1247.984) (-1249.446) (-1252.015) * (-1245.290) (-1245.423) (-1251.342) [-1246.593] -- 0:01:06
      518500 -- (-1248.928) (-1246.420) (-1250.295) [-1248.857] * (-1249.910) (-1243.231) (-1246.458) [-1243.883] -- 0:01:05
      519000 -- [-1245.849] (-1245.810) (-1248.501) (-1247.351) * (-1245.919) (-1245.780) (-1252.010) [-1243.027] -- 0:01:05
      519500 -- (-1241.649) [-1249.064] (-1255.710) (-1245.572) * (-1246.360) [-1246.563] (-1251.427) (-1245.451) -- 0:01:05
      520000 -- (-1258.625) (-1247.370) [-1250.838] (-1243.961) * [-1250.028] (-1251.233) (-1240.771) (-1245.276) -- 0:01:05

      Average standard deviation of split frequencies: 0.000000

      520500 -- (-1253.797) (-1245.482) (-1251.391) [-1247.234] * (-1247.664) (-1248.614) (-1246.699) [-1246.033] -- 0:01:06
      521000 -- (-1252.046) (-1247.261) (-1254.554) [-1243.161] * [-1250.408] (-1245.197) (-1253.913) (-1244.994) -- 0:01:06
      521500 -- (-1249.045) (-1240.325) [-1250.450] (-1246.229) * (-1248.035) (-1251.049) [-1244.478] (-1247.523) -- 0:01:06
      522000 -- [-1244.906] (-1249.406) (-1249.268) (-1249.458) * (-1250.073) [-1245.492] (-1248.206) (-1246.309) -- 0:01:05
      522500 -- (-1245.684) (-1243.639) [-1247.541] (-1252.752) * (-1246.144) (-1250.010) (-1246.682) [-1243.590] -- 0:01:05
      523000 -- [-1243.014] (-1246.373) (-1248.748) (-1248.975) * (-1245.258) [-1246.300] (-1245.705) (-1244.136) -- 0:01:05
      523500 -- (-1249.174) (-1245.846) [-1251.015] (-1245.584) * (-1245.219) (-1246.244) (-1247.986) [-1245.342] -- 0:01:05
      524000 -- (-1249.226) (-1241.000) (-1251.025) [-1244.895] * [-1242.817] (-1248.392) (-1246.741) (-1246.942) -- 0:01:05
      524500 -- (-1248.144) [-1246.638] (-1251.375) (-1245.496) * [-1243.005] (-1256.489) (-1244.888) (-1246.725) -- 0:01:05
      525000 -- [-1244.611] (-1244.324) (-1258.232) (-1248.161) * (-1250.720) (-1249.753) (-1251.225) [-1242.661] -- 0:01:05

      Average standard deviation of split frequencies: 0.000000

      525500 -- (-1251.925) (-1242.464) [-1249.099] (-1244.081) * (-1247.695) (-1255.633) (-1250.715) [-1246.797] -- 0:01:05
      526000 -- (-1249.893) [-1243.096] (-1253.360) (-1250.732) * (-1251.145) (-1248.490) (-1247.937) [-1248.506] -- 0:01:04
      526500 -- [-1243.761] (-1245.259) (-1242.820) (-1246.705) * (-1251.971) (-1247.225) (-1248.633) [-1251.336] -- 0:01:04
      527000 -- (-1247.459) [-1245.829] (-1242.911) (-1248.940) * (-1251.389) (-1252.754) [-1244.677] (-1242.352) -- 0:01:04
      527500 -- (-1248.890) (-1247.212) (-1248.851) [-1246.244] * (-1253.161) (-1253.511) (-1248.156) [-1247.326] -- 0:01:04
      528000 -- (-1254.749) (-1253.028) [-1246.115] (-1244.552) * [-1254.384] (-1246.843) (-1252.790) (-1247.298) -- 0:01:05
      528500 -- (-1252.793) (-1248.278) (-1248.204) [-1243.343] * [-1247.859] (-1250.010) (-1248.246) (-1246.725) -- 0:01:05
      529000 -- (-1247.292) (-1256.984) [-1253.486] (-1248.095) * (-1246.524) (-1249.532) [-1246.182] (-1254.237) -- 0:01:04
      529500 -- (-1255.519) (-1245.885) (-1248.377) [-1246.663] * (-1249.020) (-1251.737) [-1249.340] (-1250.639) -- 0:01:04
      530000 -- (-1248.183) [-1246.517] (-1254.404) (-1246.622) * (-1249.026) [-1246.159] (-1245.291) (-1251.510) -- 0:01:04

      Average standard deviation of split frequencies: 0.000000

      530500 -- [-1246.089] (-1244.868) (-1250.040) (-1245.276) * [-1244.096] (-1251.466) (-1244.055) (-1247.117) -- 0:01:04
      531000 -- (-1243.938) (-1247.413) [-1245.763] (-1249.884) * (-1246.233) (-1246.460) (-1246.831) [-1247.299] -- 0:01:04
      531500 -- (-1252.625) [-1250.624] (-1248.470) (-1250.169) * [-1244.531] (-1254.414) (-1248.294) (-1244.110) -- 0:01:04
      532000 -- (-1248.302) (-1254.911) [-1244.617] (-1256.687) * (-1244.099) (-1255.537) [-1247.596] (-1249.097) -- 0:01:04
      532500 -- (-1252.549) (-1255.776) (-1249.449) [-1244.888] * (-1242.665) (-1245.209) [-1250.727] (-1252.646) -- 0:01:04
      533000 -- [-1246.336] (-1254.952) (-1253.108) (-1251.681) * (-1248.081) (-1254.179) [-1246.912] (-1252.125) -- 0:01:03
      533500 -- (-1240.879) [-1257.432] (-1263.087) (-1257.963) * [-1252.662] (-1247.648) (-1253.710) (-1252.653) -- 0:01:03
      534000 -- (-1255.387) (-1246.367) (-1250.895) [-1250.395] * [-1243.414] (-1245.998) (-1249.462) (-1248.995) -- 0:01:03
      534500 -- (-1253.379) (-1250.177) (-1246.082) [-1253.701] * (-1245.939) (-1245.870) [-1250.698] (-1244.641) -- 0:01:03
      535000 -- [-1243.644] (-1249.725) (-1250.911) (-1256.320) * (-1251.462) (-1249.824) (-1241.282) [-1245.878] -- 0:01:04

      Average standard deviation of split frequencies: 0.000440

      535500 -- (-1247.745) (-1247.080) (-1243.333) [-1246.706] * (-1254.478) (-1247.229) [-1244.906] (-1249.680) -- 0:01:04
      536000 -- (-1248.304) [-1247.056] (-1247.162) (-1246.792) * [-1251.666] (-1248.461) (-1248.100) (-1251.676) -- 0:01:04
      536500 -- [-1246.296] (-1249.767) (-1250.721) (-1245.210) * (-1247.696) (-1245.838) [-1246.827] (-1249.991) -- 0:01:03
      537000 -- (-1246.797) (-1243.421) (-1248.790) [-1243.154] * (-1251.792) [-1250.127] (-1247.853) (-1247.693) -- 0:01:03
      537500 -- [-1248.134] (-1250.912) (-1247.845) (-1243.441) * (-1246.138) (-1251.755) [-1242.260] (-1251.802) -- 0:01:03
      538000 -- (-1250.220) (-1248.901) (-1244.012) [-1250.309] * (-1248.409) (-1244.900) (-1247.867) [-1249.455] -- 0:01:03
      538500 -- [-1246.368] (-1245.626) (-1246.933) (-1246.210) * (-1250.313) (-1245.764) [-1245.248] (-1247.166) -- 0:01:03
      539000 -- (-1241.606) (-1252.510) (-1252.840) [-1247.522] * (-1249.377) (-1246.406) [-1245.682] (-1249.092) -- 0:01:03
      539500 -- (-1246.569) (-1250.482) [-1249.547] (-1245.454) * (-1248.490) (-1247.617) (-1253.823) [-1245.694] -- 0:01:03
      540000 -- (-1249.028) (-1253.285) (-1243.075) [-1246.929] * (-1250.155) (-1247.653) [-1244.239] (-1254.621) -- 0:01:03

      Average standard deviation of split frequencies: 0.000000

      540500 -- [-1247.563] (-1245.119) (-1248.670) (-1255.209) * (-1252.222) (-1251.595) [-1246.031] (-1249.407) -- 0:01:02
      541000 -- [-1241.929] (-1251.887) (-1251.274) (-1249.651) * [-1247.360] (-1250.961) (-1246.418) (-1248.137) -- 0:01:02
      541500 -- [-1243.336] (-1250.420) (-1249.669) (-1251.103) * (-1251.424) (-1250.696) [-1242.595] (-1250.423) -- 0:01:02
      542000 -- (-1247.010) [-1249.443] (-1249.349) (-1252.132) * (-1243.827) (-1252.606) (-1248.490) [-1247.308] -- 0:01:02
      542500 -- (-1253.857) [-1245.042] (-1252.257) (-1247.810) * [-1244.101] (-1254.802) (-1249.698) (-1242.679) -- 0:01:03
      543000 -- [-1243.638] (-1256.109) (-1248.406) (-1249.561) * (-1247.295) [-1246.003] (-1251.891) (-1245.251) -- 0:01:03
      543500 -- (-1247.843) (-1248.812) (-1246.377) [-1246.306] * [-1243.724] (-1248.792) (-1250.660) (-1251.579) -- 0:01:02
      544000 -- (-1250.593) (-1250.124) [-1246.317] (-1245.812) * [-1246.964] (-1254.115) (-1247.398) (-1247.690) -- 0:01:02
      544500 -- [-1248.302] (-1253.610) (-1242.741) (-1251.051) * (-1247.019) [-1245.476] (-1247.196) (-1249.783) -- 0:01:02
      545000 -- (-1248.291) (-1248.336) [-1246.523] (-1250.137) * [-1244.651] (-1254.432) (-1248.349) (-1244.362) -- 0:01:02

      Average standard deviation of split frequencies: 0.000000

      545500 -- (-1245.267) (-1247.837) (-1246.793) [-1244.488] * (-1257.987) [-1250.670] (-1253.354) (-1248.017) -- 0:01:02
      546000 -- [-1242.752] (-1248.556) (-1249.359) (-1242.577) * [-1251.568] (-1249.939) (-1249.876) (-1247.805) -- 0:01:02
      546500 -- (-1253.318) (-1242.652) (-1247.109) [-1246.565] * (-1251.334) (-1252.907) [-1248.672] (-1246.605) -- 0:01:02
      547000 -- [-1251.209] (-1250.378) (-1256.896) (-1250.802) * (-1252.102) (-1251.427) [-1246.681] (-1245.320) -- 0:01:02
      547500 -- [-1248.362] (-1252.377) (-1248.331) (-1246.798) * [-1253.784] (-1251.729) (-1244.383) (-1244.515) -- 0:01:01
      548000 -- [-1250.761] (-1247.263) (-1246.637) (-1248.416) * [-1245.124] (-1247.797) (-1242.177) (-1243.315) -- 0:01:01
      548500 -- (-1248.965) (-1245.894) (-1251.042) [-1244.411] * (-1250.354) [-1246.512] (-1247.078) (-1246.599) -- 0:01:01
      549000 -- (-1245.690) [-1242.989] (-1250.192) (-1248.107) * (-1250.076) (-1246.287) [-1247.271] (-1244.959) -- 0:01:01
      549500 -- (-1245.184) (-1246.052) [-1245.974] (-1251.702) * (-1247.992) (-1253.469) [-1240.972] (-1251.569) -- 0:01:01
      550000 -- (-1249.586) (-1243.596) [-1244.330] (-1248.614) * (-1247.148) (-1248.790) [-1244.712] (-1247.084) -- 0:01:02

      Average standard deviation of split frequencies: 0.000428

      550500 -- (-1248.272) (-1251.614) (-1246.366) [-1250.879] * (-1247.464) [-1244.945] (-1247.566) (-1251.433) -- 0:01:02
      551000 -- (-1251.855) (-1245.645) (-1255.855) [-1247.395] * (-1248.347) (-1245.606) (-1250.529) [-1247.704] -- 0:01:01
      551500 -- [-1252.192] (-1245.021) (-1246.608) (-1245.534) * [-1247.031] (-1250.433) (-1243.900) (-1246.764) -- 0:01:01
      552000 -- (-1248.569) (-1245.773) (-1250.369) [-1243.971] * (-1253.499) (-1246.981) [-1246.831] (-1247.210) -- 0:01:01
      552500 -- (-1244.767) [-1249.478] (-1246.721) (-1247.385) * [-1246.286] (-1244.045) (-1244.696) (-1245.941) -- 0:01:01
      553000 -- (-1253.927) (-1245.975) [-1246.319] (-1256.027) * (-1250.459) (-1249.405) (-1245.724) [-1248.313] -- 0:01:01
      553500 -- (-1256.820) (-1250.329) [-1251.029] (-1245.583) * (-1251.169) (-1250.934) [-1251.653] (-1249.058) -- 0:01:01
      554000 -- (-1245.535) (-1251.042) [-1244.653] (-1246.572) * (-1249.734) [-1245.806] (-1248.096) (-1250.702) -- 0:01:01
      554500 -- [-1245.873] (-1250.254) (-1247.154) (-1245.973) * (-1255.948) (-1249.649) [-1245.046] (-1252.256) -- 0:01:01
      555000 -- (-1250.033) (-1251.512) [-1248.561] (-1245.004) * (-1249.908) (-1248.933) (-1247.401) [-1249.257] -- 0:01:00

      Average standard deviation of split frequencies: 0.000848

      555500 -- (-1245.613) (-1248.285) [-1244.013] (-1246.460) * (-1244.187) [-1251.580] (-1253.469) (-1249.336) -- 0:01:00
      556000 -- (-1257.641) (-1248.621) [-1243.393] (-1253.453) * (-1250.403) (-1253.832) (-1251.017) [-1248.943] -- 0:01:00
      556500 -- (-1247.872) [-1244.822] (-1246.474) (-1254.586) * (-1251.616) (-1249.973) (-1253.277) [-1246.902] -- 0:01:00
      557000 -- [-1249.883] (-1250.558) (-1249.092) (-1247.819) * [-1246.600] (-1248.269) (-1253.316) (-1249.753) -- 0:01:00
      557500 -- (-1248.271) (-1249.384) (-1244.097) [-1246.846] * (-1253.894) (-1255.907) (-1244.657) [-1248.194] -- 0:01:00
      558000 -- (-1248.833) (-1248.472) (-1248.474) [-1247.842] * [-1249.666] (-1248.937) (-1245.923) (-1249.225) -- 0:01:00
      558500 -- (-1249.592) (-1258.147) [-1249.607] (-1243.280) * (-1248.976) (-1251.934) [-1245.354] (-1252.174) -- 0:01:00
      559000 -- (-1245.655) (-1249.024) (-1247.481) [-1250.105] * (-1252.224) (-1249.180) (-1244.819) [-1248.523] -- 0:01:00
      559500 -- (-1253.568) (-1248.279) (-1249.938) [-1246.244] * (-1247.135) (-1251.866) [-1246.320] (-1242.974) -- 0:01:00
      560000 -- [-1245.572] (-1247.686) (-1250.358) (-1250.319) * (-1258.300) (-1254.780) [-1251.315] (-1243.400) -- 0:01:00

      Average standard deviation of split frequencies: 0.000841

      560500 -- (-1242.616) (-1246.017) [-1247.109] (-1248.577) * (-1248.956) [-1252.430] (-1244.573) (-1247.091) -- 0:01:00
      561000 -- (-1242.914) (-1244.061) (-1249.454) [-1252.545] * [-1246.748] (-1247.802) (-1246.067) (-1252.182) -- 0:01:00
      561500 -- (-1251.292) [-1251.468] (-1249.751) (-1256.938) * (-1249.068) (-1245.804) (-1256.065) [-1250.024] -- 0:01:00
      562000 -- (-1246.467) [-1247.088] (-1254.790) (-1246.125) * (-1247.931) [-1250.968] (-1247.886) (-1245.881) -- 0:01:00
      562500 -- (-1248.433) (-1243.597) (-1253.078) [-1245.694] * (-1243.966) (-1249.185) (-1252.430) [-1244.289] -- 0:00:59
      563000 -- (-1254.769) (-1245.908) (-1260.093) [-1247.761] * (-1245.809) (-1253.773) (-1244.968) [-1245.814] -- 0:00:59
      563500 -- (-1248.083) (-1247.377) [-1246.019] (-1251.112) * (-1248.750) [-1249.665] (-1250.962) (-1246.032) -- 0:00:59
      564000 -- (-1250.936) (-1245.985) [-1246.453] (-1248.186) * (-1243.832) (-1255.348) (-1246.934) [-1243.430] -- 0:00:59
      564500 -- (-1242.086) (-1253.188) [-1245.136] (-1250.794) * [-1246.081] (-1250.671) (-1255.029) (-1248.114) -- 0:00:59
      565000 -- (-1246.956) [-1245.613] (-1245.433) (-1248.527) * (-1248.901) (-1247.665) (-1252.199) [-1249.773] -- 0:00:59

      Average standard deviation of split frequencies: 0.000833

      565500 -- (-1244.895) (-1256.233) [-1244.001] (-1249.988) * [-1247.182] (-1250.284) (-1247.221) (-1256.145) -- 0:00:59
      566000 -- (-1245.703) [-1251.265] (-1244.472) (-1247.583) * (-1245.108) (-1253.148) (-1254.530) [-1247.673] -- 0:00:59
      566500 -- [-1251.066] (-1253.580) (-1249.744) (-1251.792) * [-1243.702] (-1259.367) (-1248.955) (-1245.024) -- 0:00:59
      567000 -- (-1251.215) (-1250.379) [-1248.404] (-1244.789) * (-1247.358) (-1255.148) (-1247.141) [-1244.024] -- 0:00:59
      567500 -- (-1257.020) [-1249.762] (-1248.594) (-1246.312) * (-1252.197) (-1261.496) (-1244.842) [-1246.741] -- 0:00:59
      568000 -- [-1253.848] (-1245.864) (-1253.930) (-1245.623) * (-1249.697) (-1253.810) (-1248.564) [-1249.083] -- 0:00:59
      568500 -- (-1259.104) (-1256.339) [-1251.504] (-1245.576) * (-1244.788) [-1251.933] (-1249.081) (-1250.847) -- 0:00:59
      569000 -- (-1259.002) (-1249.793) [-1242.521] (-1249.933) * (-1249.878) (-1252.064) [-1246.352] (-1245.646) -- 0:00:59
      569500 -- (-1253.768) [-1247.830] (-1247.551) (-1249.994) * [-1249.800] (-1256.647) (-1252.324) (-1249.128) -- 0:00:58
      570000 -- [-1245.335] (-1251.769) (-1243.341) (-1247.030) * [-1246.688] (-1249.404) (-1256.410) (-1255.460) -- 0:00:58

      Average standard deviation of split frequencies: 0.000826

      570500 -- (-1249.006) [-1249.490] (-1248.799) (-1249.766) * [-1254.220] (-1248.623) (-1249.023) (-1251.550) -- 0:00:58
      571000 -- (-1249.184) (-1248.530) [-1246.009] (-1247.888) * (-1252.750) (-1248.961) [-1249.107] (-1254.239) -- 0:00:58
      571500 -- (-1243.245) (-1251.941) (-1250.370) [-1241.707] * (-1247.583) (-1251.433) (-1251.549) [-1247.230] -- 0:00:58
      572000 -- [-1243.815] (-1251.236) (-1248.290) (-1248.573) * [-1246.902] (-1250.228) (-1250.732) (-1245.482) -- 0:00:58
      572500 -- [-1242.427] (-1245.447) (-1248.190) (-1247.485) * [-1246.500] (-1247.786) (-1254.326) (-1248.790) -- 0:00:58
      573000 -- (-1242.537) (-1247.134) (-1254.296) [-1249.927] * (-1250.006) [-1247.443] (-1248.825) (-1255.217) -- 0:00:58
      573500 -- (-1246.454) [-1251.923] (-1248.991) (-1248.937) * (-1246.148) [-1243.940] (-1250.769) (-1254.105) -- 0:00:58
      574000 -- (-1252.563) (-1260.600) (-1249.313) [-1246.858] * (-1248.782) [-1247.954] (-1251.372) (-1252.997) -- 0:00:58
      574500 -- [-1248.690] (-1253.974) (-1244.668) (-1243.395) * (-1252.104) (-1253.159) (-1246.504) [-1247.820] -- 0:00:58
      575000 -- [-1249.411] (-1251.055) (-1246.488) (-1248.174) * (-1250.320) (-1253.122) [-1246.847] (-1252.040) -- 0:00:58

      Average standard deviation of split frequencies: 0.001637

      575500 -- [-1248.249] (-1245.800) (-1248.410) (-1249.690) * [-1249.947] (-1250.388) (-1249.173) (-1245.476) -- 0:00:58
      576000 -- (-1245.912) (-1248.284) [-1247.554] (-1245.885) * (-1252.374) (-1248.681) [-1247.340] (-1252.588) -- 0:00:58
      576500 -- (-1244.175) (-1250.329) [-1247.949] (-1249.352) * (-1253.464) (-1252.946) (-1250.338) [-1244.483] -- 0:00:58
      577000 -- (-1251.019) (-1252.753) (-1251.875) [-1249.961] * (-1250.973) (-1249.975) (-1247.567) [-1254.620] -- 0:00:57
      577500 -- (-1247.924) (-1253.576) (-1248.778) [-1249.909] * (-1247.118) (-1244.558) (-1249.262) [-1243.990] -- 0:00:57
      578000 -- [-1246.873] (-1251.673) (-1251.611) (-1250.000) * [-1243.832] (-1254.027) (-1251.510) (-1241.463) -- 0:00:57
      578500 -- (-1251.454) (-1251.790) (-1249.087) [-1251.289] * (-1247.152) (-1246.222) (-1251.788) [-1250.849] -- 0:00:57
      579000 -- (-1246.393) (-1253.296) (-1249.143) [-1251.387] * (-1249.046) (-1246.180) [-1249.396] (-1249.081) -- 0:00:57
      579500 -- [-1250.467] (-1252.771) (-1253.636) (-1251.035) * (-1249.219) (-1246.526) (-1252.160) [-1246.755] -- 0:00:57
      580000 -- [-1250.961] (-1249.010) (-1247.995) (-1248.163) * [-1247.549] (-1249.131) (-1250.454) (-1252.354) -- 0:00:57

      Average standard deviation of split frequencies: 0.001624

      580500 -- [-1248.968] (-1248.336) (-1245.992) (-1241.806) * [-1246.362] (-1248.982) (-1247.038) (-1253.057) -- 0:00:57
      581000 -- (-1254.277) (-1245.276) (-1254.070) [-1250.261] * (-1249.953) (-1246.525) (-1244.452) [-1252.248] -- 0:00:57
      581500 -- (-1243.299) (-1244.722) (-1249.467) [-1243.201] * [-1244.639] (-1250.425) (-1248.978) (-1243.016) -- 0:00:57
      582000 -- (-1245.231) (-1253.277) (-1252.901) [-1249.245] * [-1245.083] (-1249.857) (-1256.918) (-1248.875) -- 0:00:57
      582500 -- (-1248.299) [-1243.916] (-1243.292) (-1254.362) * [-1246.857] (-1251.242) (-1244.143) (-1243.567) -- 0:00:57
      583000 -- (-1247.643) (-1245.438) [-1242.250] (-1244.590) * (-1246.891) (-1250.095) [-1249.134] (-1248.851) -- 0:00:57
      583500 -- (-1246.154) [-1244.809] (-1248.450) (-1246.083) * [-1251.349] (-1245.489) (-1251.305) (-1251.223) -- 0:00:57
      584000 -- (-1251.600) (-1247.543) (-1247.920) [-1245.200] * (-1251.017) [-1255.896] (-1248.183) (-1249.434) -- 0:00:56
      584500 -- [-1241.924] (-1248.803) (-1255.238) (-1248.046) * (-1245.313) (-1251.110) [-1246.524] (-1250.488) -- 0:00:56
      585000 -- (-1247.321) (-1251.198) [-1251.234] (-1246.848) * [-1252.334] (-1248.687) (-1249.243) (-1248.902) -- 0:00:56

      Average standard deviation of split frequencies: 0.001609

      585500 -- (-1249.260) [-1247.369] (-1247.412) (-1253.983) * (-1251.590) (-1246.846) (-1248.286) [-1243.609] -- 0:00:56
      586000 -- (-1240.911) (-1247.600) [-1248.451] (-1249.845) * (-1251.734) (-1246.699) [-1245.950] (-1248.261) -- 0:00:56
      586500 -- (-1247.631) (-1252.592) [-1247.247] (-1243.412) * (-1249.751) [-1243.629] (-1254.257) (-1247.543) -- 0:00:56
      587000 -- (-1248.875) [-1251.208] (-1251.851) (-1253.838) * (-1246.686) [-1240.460] (-1246.185) (-1244.578) -- 0:00:56
      587500 -- [-1248.850] (-1256.573) (-1248.954) (-1245.458) * [-1245.013] (-1246.009) (-1247.982) (-1252.085) -- 0:00:56
      588000 -- (-1248.381) (-1248.500) [-1248.503] (-1250.912) * [-1243.254] (-1253.706) (-1248.815) (-1246.306) -- 0:00:56
      588500 -- (-1251.709) [-1242.023] (-1245.500) (-1247.600) * (-1245.295) [-1253.822] (-1248.087) (-1252.030) -- 0:00:56
      589000 -- [-1244.162] (-1251.620) (-1254.158) (-1259.177) * (-1255.408) (-1248.881) (-1248.673) [-1247.453] -- 0:00:56
      589500 -- [-1249.724] (-1243.925) (-1247.593) (-1246.866) * [-1250.593] (-1246.805) (-1244.364) (-1242.423) -- 0:00:56
      590000 -- (-1250.469) (-1247.434) [-1246.642] (-1253.833) * (-1249.574) [-1247.272] (-1248.443) (-1247.164) -- 0:00:56

      Average standard deviation of split frequencies: 0.001596

      590500 -- [-1245.449] (-1243.949) (-1243.870) (-1253.777) * (-1243.548) (-1251.314) (-1244.505) [-1244.696] -- 0:00:56
      591000 -- (-1248.302) (-1247.933) (-1244.638) [-1246.682] * (-1246.846) (-1244.691) [-1251.413] (-1247.403) -- 0:00:56
      591500 -- (-1252.019) [-1245.312] (-1245.386) (-1248.486) * (-1252.785) (-1242.983) [-1245.666] (-1253.683) -- 0:00:55
      592000 -- (-1244.959) [-1242.215] (-1246.304) (-1244.956) * (-1248.698) [-1244.060] (-1250.551) (-1249.831) -- 0:00:55
      592500 -- (-1242.282) [-1242.024] (-1243.850) (-1251.480) * (-1245.865) (-1245.023) [-1252.093] (-1247.138) -- 0:00:55
      593000 -- (-1245.091) [-1250.146] (-1244.152) (-1252.193) * (-1249.082) (-1250.807) (-1248.016) [-1248.248] -- 0:00:55
      593500 -- [-1244.900] (-1257.243) (-1245.733) (-1245.566) * (-1248.083) [-1247.982] (-1249.025) (-1250.646) -- 0:00:55
      594000 -- (-1252.809) [-1240.927] (-1249.163) (-1245.613) * [-1248.518] (-1243.126) (-1257.144) (-1253.475) -- 0:00:55
      594500 -- (-1245.373) (-1246.327) [-1248.722] (-1245.513) * (-1251.081) [-1248.348] (-1251.540) (-1248.710) -- 0:00:55
      595000 -- (-1258.940) [-1242.847] (-1247.313) (-1244.989) * (-1246.897) (-1246.705) [-1245.912] (-1248.578) -- 0:00:55

      Average standard deviation of split frequencies: 0.001186

      595500 -- (-1255.999) [-1243.440] (-1247.827) (-1252.052) * [-1244.982] (-1249.170) (-1249.409) (-1253.342) -- 0:00:55
      596000 -- (-1254.087) (-1248.165) [-1252.471] (-1254.155) * [-1243.510] (-1246.877) (-1250.985) (-1250.980) -- 0:00:55
      596500 -- (-1249.357) (-1249.220) [-1247.876] (-1250.863) * (-1246.522) [-1243.248] (-1251.011) (-1250.039) -- 0:00:55
      597000 -- [-1250.412] (-1249.732) (-1257.658) (-1248.682) * (-1243.613) (-1248.637) [-1245.781] (-1250.283) -- 0:00:55
      597500 -- (-1248.526) (-1249.294) (-1250.701) [-1251.285] * (-1245.299) (-1245.855) [-1253.452] (-1250.540) -- 0:00:55
      598000 -- [-1247.873] (-1250.327) (-1245.826) (-1244.437) * [-1246.471] (-1245.931) (-1247.000) (-1246.693) -- 0:00:55
      598500 -- (-1249.735) (-1242.868) (-1252.319) [-1253.156] * (-1251.387) [-1244.483] (-1244.211) (-1252.204) -- 0:00:55
      599000 -- (-1248.632) [-1247.271] (-1243.519) (-1248.856) * (-1244.899) (-1251.829) (-1249.698) [-1247.093] -- 0:00:54
      599500 -- (-1248.392) (-1245.442) (-1248.151) [-1251.272] * [-1251.065] (-1246.049) (-1250.566) (-1248.552) -- 0:00:54
      600000 -- (-1250.203) (-1250.566) [-1251.887] (-1248.141) * (-1256.148) (-1246.503) (-1245.208) [-1246.624] -- 0:00:54

      Average standard deviation of split frequencies: 0.001177

      600500 -- [-1248.595] (-1246.510) (-1245.379) (-1251.672) * (-1249.177) [-1244.167] (-1253.340) (-1250.272) -- 0:00:54
      601000 -- (-1249.345) (-1246.956) (-1248.019) [-1250.162] * (-1247.464) [-1246.108] (-1245.680) (-1243.561) -- 0:00:54
      601500 -- (-1248.015) [-1251.894] (-1247.928) (-1247.167) * (-1248.721) (-1248.923) [-1246.509] (-1255.476) -- 0:00:54
      602000 -- (-1253.912) [-1243.947] (-1246.255) (-1250.798) * (-1243.149) [-1249.222] (-1254.260) (-1252.362) -- 0:00:54
      602500 -- (-1247.559) [-1246.321] (-1247.117) (-1244.246) * [-1245.487] (-1259.475) (-1247.929) (-1245.247) -- 0:00:54
      603000 -- [-1243.139] (-1249.853) (-1249.176) (-1250.662) * (-1245.605) [-1247.402] (-1250.209) (-1245.449) -- 0:00:54
      603500 -- [-1248.241] (-1248.891) (-1246.181) (-1245.450) * [-1248.938] (-1245.275) (-1254.094) (-1244.334) -- 0:00:54
      604000 -- (-1257.676) [-1244.851] (-1247.175) (-1245.681) * (-1249.472) (-1251.150) (-1251.472) [-1247.430] -- 0:00:54
      604500 -- (-1248.598) [-1245.798] (-1247.022) (-1250.958) * (-1242.712) (-1250.579) (-1246.280) [-1242.780] -- 0:00:54
      605000 -- (-1251.245) [-1248.424] (-1247.214) (-1252.763) * [-1244.540] (-1246.312) (-1249.377) (-1252.125) -- 0:00:54

      Average standard deviation of split frequencies: 0.001167

      605500 -- (-1248.317) (-1247.431) (-1251.488) [-1254.643] * (-1245.172) [-1242.037] (-1263.245) (-1244.460) -- 0:00:54
      606000 -- (-1247.909) (-1242.491) (-1249.427) [-1251.108] * [-1250.019] (-1249.549) (-1253.204) (-1251.545) -- 0:00:53
      606500 -- (-1249.574) (-1260.960) [-1259.407] (-1250.108) * (-1242.384) (-1249.387) (-1248.037) [-1248.191] -- 0:00:53
      607000 -- (-1245.600) [-1248.951] (-1244.701) (-1248.006) * (-1245.868) (-1248.035) [-1248.792] (-1254.901) -- 0:00:53
      607500 -- (-1247.119) (-1248.695) [-1248.421] (-1245.476) * (-1243.799) (-1245.709) [-1247.669] (-1253.431) -- 0:00:53
      608000 -- (-1251.365) (-1249.400) (-1247.917) [-1246.870] * (-1247.298) (-1242.154) (-1249.261) [-1244.031] -- 0:00:53
      608500 -- (-1251.729) [-1247.792] (-1249.135) (-1248.793) * (-1249.206) (-1252.269) [-1251.533] (-1258.449) -- 0:00:53
      609000 -- (-1246.568) [-1252.292] (-1247.464) (-1247.491) * (-1247.084) [-1245.303] (-1244.285) (-1253.628) -- 0:00:53
      609500 -- (-1249.046) (-1243.665) (-1246.461) [-1249.781] * (-1246.500) (-1243.519) [-1251.201] (-1251.532) -- 0:00:53
      610000 -- (-1254.133) (-1243.905) (-1243.597) [-1247.938] * (-1249.035) [-1243.988] (-1251.752) (-1244.335) -- 0:00:53

      Average standard deviation of split frequencies: 0.001158

      610500 -- (-1249.036) [-1249.085] (-1248.080) (-1247.317) * [-1242.065] (-1256.138) (-1245.062) (-1243.315) -- 0:00:53
      611000 -- (-1246.270) (-1247.064) (-1251.152) [-1248.550] * (-1253.622) (-1248.420) [-1246.085] (-1246.770) -- 0:00:53
      611500 -- [-1250.489] (-1245.994) (-1252.277) (-1251.657) * (-1251.750) [-1246.599] (-1246.941) (-1253.382) -- 0:00:53
      612000 -- [-1248.612] (-1250.928) (-1250.542) (-1249.081) * (-1247.158) [-1249.311] (-1243.660) (-1253.563) -- 0:00:53
      612500 -- (-1246.031) (-1249.337) (-1255.642) [-1247.169] * [-1245.456] (-1247.775) (-1247.747) (-1247.606) -- 0:00:53
      613000 -- (-1246.459) (-1246.669) (-1250.890) [-1249.398] * [-1251.391] (-1248.175) (-1247.124) (-1245.857) -- 0:00:53
      613500 -- (-1249.959) (-1247.232) [-1250.828] (-1251.192) * (-1250.099) [-1249.721] (-1250.745) (-1250.516) -- 0:00:52
      614000 -- [-1250.048] (-1246.373) (-1247.878) (-1245.294) * (-1247.913) (-1243.184) [-1246.203] (-1251.997) -- 0:00:52
      614500 -- (-1248.108) [-1248.284] (-1249.130) (-1257.675) * (-1245.536) (-1255.903) [-1244.071] (-1257.437) -- 0:00:52
      615000 -- [-1245.016] (-1245.971) (-1247.817) (-1248.808) * (-1250.338) (-1242.792) (-1251.273) [-1253.340] -- 0:00:52

      Average standard deviation of split frequencies: 0.001148

      615500 -- (-1247.320) [-1246.176] (-1245.923) (-1249.687) * (-1245.408) [-1243.745] (-1248.822) (-1252.492) -- 0:00:52
      616000 -- [-1244.200] (-1247.143) (-1242.418) (-1246.222) * (-1248.230) (-1251.101) [-1250.708] (-1246.779) -- 0:00:52
      616500 -- (-1246.250) (-1250.581) [-1243.188] (-1252.574) * (-1256.366) (-1248.838) [-1247.041] (-1245.997) -- 0:00:52
      617000 -- (-1246.760) (-1250.987) (-1249.307) [-1242.942] * (-1249.539) (-1250.862) [-1240.716] (-1245.583) -- 0:00:52
      617500 -- (-1246.610) (-1244.857) (-1244.572) [-1242.769] * (-1249.157) (-1244.042) [-1244.871] (-1244.151) -- 0:00:52
      618000 -- (-1251.774) [-1249.850] (-1250.330) (-1249.314) * (-1248.047) (-1243.676) (-1253.792) [-1246.064] -- 0:00:52
      618500 -- (-1249.740) [-1246.397] (-1243.739) (-1252.410) * (-1251.713) (-1242.906) (-1247.885) [-1245.434] -- 0:00:52
      619000 -- (-1253.262) [-1245.821] (-1246.506) (-1245.250) * [-1248.820] (-1252.273) (-1247.878) (-1247.235) -- 0:00:52
      619500 -- (-1247.411) [-1245.274] (-1244.290) (-1244.484) * (-1246.156) [-1251.410] (-1254.551) (-1248.571) -- 0:00:52
      620000 -- (-1250.624) (-1246.152) [-1249.163] (-1248.262) * [-1250.112] (-1247.936) (-1265.770) (-1243.474) -- 0:00:52

      Average standard deviation of split frequencies: 0.001139

      620500 -- (-1250.846) (-1249.433) [-1245.163] (-1253.772) * (-1245.235) (-1242.077) (-1248.617) [-1250.473] -- 0:00:51
      621000 -- (-1248.584) (-1249.254) [-1248.730] (-1246.779) * (-1244.101) (-1246.645) (-1251.981) [-1244.510] -- 0:00:51
      621500 -- (-1248.758) [-1244.895] (-1253.632) (-1246.699) * (-1245.726) (-1244.026) (-1249.800) [-1243.448] -- 0:00:51
      622000 -- (-1250.529) [-1244.696] (-1250.872) (-1249.416) * (-1247.028) (-1244.698) (-1243.612) [-1246.062] -- 0:00:51
      622500 -- (-1248.297) [-1246.268] (-1247.901) (-1247.894) * (-1242.034) (-1252.259) (-1254.683) [-1246.554] -- 0:00:51
      623000 -- (-1245.201) (-1250.051) [-1247.080] (-1247.636) * (-1246.517) (-1243.577) (-1242.845) [-1248.992] -- 0:00:51
      623500 -- (-1250.084) (-1253.832) (-1253.279) [-1243.940] * [-1245.073] (-1246.256) (-1248.860) (-1246.219) -- 0:00:51
      624000 -- (-1244.188) (-1249.295) (-1253.373) [-1246.090] * [-1244.963] (-1250.434) (-1250.360) (-1247.739) -- 0:00:51
      624500 -- (-1249.238) (-1248.880) (-1251.922) [-1248.138] * [-1247.861] (-1244.845) (-1245.375) (-1249.120) -- 0:00:51
      625000 -- (-1246.644) (-1250.733) (-1255.153) [-1242.668] * (-1243.470) (-1252.645) (-1245.725) [-1245.144] -- 0:00:51

      Average standard deviation of split frequencies: 0.001130

      625500 -- (-1248.119) [-1245.876] (-1246.647) (-1247.873) * (-1248.750) (-1248.606) (-1245.983) [-1248.307] -- 0:00:51
      626000 -- (-1248.413) [-1246.409] (-1254.302) (-1246.631) * [-1245.770] (-1250.240) (-1244.121) (-1244.840) -- 0:00:51
      626500 -- [-1244.711] (-1247.446) (-1242.877) (-1247.327) * (-1246.430) (-1253.343) [-1245.946] (-1255.924) -- 0:00:51
      627000 -- [-1248.005] (-1247.862) (-1246.679) (-1244.997) * (-1249.386) [-1247.509] (-1244.520) (-1247.886) -- 0:00:51
      627500 -- (-1248.771) (-1244.627) [-1250.178] (-1245.768) * (-1246.462) (-1250.623) [-1247.557] (-1247.320) -- 0:00:51
      628000 -- (-1248.522) (-1247.120) (-1248.637) [-1248.785] * (-1249.580) [-1245.771] (-1246.311) (-1251.020) -- 0:00:50
      628500 -- (-1243.105) [-1242.450] (-1244.755) (-1249.235) * (-1244.456) [-1249.293] (-1244.406) (-1254.102) -- 0:00:50
      629000 -- (-1250.042) (-1246.723) [-1247.757] (-1252.808) * (-1244.365) (-1250.915) [-1249.959] (-1250.905) -- 0:00:50
      629500 -- [-1247.939] (-1252.562) (-1244.066) (-1252.923) * (-1248.265) (-1254.173) [-1251.678] (-1248.348) -- 0:00:50
      630000 -- [-1249.911] (-1254.836) (-1249.126) (-1248.162) * (-1250.906) (-1253.349) (-1243.236) [-1249.466] -- 0:00:50

      Average standard deviation of split frequencies: 0.001121

      630500 -- (-1249.417) [-1245.759] (-1246.720) (-1261.095) * [-1247.491] (-1245.762) (-1249.377) (-1243.095) -- 0:00:50
      631000 -- (-1243.100) (-1258.801) (-1245.298) [-1244.484] * [-1246.603] (-1244.669) (-1245.239) (-1245.452) -- 0:00:50
      631500 -- (-1250.510) [-1247.919] (-1250.724) (-1245.669) * (-1252.088) (-1252.130) [-1248.851] (-1246.376) -- 0:00:50
      632000 -- [-1247.476] (-1251.663) (-1251.423) (-1251.080) * [-1250.415] (-1252.376) (-1251.725) (-1251.277) -- 0:00:50
      632500 -- [-1250.338] (-1251.920) (-1247.000) (-1253.778) * (-1247.553) (-1246.818) (-1245.494) [-1251.188] -- 0:00:50
      633000 -- (-1251.601) [-1248.669] (-1250.023) (-1251.823) * (-1253.186) (-1255.553) (-1245.198) [-1246.199] -- 0:00:50
      633500 -- (-1244.617) [-1248.830] (-1244.393) (-1244.759) * (-1244.393) [-1251.492] (-1246.737) (-1247.563) -- 0:00:50
      634000 -- [-1244.768] (-1248.189) (-1254.459) (-1251.474) * (-1247.159) (-1249.458) [-1253.121] (-1246.638) -- 0:00:50
      634500 -- [-1249.875] (-1249.865) (-1248.290) (-1247.172) * (-1248.819) (-1252.396) [-1251.611] (-1252.262) -- 0:00:50
      635000 -- (-1245.798) (-1248.455) (-1244.431) [-1242.948] * (-1255.216) (-1246.305) (-1256.009) [-1251.302] -- 0:00:50

      Average standard deviation of split frequencies: 0.001112

      635500 -- (-1253.919) [-1247.402] (-1247.643) (-1248.460) * (-1249.829) [-1240.491] (-1255.307) (-1251.023) -- 0:00:49
      636000 -- (-1244.082) [-1244.797] (-1256.421) (-1250.267) * (-1253.414) (-1244.624) [-1245.275] (-1254.707) -- 0:00:49
      636500 -- (-1240.591) [-1245.603] (-1252.200) (-1245.067) * (-1247.523) (-1253.208) [-1246.599] (-1256.523) -- 0:00:49
      637000 -- (-1246.502) (-1246.718) (-1252.015) [-1249.082] * (-1243.703) (-1252.037) (-1246.740) [-1249.265] -- 0:00:49
      637500 -- (-1251.973) [-1243.925] (-1249.893) (-1251.845) * (-1246.619) (-1245.161) [-1249.698] (-1244.492) -- 0:00:49
      638000 -- (-1248.463) [-1243.857] (-1249.792) (-1253.778) * (-1248.612) (-1245.792) [-1246.810] (-1243.963) -- 0:00:49
      638500 -- (-1242.841) [-1248.160] (-1242.631) (-1249.354) * [-1244.919] (-1246.437) (-1251.336) (-1252.084) -- 0:00:49
      639000 -- (-1249.172) (-1244.356) (-1256.190) [-1251.086] * [-1247.465] (-1247.911) (-1245.478) (-1247.310) -- 0:00:49
      639500 -- (-1255.126) (-1243.207) (-1255.629) [-1254.679] * (-1250.159) (-1244.912) (-1250.944) [-1246.964] -- 0:00:49
      640000 -- (-1250.676) (-1243.541) (-1256.753) [-1244.703] * [-1244.308] (-1249.044) (-1245.232) (-1248.562) -- 0:00:49

      Average standard deviation of split frequencies: 0.001104

      640500 -- (-1255.557) [-1249.880] (-1243.017) (-1252.149) * (-1248.344) [-1247.971] (-1243.470) (-1250.559) -- 0:00:49
      641000 -- (-1258.616) [-1247.081] (-1248.293) (-1249.334) * (-1247.494) (-1248.386) (-1248.566) [-1246.540] -- 0:00:49
      641500 -- (-1246.611) (-1248.369) [-1246.243] (-1244.403) * (-1255.645) (-1248.341) [-1244.362] (-1246.300) -- 0:00:49
      642000 -- (-1247.835) [-1247.965] (-1245.253) (-1247.667) * (-1246.154) (-1250.883) [-1242.026] (-1249.203) -- 0:00:49
      642500 -- (-1247.320) (-1256.570) [-1244.504] (-1250.655) * (-1248.929) (-1248.934) (-1245.122) [-1243.809] -- 0:00:48
      643000 -- (-1241.392) (-1251.492) [-1250.915] (-1250.255) * (-1245.843) (-1244.372) (-1250.223) [-1244.858] -- 0:00:48
      643500 -- (-1247.328) [-1250.480] (-1247.744) (-1253.258) * [-1246.220] (-1249.205) (-1247.344) (-1243.825) -- 0:00:48
      644000 -- (-1245.866) [-1244.623] (-1245.612) (-1244.344) * [-1251.706] (-1246.210) (-1242.968) (-1246.450) -- 0:00:48
      644500 -- (-1252.460) (-1256.021) (-1242.407) [-1240.881] * (-1259.666) (-1247.478) [-1249.296] (-1246.605) -- 0:00:48
      645000 -- (-1240.794) (-1246.499) [-1246.640] (-1245.515) * [-1246.619] (-1246.734) (-1242.187) (-1254.585) -- 0:00:48

      Average standard deviation of split frequencies: 0.001095

      645500 -- (-1253.222) [-1243.761] (-1254.579) (-1258.747) * (-1251.689) [-1248.204] (-1248.338) (-1259.443) -- 0:00:48
      646000 -- (-1247.667) (-1248.026) (-1249.115) [-1250.542] * (-1247.917) (-1256.375) [-1242.004] (-1252.976) -- 0:00:48
      646500 -- (-1247.422) [-1244.951] (-1257.057) (-1246.948) * [-1252.223] (-1254.755) (-1246.591) (-1254.921) -- 0:00:48
      647000 -- (-1247.298) (-1245.417) [-1253.221] (-1243.448) * [-1249.245] (-1252.533) (-1243.903) (-1252.474) -- 0:00:48
      647500 -- (-1244.554) (-1247.632) (-1248.254) [-1242.743] * (-1247.174) (-1248.092) [-1243.570] (-1256.483) -- 0:00:48
      648000 -- (-1248.716) (-1249.033) (-1243.769) [-1248.184] * (-1251.721) (-1248.795) [-1246.549] (-1254.467) -- 0:00:48
      648500 -- (-1243.952) (-1251.240) (-1243.540) [-1243.485] * (-1250.153) (-1259.642) (-1248.505) [-1248.899] -- 0:00:48
      649000 -- [-1244.012] (-1243.560) (-1247.085) (-1251.853) * (-1248.131) [-1249.145] (-1247.438) (-1251.067) -- 0:00:48
      649500 -- (-1246.782) (-1247.540) (-1244.351) [-1248.925] * (-1246.856) (-1249.307) [-1246.163] (-1247.720) -- 0:00:48
      650000 -- (-1251.529) (-1247.576) [-1250.630] (-1247.667) * (-1250.597) (-1247.063) [-1243.283] (-1252.110) -- 0:00:47

      Average standard deviation of split frequencies: 0.001087

      650500 -- (-1246.925) [-1244.938] (-1252.179) (-1251.077) * [-1247.193] (-1252.653) (-1247.715) (-1247.984) -- 0:00:47
      651000 -- [-1244.588] (-1248.863) (-1246.436) (-1250.391) * (-1245.535) (-1249.390) [-1247.650] (-1248.668) -- 0:00:47
      651500 -- (-1245.797) [-1251.255] (-1246.244) (-1252.960) * (-1248.398) (-1253.189) (-1245.914) [-1245.245] -- 0:00:47
      652000 -- [-1248.203] (-1245.832) (-1250.648) (-1255.243) * (-1252.292) (-1248.067) [-1243.756] (-1247.082) -- 0:00:47
      652500 -- [-1245.521] (-1250.986) (-1245.945) (-1245.253) * (-1251.752) (-1245.282) (-1244.885) [-1245.989] -- 0:00:47
      653000 -- (-1253.318) (-1245.423) [-1245.792] (-1245.807) * (-1250.775) [-1244.654] (-1252.947) (-1245.985) -- 0:00:47
      653500 -- (-1246.975) (-1247.177) (-1251.684) [-1241.702] * (-1255.957) [-1245.290] (-1246.696) (-1255.695) -- 0:00:47
      654000 -- (-1253.202) [-1244.578] (-1251.242) (-1247.693) * (-1248.603) (-1245.504) [-1244.501] (-1251.542) -- 0:00:47
      654500 -- (-1262.148) [-1243.837] (-1250.158) (-1250.083) * (-1244.285) (-1247.309) [-1248.106] (-1253.520) -- 0:00:46
      655000 -- (-1254.835) [-1245.030] (-1246.167) (-1246.575) * [-1242.512] (-1248.992) (-1247.874) (-1249.882) -- 0:00:47

      Average standard deviation of split frequencies: 0.001078

      655500 -- (-1249.999) [-1245.886] (-1249.303) (-1253.921) * (-1251.019) (-1264.855) [-1245.199] (-1246.035) -- 0:00:47
      656000 -- (-1250.154) (-1254.134) (-1253.774) [-1241.167] * [-1246.725] (-1264.525) (-1249.381) (-1244.091) -- 0:00:47
      656500 -- (-1246.668) (-1253.956) [-1250.393] (-1254.877) * (-1247.690) (-1251.400) (-1249.358) [-1248.543] -- 0:00:47
      657000 -- (-1253.782) (-1247.904) (-1245.694) [-1249.752] * (-1245.909) (-1255.556) (-1242.352) [-1249.272] -- 0:00:46
      657500 -- (-1254.793) (-1251.425) (-1244.727) [-1244.081] * (-1250.460) (-1248.793) (-1247.912) [-1255.610] -- 0:00:46
      658000 -- (-1250.062) (-1251.450) [-1244.952] (-1248.312) * (-1250.867) (-1253.088) [-1247.504] (-1247.883) -- 0:00:46
      658500 -- [-1249.984] (-1253.403) (-1250.357) (-1248.737) * [-1249.015] (-1247.856) (-1245.937) (-1253.689) -- 0:00:46
      659000 -- (-1254.332) [-1255.489] (-1245.337) (-1247.903) * (-1253.432) [-1249.732] (-1243.428) (-1256.769) -- 0:00:46
      659500 -- (-1246.053) (-1249.176) (-1245.408) [-1245.152] * (-1249.296) [-1242.168] (-1246.954) (-1253.076) -- 0:00:46
      660000 -- (-1253.210) (-1250.668) [-1243.836] (-1247.957) * [-1248.937] (-1243.986) (-1255.290) (-1256.501) -- 0:00:46

      Average standard deviation of split frequencies: 0.001070

      660500 -- (-1247.746) (-1247.794) (-1252.276) [-1247.169] * [-1250.205] (-1243.175) (-1245.569) (-1255.315) -- 0:00:46
      661000 -- (-1249.350) (-1252.237) (-1247.380) [-1243.587] * (-1251.264) (-1245.957) [-1244.624] (-1251.859) -- 0:00:46
      661500 -- (-1247.274) (-1244.667) (-1256.924) [-1245.169] * (-1251.848) (-1251.503) (-1244.275) [-1246.459] -- 0:00:46
      662000 -- (-1253.146) (-1249.903) (-1256.354) [-1245.492] * (-1254.953) (-1247.126) [-1241.134] (-1253.594) -- 0:00:46
      662500 -- (-1249.491) [-1246.277] (-1249.135) (-1246.316) * [-1251.945] (-1245.136) (-1244.034) (-1256.196) -- 0:00:46
      663000 -- (-1251.854) (-1244.083) [-1247.345] (-1253.171) * [-1251.060] (-1244.992) (-1242.919) (-1250.032) -- 0:00:46
      663500 -- (-1255.661) [-1247.293] (-1250.751) (-1246.953) * (-1249.449) [-1250.197] (-1242.662) (-1250.426) -- 0:00:46
      664000 -- (-1250.095) (-1245.399) [-1247.895] (-1245.424) * (-1252.982) [-1244.577] (-1246.822) (-1248.141) -- 0:00:46
      664500 -- (-1245.353) [-1247.272] (-1251.368) (-1252.362) * (-1248.222) [-1243.438] (-1244.625) (-1251.094) -- 0:00:45
      665000 -- (-1251.192) [-1244.977] (-1246.899) (-1252.868) * [-1247.686] (-1252.750) (-1244.860) (-1254.993) -- 0:00:45

      Average standard deviation of split frequencies: 0.001062

      665500 -- (-1244.819) (-1255.220) [-1242.359] (-1250.933) * (-1253.189) (-1257.273) [-1243.860] (-1251.855) -- 0:00:45
      666000 -- (-1246.546) (-1248.196) (-1250.770) [-1247.002] * [-1254.361] (-1265.080) (-1243.410) (-1259.282) -- 0:00:45
      666500 -- [-1243.180] (-1247.260) (-1246.428) (-1246.184) * (-1245.979) [-1252.983] (-1245.317) (-1254.721) -- 0:00:45
      667000 -- (-1250.052) (-1247.903) [-1248.711] (-1253.599) * (-1247.165) (-1248.929) [-1241.980] (-1247.417) -- 0:00:45
      667500 -- [-1253.806] (-1255.686) (-1248.852) (-1250.202) * (-1247.784) (-1249.663) (-1243.971) [-1245.001] -- 0:00:45
      668000 -- (-1245.692) (-1247.278) (-1255.969) [-1249.110] * (-1255.545) (-1251.598) [-1246.692] (-1247.514) -- 0:00:45
      668500 -- (-1249.697) [-1250.096] (-1247.066) (-1250.268) * (-1248.702) [-1246.386] (-1245.293) (-1243.036) -- 0:00:45
      669000 -- (-1245.634) (-1253.180) (-1244.544) [-1248.402] * (-1247.308) (-1247.212) [-1248.658] (-1261.714) -- 0:00:45
      669500 -- [-1245.320] (-1249.360) (-1249.702) (-1247.082) * (-1247.333) (-1247.060) [-1248.275] (-1251.129) -- 0:00:44
      670000 -- (-1250.370) (-1253.329) [-1253.791] (-1249.785) * [-1243.733] (-1247.300) (-1249.730) (-1255.455) -- 0:00:45

      Average standard deviation of split frequencies: 0.001054

      670500 -- (-1245.117) [-1247.152] (-1248.015) (-1246.473) * (-1247.919) (-1244.728) (-1243.055) [-1248.123] -- 0:00:45
      671000 -- (-1244.988) (-1256.780) (-1254.829) [-1246.909] * [-1245.013] (-1248.053) (-1244.437) (-1245.366) -- 0:00:45
      671500 -- (-1245.581) (-1251.278) (-1250.183) [-1244.025] * (-1249.833) [-1242.352] (-1245.376) (-1248.583) -- 0:00:45
      672000 -- (-1245.572) (-1240.545) (-1244.774) [-1242.208] * [-1244.562] (-1247.636) (-1253.618) (-1247.715) -- 0:00:44
      672500 -- (-1257.250) (-1242.110) [-1251.991] (-1245.498) * [-1247.032] (-1248.002) (-1251.639) (-1248.955) -- 0:00:44
      673000 -- [-1243.718] (-1248.574) (-1246.781) (-1249.792) * [-1245.153] (-1257.491) (-1248.989) (-1253.975) -- 0:00:44
      673500 -- (-1245.283) [-1248.421] (-1247.734) (-1247.738) * (-1250.691) [-1248.422] (-1251.274) (-1252.118) -- 0:00:44
      674000 -- (-1248.851) (-1247.753) (-1246.441) [-1243.387] * (-1254.696) [-1250.238] (-1244.119) (-1251.245) -- 0:00:44
      674500 -- (-1247.205) (-1245.898) [-1249.390] (-1255.717) * [-1250.698] (-1248.449) (-1245.719) (-1251.845) -- 0:00:44
      675000 -- (-1249.607) [-1245.493] (-1247.996) (-1251.006) * [-1255.520] (-1254.756) (-1245.178) (-1248.460) -- 0:00:44

      Average standard deviation of split frequencies: 0.001046

      675500 -- (-1249.097) (-1247.994) [-1247.258] (-1249.020) * (-1243.977) (-1250.342) (-1246.759) [-1246.958] -- 0:00:44
      676000 -- [-1245.046] (-1253.014) (-1244.311) (-1247.856) * (-1244.808) (-1246.672) (-1252.040) [-1247.114] -- 0:00:44
      676500 -- (-1247.248) [-1244.933] (-1247.125) (-1248.016) * (-1250.072) (-1246.593) (-1253.158) [-1245.447] -- 0:00:43
      677000 -- (-1251.341) (-1250.303) [-1252.877] (-1246.727) * (-1242.993) (-1252.723) (-1252.434) [-1245.132] -- 0:00:43
      677500 -- [-1248.199] (-1244.837) (-1252.540) (-1249.326) * (-1244.647) [-1249.973] (-1251.377) (-1253.718) -- 0:00:44
      678000 -- (-1249.941) (-1253.822) (-1245.070) [-1251.977] * (-1251.524) [-1248.542] (-1253.731) (-1252.479) -- 0:00:44
      678500 -- [-1244.081] (-1252.711) (-1247.818) (-1245.217) * (-1253.609) (-1253.770) (-1253.898) [-1253.230] -- 0:00:44
      679000 -- [-1252.821] (-1248.600) (-1247.452) (-1252.105) * (-1252.027) (-1251.698) (-1254.211) [-1247.741] -- 0:00:43
      679500 -- (-1247.667) (-1250.673) [-1245.666] (-1246.867) * [-1244.127] (-1254.582) (-1254.539) (-1250.780) -- 0:00:43
      680000 -- [-1247.325] (-1244.986) (-1251.391) (-1244.090) * (-1242.762) [-1249.475] (-1254.979) (-1246.052) -- 0:00:43

      Average standard deviation of split frequencies: 0.000693

      680500 -- (-1250.770) [-1242.494] (-1252.615) (-1247.936) * (-1249.657) (-1249.871) [-1250.155] (-1242.949) -- 0:00:43
      681000 -- [-1248.154] (-1250.355) (-1246.488) (-1248.192) * (-1253.618) (-1247.110) [-1247.427] (-1248.436) -- 0:00:43
      681500 -- (-1246.785) (-1251.594) (-1247.611) [-1244.823] * (-1255.500) [-1246.521] (-1251.976) (-1254.121) -- 0:00:43
      682000 -- (-1244.592) (-1243.377) (-1257.686) [-1243.445] * [-1243.195] (-1246.507) (-1252.254) (-1254.642) -- 0:00:43
      682500 -- (-1248.351) [-1243.728] (-1244.721) (-1249.723) * [-1247.840] (-1254.040) (-1246.599) (-1248.954) -- 0:00:43
      683000 -- (-1245.453) [-1245.775] (-1247.120) (-1247.244) * [-1248.678] (-1250.061) (-1249.569) (-1247.358) -- 0:00:43
      683500 -- [-1243.550] (-1241.926) (-1253.243) (-1255.645) * (-1246.003) (-1249.094) (-1243.771) [-1247.335] -- 0:00:43
      684000 -- [-1245.217] (-1243.153) (-1247.611) (-1244.470) * (-1249.510) (-1252.482) [-1245.265] (-1243.564) -- 0:00:42
      684500 -- (-1244.244) [-1243.157] (-1247.062) (-1245.559) * (-1252.258) (-1248.489) (-1243.821) [-1247.872] -- 0:00:43
      685000 -- (-1256.508) (-1249.626) (-1249.091) [-1241.650] * (-1252.829) (-1250.331) [-1245.902] (-1245.192) -- 0:00:43

      Average standard deviation of split frequencies: 0.000687

      685500 -- (-1246.020) (-1250.155) (-1248.897) [-1249.094] * [-1251.615] (-1255.536) (-1245.333) (-1252.531) -- 0:00:43
      686000 -- [-1253.331] (-1246.567) (-1242.478) (-1247.514) * (-1255.755) (-1250.300) [-1243.421] (-1247.947) -- 0:00:43
      686500 -- [-1245.422] (-1249.133) (-1247.979) (-1246.813) * (-1247.860) (-1251.080) (-1245.643) [-1244.992] -- 0:00:42
      687000 -- (-1250.740) (-1253.343) [-1250.407] (-1250.181) * [-1247.250] (-1244.786) (-1244.818) (-1247.467) -- 0:00:42
      687500 -- (-1248.008) (-1248.063) (-1251.624) [-1251.842] * (-1249.718) (-1244.632) (-1246.173) [-1245.179] -- 0:00:42
      688000 -- (-1252.859) (-1243.176) (-1246.944) [-1245.616] * (-1248.438) (-1252.634) (-1245.442) [-1242.720] -- 0:00:42
      688500 -- (-1245.713) (-1246.372) (-1246.613) [-1247.548] * (-1251.902) (-1247.802) [-1247.745] (-1245.146) -- 0:00:42
      689000 -- (-1248.396) (-1244.191) (-1246.141) [-1246.018] * (-1248.829) (-1251.620) (-1251.060) [-1247.989] -- 0:00:42
      689500 -- (-1247.160) (-1247.899) [-1249.164] (-1244.425) * [-1244.083] (-1253.099) (-1250.268) (-1246.142) -- 0:00:42
      690000 -- (-1247.551) (-1248.620) (-1245.357) [-1243.036] * [-1246.439] (-1255.310) (-1249.629) (-1246.447) -- 0:00:42

      Average standard deviation of split frequencies: 0.001024

      690500 -- [-1246.333] (-1246.367) (-1248.919) (-1245.645) * (-1242.564) (-1250.952) [-1246.555] (-1250.754) -- 0:00:42
      691000 -- (-1248.273) [-1245.077] (-1248.588) (-1244.340) * [-1246.208] (-1251.806) (-1253.237) (-1249.564) -- 0:00:42
      691500 -- (-1246.242) (-1248.968) (-1252.501) [-1247.005] * (-1241.344) (-1251.041) (-1250.305) [-1246.085] -- 0:00:42
      692000 -- (-1246.110) (-1251.049) (-1253.899) [-1244.616] * [-1249.869] (-1252.474) (-1248.872) (-1242.882) -- 0:00:42
      692500 -- [-1244.512] (-1250.842) (-1243.385) (-1253.088) * (-1245.308) (-1247.225) (-1255.127) [-1242.720] -- 0:00:42
      693000 -- (-1247.030) (-1247.441) [-1244.132] (-1253.134) * (-1254.142) (-1250.742) (-1249.129) [-1249.300] -- 0:00:42
      693500 -- (-1247.678) [-1243.894] (-1247.502) (-1253.619) * (-1244.026) (-1254.571) (-1255.361) [-1246.242] -- 0:00:41
      694000 -- (-1247.852) (-1243.973) [-1245.704] (-1242.749) * [-1243.036] (-1254.596) (-1262.753) (-1245.128) -- 0:00:41
      694500 -- [-1247.140] (-1249.250) (-1248.059) (-1246.350) * (-1247.681) [-1250.175] (-1250.975) (-1245.665) -- 0:00:41
      695000 -- [-1245.754] (-1248.407) (-1247.218) (-1246.693) * (-1252.800) [-1246.357] (-1254.181) (-1245.480) -- 0:00:41

      Average standard deviation of split frequencies: 0.001016

      695500 -- (-1251.471) [-1243.986] (-1252.703) (-1247.823) * (-1249.771) (-1244.604) (-1254.191) [-1252.251] -- 0:00:41
      696000 -- [-1252.361] (-1246.342) (-1249.575) (-1253.663) * (-1249.105) (-1248.425) (-1256.452) [-1244.000] -- 0:00:41
      696500 -- [-1251.937] (-1261.036) (-1251.356) (-1247.331) * (-1249.255) [-1241.484] (-1249.278) (-1247.872) -- 0:00:41
      697000 -- [-1244.035] (-1248.913) (-1252.132) (-1247.779) * (-1250.433) (-1243.233) (-1253.894) [-1245.533] -- 0:00:41
      697500 -- (-1248.455) (-1251.571) [-1249.265] (-1249.441) * (-1244.869) [-1248.508] (-1244.493) (-1247.027) -- 0:00:41
      698000 -- [-1250.412] (-1240.843) (-1255.751) (-1248.364) * [-1246.102] (-1248.902) (-1245.255) (-1248.918) -- 0:00:41
      698500 -- (-1248.640) (-1246.884) (-1253.147) [-1245.511] * [-1244.839] (-1248.562) (-1245.950) (-1249.097) -- 0:00:41
      699000 -- (-1248.510) [-1247.969] (-1253.545) (-1246.148) * (-1241.560) [-1243.528] (-1250.057) (-1248.288) -- 0:00:41
      699500 -- [-1247.068] (-1249.052) (-1248.100) (-1246.979) * [-1245.026] (-1247.084) (-1247.710) (-1249.229) -- 0:00:41
      700000 -- (-1244.640) (-1244.651) [-1248.968] (-1246.819) * (-1253.926) [-1246.822] (-1254.641) (-1251.691) -- 0:00:41

      Average standard deviation of split frequencies: 0.000673

      700500 -- (-1248.915) [-1244.593] (-1250.045) (-1255.465) * (-1244.804) [-1244.181] (-1243.873) (-1248.587) -- 0:00:41
      701000 -- (-1251.047) (-1243.087) [-1244.828] (-1244.035) * (-1250.456) (-1251.568) [-1242.960] (-1256.422) -- 0:00:40
      701500 -- (-1245.120) [-1253.116] (-1255.583) (-1245.633) * (-1249.194) (-1250.283) [-1249.198] (-1255.856) -- 0:00:40
      702000 -- (-1254.066) (-1249.003) (-1249.954) [-1242.152] * (-1256.001) (-1250.361) [-1244.864] (-1249.915) -- 0:00:40
      702500 -- (-1252.323) (-1245.216) [-1249.263] (-1245.085) * [-1250.019] (-1246.688) (-1249.608) (-1255.943) -- 0:00:40
      703000 -- [-1250.733] (-1245.493) (-1248.114) (-1249.806) * [-1243.072] (-1247.845) (-1247.089) (-1261.293) -- 0:00:40
      703500 -- [-1246.259] (-1243.911) (-1243.815) (-1249.505) * (-1243.055) (-1246.152) [-1249.685] (-1249.044) -- 0:00:40
      704000 -- (-1247.997) (-1248.186) (-1245.890) [-1251.041] * [-1245.515] (-1252.127) (-1252.880) (-1246.867) -- 0:00:40
      704500 -- (-1246.534) [-1249.230] (-1246.115) (-1249.151) * (-1242.745) (-1241.534) [-1248.194] (-1250.227) -- 0:00:40
      705000 -- (-1253.640) [-1248.502] (-1247.543) (-1250.574) * (-1243.948) (-1244.526) (-1242.764) [-1248.745] -- 0:00:40

      Average standard deviation of split frequencies: 0.001002

      705500 -- (-1247.727) (-1247.181) (-1255.685) [-1244.227] * (-1257.363) [-1251.205] (-1244.893) (-1249.195) -- 0:00:40
      706000 -- (-1249.566) (-1247.870) (-1242.146) [-1247.361] * (-1250.111) (-1250.830) (-1245.549) [-1247.655] -- 0:00:39
      706500 -- (-1248.520) (-1249.166) [-1245.963] (-1250.400) * (-1246.264) (-1247.435) (-1247.131) [-1246.443] -- 0:00:40
      707000 -- [-1247.466] (-1246.682) (-1246.551) (-1254.276) * (-1247.479) [-1245.991] (-1246.593) (-1260.198) -- 0:00:40
      707500 -- [-1250.794] (-1251.192) (-1245.047) (-1244.989) * [-1246.487] (-1251.940) (-124