--- EXPERIMENT NOTES
--- EXPERIMENT PROPERTIES
#Tue Nov 22 06:38:02 WET 2016
codeml.models=0 1 2 3 7 8
mrbayes.mpich=
mrbayes.ngen=1000000
tcoffee.alignMethod=CLUSTALW2
tcoffee.params=
tcoffee.maxSeqs=0
codeml.bin=codeml
mrbayes.tburnin=2500
codeml.dir=
input.sequences=
mrbayes.pburnin=2500
mrbayes.bin=mb_adops
tcoffee.bin=t_coffee_ADOPS
mrbayes.dir=/usr/bin/
tcoffee.dir=
tcoffee.minScore=3
input.fasta=/opt/ADOPS/3/Acp65Aa-PA/input.fasta
input.names=
mrbayes.params=
codeml.params=
--- PSRF SUMMARY
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1057.86 -1073.03
2 -1057.71 -1072.87
--------------------------------------
TOTAL -1057.78 -1072.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.134575 0.036748 0.778742 1.515409 1.117591 1343.68 1363.32 1.000
r(A<->C){all} 0.081645 0.000928 0.025294 0.139950 0.077888 665.25 718.81 1.000
r(A<->G){all} 0.191549 0.002997 0.096250 0.301956 0.188149 776.33 793.34 1.000
r(A<->T){all} 0.073866 0.001583 0.002931 0.149883 0.067723 645.00 653.76 1.001
r(C<->G){all} 0.049810 0.000358 0.016507 0.086660 0.047638 921.00 992.98 1.000
r(C<->T){all} 0.566748 0.006083 0.420874 0.720081 0.566933 686.52 813.62 1.002
r(G<->T){all} 0.036383 0.000430 0.003987 0.078604 0.032885 811.75 972.83 1.000
pi(A){all} 0.225153 0.000556 0.179157 0.271622 0.224436 1030.33 1080.56 1.000
pi(C){all} 0.306555 0.000578 0.258590 0.350077 0.305942 1180.87 1188.32 1.000
pi(G){all} 0.284778 0.000630 0.231761 0.329885 0.284209 1095.09 1143.90 1.001
pi(T){all} 0.183514 0.000392 0.146280 0.224131 0.182361 1023.28 1046.15 1.000
alpha{1,2} 0.139686 0.001483 0.072609 0.228715 0.136936 1129.43 1145.04 1.000
alpha{3} 1.849847 0.555182 0.638544 3.311391 1.732669 1238.27 1369.64 1.000
pinvar{all} 0.384036 0.008597 0.184943 0.544266 0.396876 884.55 956.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
--- CODEML SUMMARY
Model 1: NearlyNeutral -1022.381872
Model 2: PositiveSelection -1022.381872
Model 0: one-ratio -1024.271393
Model 3: discrete -1018.036846
Model 7: beta -1018.549421
Model 8: beta&w>1 -1018.549722
Model 0 vs 1 3.7790419999998903
Model 2 vs 1 0.0
Model 8 vs 7 6.019999998443382E-4
>C1
MMKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG
TSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEG
AHLPKo
>C2
MMKLMLVVGSMAVLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG
TSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEG
AHLPKo
>C3
MMKLMLVVGSMAVLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG
TSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEG
AHLPKo
>C4
MMKLMLVVSSMAVLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG
TSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEG
AHLPKo
>C5
MMKLMLVVSSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG
TSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPEG
AHLPKo
>C6
MMKLMLVVGSMALILALASARPQNDAVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPQ
GDHLPK
>C7
MMKLMLVVGSMALLLALASARPQNDVEILESESENIGIGGYKFSYKLSDG
TTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYSINFVADENGFQPEG
AHLPKo
>C8
MMKLMLVVGSMALLLALASARPQNDVEVLEYESENIGLGGYKFSYKLSDG
TTRSEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPEG
AHLPKo
>C9
MMKLMLVVGSMALLFALASARPQNDVEVLEYESENTGLGGYKFSYKLSDG
TSRTEEGVVNNAGTDNESISIRGSVSWVAPDGQTYTINFVADENGFQPEG
AHLPKo
>C10
MMKLMLVVGSMALLLALASARPQNDVEVLEYDSENIGIGGYKFSYKLSDG
TTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPEG
AHLPKo
>C11
MMKLMLVVGSMALLLALASARPQNDVEVLEYESENIGIGGYKFSYKLSDG
TSRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPEG
AHLPKo
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=107
C1 MMKLMLVVGSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
C2 MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
C3 MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
C4 MMKLMLVVSSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
C5 MMKLMLVVSSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
C6 MMKLMLVVGSMALILALASARPQNDAVEVLEYESENTGLGGYKFSYKLSD
C7 MMKLMLVVGSMALLLALASARPQND-VEILESESENIGIGGYKFSYKLSD
C8 MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGLGGYKFSYKLSD
C9 MMKLMLVVGSMALLFALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
C10 MMKLMLVVGSMALLLALASARPQND-VEVLEYDSENIGIGGYKFSYKLSD
C11 MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGIGGYKFSYKLSD
********.*:*:::********** **:** :*** *:***********
C1 GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
C2 GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
C3 GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
C4 GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
C5 GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
C6 GTSRTEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPQ
C7 GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYSINFVADENGFQPE
C8 GTTRSEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
C9 GTSRTEEGVVNNAGTDNESISIRGSVSWVAPDGQTYTINFVADENGFQPE
C10 GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
C11 GTSRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
**:*:***.******:**********:*********:************:
C1 GAHLPKo
C2 GAHLPKo
C3 GAHLPKo
C4 GAHLPKo
C5 GAHLPKo
C6 GDHLPK-
C7 GAHLPKo
C8 GAHLPKo
C9 GAHLPKo
C10 GAHLPKo
C11 GAHLPKo
* ****
PROGRAM: T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
-full_log S [0]
-genepred_score S [0] nsd
-run_name S [0]
-mem_mode S [0] mem
-extend D [1] 1
-extend_mode S [0] very_fast_triplet
-max_n_pair D [0] 10
-seq_name_for_quadruplet S [0] all
-compact S [0] default
-clean S [0] no
-do_self FL [0] 0
-do_normalise D [0] 1000
-template_file S [0]
-setenv S [0] 0
-template_mode S [0]
-flip D [0] 0
-remove_template_file D [0] 0
-profile_template_file S [0]
-in S [0]
-seq S [0]
-aln S [0]
-method_limits S [0]
-method S [0]
-lib S [0]
-profile S [0]
-profile1 S [0]
-profile2 S [0]
-pdb S [0]
-relax_lib D [0] 1
-filter_lib D [0] 0
-shrink_lib D [0] 0
-out_lib W_F [0] no
-out_lib_mode S [0] primary
-lib_only D [0] 0
-outseqweight W_F [0] no
-dpa FL [0] 0
-seq_source S [0] ANY
-cosmetic_penalty D [0] 0
-gapopen D [0] 0
-gapext D [0] 0
-fgapopen D [0] 0
-fgapext D [0] 0
-nomatch D [0] 0
-newtree W_F [0] default
-tree W_F [0] NO
-usetree R_F [0]
-tree_mode S [0] nj
-distance_matrix_mode S [0] ktup
-distance_matrix_sim_mode S [0] idmat_sim1
-quicktree FL [0] 0
-outfile W_F [0] default
-maximise FL [1] 1
-output S [1] score_ascii html score_ascii
-len D [0] 0
-infile R_F [1] /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
-matrix S [0] default
-tg_mode D [0] 1
-profile_mode S [0] cw_profile_profile
-profile_comparison S [0] profile
-dp_mode S [0] linked_pair_wise
-ktuple D [0] 1
-ndiag D [0] 0
-diag_threshold D [0] 0
-diag_mode D [0] 0
-sim_matrix S [0] vasiliky
-transform S [0]
-extend_seq FL [0] 0
-outorder S [0] input
-inorder S [0] aligned
-seqnos S [0] off
-case S [0] keep
-cpu D [0] 0
-maxnseq D [0] 1000
-maxlen D [0] -1
-sample_dp D [0] 0
-weight S [0] default
-seq_weight S [0] no
-align FL [1] 1
-mocca FL [0] 0
-domain FL [0] 0
-start D [0] 0
-len D [0] 0
-scale D [0] 0
-mocca_interactive FL [0] 0
-method_evaluate_mode S [0] default
-evaluate_mode S [1] t_coffee_fast
-get_type FL [0] 0
-clean_aln D [0] 0
-clean_threshold D [1] 1
-clean_iteration D [1] 1
-clean_evaluate_mode S [0] t_coffee_fast
-extend_matrix FL [0] 0
-prot_min_sim D [40] 40
-prot_max_sim D [90] 90
-prot_min_cov D [40] 40
-pdb_type S [0] d
-pdb_min_sim D [35] 35
-pdb_max_sim D [100] 100
-pdb_min_cov D [50] 50
-pdb_blast_server W_F [0] EBI
-blast W_F [0]
-blast_server W_F [0] EBI
-pdb_db W_F [0] pdb
-protein_db W_F [0] uniprot
-method_log W_F [0] no
-struc_to_use S [0]
-cache W_F [0] use
-align_pdb_param_file W_F [0] no
-align_pdb_hasch_mode W_F [0] hasch_ca_trace_bubble
-external_aligner S [0] NO
-msa_mode S [0] tree
-master S [0] no
-blast_nseq D [0] 0
-lalign_n_top D [0] 10
-iterate D [1] 0
-trim D [0] 0
-split D [0] 0
-trimfile S [0] default
-split D [0] 0
-split_nseq_thres D [0] 0
-split_score_thres D [0] 0
-check_pdb_status D [0] 0
-clean_seq_name D [0] 0
-seq_to_keep S [0]
-dpa_master_aln S [0]
-dpa_maxnseq D [0] 0
-dpa_min_score1 D [0]
-dpa_min_score2 D [0]
-dpa_keep_tmpfile FL [0] 0
-dpa_debug D [0] 0
-multi_core S [0] templates_jobs_relax_msa_evaluate
-n_core D [0] 0
-max_n_proc D [0] 0
-lib_list S [0]
-prune_lib_mode S [0] 5
-tip S [0] none
-rna_lib S [0]
-no_warning D [0] 0
-run_local_script D [0] 0
-plugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.alnugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
ugins S [0] default
-proxy S [0] unset
-email S [0]
-clean_overaln D [0] 0
-overaln_param S [0]
-overaln_mode S [0]
-overaln_model S [0]
-overaln_threshold D [0] 0
-overaln_target D [0] 0
-overaln_P1 D [0] 0
-overaln_P2 D [0] 0
-overaln_P3 D [0] 0
-overaln_P4 D [0] 0
-exon_boundaries S [0]
-dump S [0] no
-display D [0] 100
INPUT FILES
Input File (S) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Format clustal_aln
Input File (M) proba_pair
Identify Master Sequences [no]:
Master Sequences Identified
INPUT SEQUENCES: 11 SEQUENCES [PROTEIN]
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C1 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C10 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C11 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C2 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C3 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C4 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C5 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C6 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C7 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C8 Length 106 type PROTEIN Struct Unchecked
Input File /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln Seq C9 Length 106 type PROTEIN Struct Unchecked
Multi Core Mode: 72 processors:
--- Process Method/Library/Aln S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
--- Process Method/Library/Aln Mproba_pair
xxx Retrieved S/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln
xxx Retrieved Mproba_pair
All Methods Retrieved
MANUAL PENALTIES: gapopen=0 gapext=0
Library Total Size: [11760]
Library Relaxation: Multi_proc [72]
Relaxation Summary: [11760]--->[11760]
UN-WEIGHTED MODE: EVERY SEQUENCE WEIGHTS 1
OUTPUT RESULTS
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
#### File Type= MSA Format= html Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.html
#### File Type= MSA Format= score_ascii Name= input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.score_ascii
# Command Line: t_coffee_ADOPS -infile /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/tcoffee/input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln -output score_ascii -special_mode evaluate -evaluate_mode t_coffee_fast [PROGRAM:T-COFFEE]
# T-COFFEE Memory Usage: Current= 29.551 Mb, Max= 30.838 Mb
# Results Produced with T-COFFEE Version_10.00.r1613 (2013-10-22 15:49:04 - Revision 1613 - Build 427)
# T-COFFEE is available from http://www.tcoffee.org
# Register on: https://groups.google.com/group/tcoffee/
>C1
MMKLMLVVGSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C2
MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C3
MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C4
MMKLMLVVSSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C5
MMKLMLVVSSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C6
MMKLMLVVGSMALILALASARPQNDAVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPQ
GDHLPK-
>C7
MMKLMLVVGSMALLLALASARPQND-VEILESESENIGIGGYKFSYKLSD
GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYSINFVADENGFQPE
GAHLPKo
>C8
MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGLGGYKFSYKLSD
GTTRSEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C9
MMKLMLVVGSMALLFALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C10
MMKLMLVVGSMALLLALASARPQND-VEVLEYDSENIGIGGYKFSYKLSD
GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C11
MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGIGGYKFSYKLSD
GTSRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPKo
FORMAT of file /tmp/tmp6390663214465541138aln Not Supported[FATAL:T-COFFEE]
>C1
MMKLMLVVGSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C2
MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C3
MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C4
MMKLMLVVSSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C5
MMKLMLVVSSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C6
MMKLMLVVGSMALILALASARPQNDAVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPQ
GDHLPK-
>C7
MMKLMLVVGSMALLLALASARPQND-VEILESESENIGIGGYKFSYKLSD
GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYSINFVADENGFQPE
GAHLPKo
>C8
MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGLGGYKFSYKLSD
GTTRSEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C9
MMKLMLVVGSMALLFALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C10
MMKLMLVVGSMALLLALASARPQND-VEVLEYDSENIGIGGYKFSYKLSD
GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPKo
>C11
MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGIGGYKFSYKLSD
GTSRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPKo
input.fasta.prot.fasta.clustalw2_rs_0_0.fasta.aln I:107 S:99 BS:107
# TC_SIMILARITY_MATRIX_FORMAT_01
# SEQ_INDEX C1 0
# SEQ_INDEX C2 1
# SEQ_INDEX C3 2
# SEQ_INDEX C4 3
# SEQ_INDEX C5 4
# SEQ_INDEX C6 5
# SEQ_INDEX C7 6
# SEQ_INDEX C8 7
# SEQ_INDEX C9 8
# SEQ_INDEX C10 9
# SEQ_INDEX C11 10
# PW_SEQ_DISTANCES
BOT 0 1 98.11 C1 C2 98.11
TOP 1 0 98.11 C2 C1 98.11
BOT 0 2 98.11 C1 C3 98.11
TOP 2 0 98.11 C3 C1 98.11
BOT 0 3 97.17 C1 C4 97.17
TOP 3 0 97.17 C4 C1 97.17
BOT 0 4 99.06 C1 C5 99.06
TOP 4 0 99.06 C5 C1 99.06
BOT 0 5 93.33 C1 C6 93.33
TOP 5 0 93.33 C6 C1 93.33
BOT 0 6 91.51 C1 C7 91.51
TOP 6 0 91.51 C7 C1 91.51
BOT 0 7 93.40 C1 C8 93.40
TOP 7 0 93.40 C8 C1 93.40
BOT 0 8 97.17 C1 C9 97.17
TOP 8 0 97.17 C9 C1 97.17
BOT 0 9 93.40 C1 C10 93.40
TOP 9 0 93.40 C10 C1 93.40
BOT 0 10 95.28 C1 C11 95.28
TOP 10 0 95.28 C11 C1 95.28
BOT 1 2 100.00 C2 C3 100.00
TOP 2 1 100.00 C3 C2 100.00
BOT 1 3 99.06 C2 C4 99.06
TOP 3 1 99.06 C4 C2 99.06
BOT 1 4 97.17 C2 C5 97.17
TOP 4 1 97.17 C5 C2 97.17
BOT 1 5 93.33 C2 C6 93.33
TOP 5 1 93.33 C6 C2 93.33
BOT 1 6 91.51 C2 C7 91.51
TOP 6 1 91.51 C7 C2 91.51
BOT 1 7 93.40 C2 C8 93.40
TOP 7 1 93.40 C8 C2 93.40
BOT 1 8 97.17 C2 C9 97.17
TOP 8 1 97.17 C9 C2 97.17
BOT 1 9 93.40 C2 C10 93.40
TOP 9 1 93.40 C10 C2 93.40
BOT 1 10 95.28 C2 C11 95.28
TOP 10 1 95.28 C11 C2 95.28
BOT 2 3 99.06 C3 C4 99.06
TOP 3 2 99.06 C4 C3 99.06
BOT 2 4 97.17 C3 C5 97.17
TOP 4 2 97.17 C5 C3 97.17
BOT 2 5 93.33 C3 C6 93.33
TOP 5 2 93.33 C6 C3 93.33
BOT 2 6 91.51 C3 C7 91.51
TOP 6 2 91.51 C7 C3 91.51
BOT 2 7 93.40 C3 C8 93.40
TOP 7 2 93.40 C8 C3 93.40
BOT 2 8 97.17 C3 C9 97.17
TOP 8 2 97.17 C9 C3 97.17
BOT 2 9 93.40 C3 C10 93.40
TOP 9 2 93.40 C10 C3 93.40
BOT 2 10 95.28 C3 C11 95.28
TOP 10 2 95.28 C11 C3 95.28
BOT 3 4 98.11 C4 C5 98.11
TOP 4 3 98.11 C5 C4 98.11
BOT 3 5 92.38 C4 C6 92.38
TOP 5 3 92.38 C6 C4 92.38
BOT 3 6 90.57 C4 C7 90.57
TOP 6 3 90.57 C7 C4 90.57
BOT 3 7 92.45 C4 C8 92.45
TOP 7 3 92.45 C8 C4 92.45
BOT 3 8 96.23 C4 C9 96.23
TOP 8 3 96.23 C9 C4 96.23
BOT 3 9 92.45 C4 C10 92.45
TOP 9 3 92.45 C10 C4 92.45
BOT 3 10 94.34 C4 C11 94.34
TOP 10 3 94.34 C11 C4 94.34
BOT 4 5 92.38 C5 C6 92.38
TOP 5 4 92.38 C6 C5 92.38
BOT 4 6 90.57 C5 C7 90.57
TOP 6 4 90.57 C7 C5 90.57
BOT 4 7 92.45 C5 C8 92.45
TOP 7 4 92.45 C8 C5 92.45
BOT 4 8 96.23 C5 C9 96.23
TOP 8 4 96.23 C9 C5 96.23
BOT 4 9 92.45 C5 C10 92.45
TOP 9 4 92.45 C10 C5 92.45
BOT 4 10 94.34 C5 C11 94.34
TOP 10 4 94.34 C11 C5 94.34
BOT 5 6 90.48 C6 C7 90.48
TOP 6 5 90.48 C7 C6 90.48
BOT 5 7 94.29 C6 C8 94.29
TOP 7 5 94.29 C8 C6 94.29
BOT 5 8 94.29 C6 C9 94.29
TOP 8 5 94.29 C9 C6 94.29
BOT 5 9 92.38 C6 C10 92.38
TOP 9 5 92.38 C10 C6 92.38
BOT 5 10 94.29 C6 C11 94.29
TOP 10 5 94.29 C11 C6 94.29
BOT 6 7 94.34 C7 C8 94.34
TOP 7 6 94.34 C8 C7 94.34
BOT 6 8 92.45 C7 C9 92.45
TOP 8 6 92.45 C9 C7 92.45
BOT 6 9 96.23 C7 C10 96.23
TOP 9 6 96.23 C10 C7 96.23
BOT 6 10 96.23 C7 C11 96.23
TOP 10 6 96.23 C11 C7 96.23
BOT 7 8 94.34 C8 C9 94.34
TOP 8 7 94.34 C9 C8 94.34
BOT 7 9 96.23 C8 C10 96.23
TOP 9 7 96.23 C10 C8 96.23
BOT 7 10 96.23 C8 C11 96.23
TOP 10 7 96.23 C11 C8 96.23
BOT 8 9 94.34 C9 C10 94.34
TOP 9 8 94.34 C10 C9 94.34
BOT 8 10 96.23 C9 C11 96.23
TOP 10 8 96.23 C11 C9 96.23
BOT 9 10 98.11 C10 C11 98.11
TOP 10 9 98.11 C11 C10 98.11
AVG 0 C1 * 95.65
AVG 1 C2 * 95.84
AVG 2 C3 * 95.84
AVG 3 C4 * 95.18
AVG 4 C5 * 94.99
AVG 5 C6 * 93.05
AVG 6 C7 * 92.54
AVG 7 C8 * 94.05
AVG 8 C9 * 95.56
AVG 9 C10 * 94.24
AVG 10 C11 * 95.56
TOT TOT * 94.77
CLUSTAL W (1.83) multiple sequence alignment
C1 ATGATGAAATTGATGCTAGTCGTTGGCTCGATAGCCCTTCTCCTGGCCCT
C2 ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCGTGCTCCTGGCGCT
C3 ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCGTGCTCCTGGCGCT
C4 ATGATGAAATTGATGCTAGTCGTTAGCTCGATGGCCGTGCTCCTGGCCCT
C5 ATGATGAAATTGATGCTAGTCGTTAGCTCGATAGCCCTGCTCCTGGCGCT
C6 ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGATCCTGGCGCT
C7 ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT
C8 ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT
C9 ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTACTCTTCGCACT
C10 ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT
C11 ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT
************************.*******.*** * .** * ** **
C1 GGCCAGTGCCCGGCCGCAAAATGAT---GTGGAAGTTCTTGAGTACGAAT
C2 GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT
C3 GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT
C4 GGCCAGTGCCCGTCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT
C5 GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT
C6 GGCCAGTGCCCGGCCCCAAAACGATGCTGTCGAGGTTCTGGAATACGAAT
C7 GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAAATTCTGGAGTCCGAGT
C8 GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTCCTGGAGTACGAAT
C9 GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAAGTTCTGGAGTACGAAT
C10 GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTATTGGAGTACGACT
C11 GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTGCTGGAGTACGAGT
************ ** ***** *** ** **..* * **.*.*** *
C1 CGGAGAACACCGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT
C2 CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT
C3 CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT
C4 CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAATTAAGCGAT
C5 CGGAGAACACTGGCCTCGGTGGCTACAAGTTCAGCTACAAATTAAGCGAT
C6 CGGAGAACACCGGCCTAGGCGGCTACAAGTTCAGCTATAAACTAAGCGAT
C7 CCGAAAACATCGGCATCGGTGGCTACAAGTTCAGCTACAAACTGAGCGAT
C8 CGGAGAACATCGGCCTCGGTGGCTACAAGTTCAGCTATAAATTGAGCGAC
C9 CGGAGAACACTGGCCTTGGCGGCTATAAGTTCAGCTATAAATTAAGCGAT
C10 CGGAGAACATTGGCATCGGCGGCTACAAGTTCAGCTATAAACTGAGTGAC
C11 CGGAGAACATTGGCATCGGAGGCTACAAGTTCAGCTACAAACTGAGTGAC
* **.**** ***.* ** ***** *********** *** *.** **
C1 GGCACCAGTCGAACAGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA
C2 GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAATGCGGGCACCGACAA
C3 GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAATGCGGGCACCGATAA
C4 GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA
C5 GGCACCAGTCGCACCGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA
C6 GGCACTTCCCGCACGGAGGAGGGCACAGTGAACAATGCGGGCACCGAAAA
C7 GGCACCACCCGCACGGAGGAGGGCGTGGTCAACAACGCGGGCACCGAAAA
C8 GGCACCACCCGCTCGGAGGAGGGCACGGTTAACAACGCGGGCACCGAAAA
C9 GGCACTAGCCGTACAGAGGAGGGCGTGGTCAACAACGCTGGCACCGATAA
C10 GGCACCACTCGCACGGAGGAGGGCGTGGTTAACAACGCGGGCACCGAGAA
C11 GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAACGCAGGCACCGAGAA
***** : ** :* *********. .** ***** ** ******** **
C1 CGAATCCATATCCATTCGGGGATCCGTCACCTGGGTGGCTCCCGATGGCC
C2 CGAATCCATATCCATTCGGGGGTCCGTCACCTGGGTGGCTCCCGATGGCC
C3 CGAATCCATATCCATTCGGGGATCCGTCACCTGGGTGGCTCCCGATGGCC
C4 CGAATCCATATCCATCCGCGGATCCGTCACCTGGGTGGCTCCCGATGGTC
C5 CGAATCTATATCCATCCGGGGATCTGTCACCTGGGTGGCTCCCGATGGCC
C6 CGAATCGATATCCATTCGAGGATCCGTCAGTTGGGTGGCTCCCGACGGAC
C7 TGAATCGATATCCATCCGGGGATCCGTCAGTTGGGTGGCTCCCGACGGCC
C8 CGAATCGATATCCATCCGGGGATCCGTCAGTTGGGTGGCTCCCGATGGCC
C9 CGAATCGATATCCATCCGTGGATCCGTCAGTTGGGTGGCACCCGATGGCC
C10 CGAATCGATATCCATCCGAGGCTCCGTCAGCTGGGTGGCTCCCGATGGCC
C11 CGAATCGATATCCATCCGAGGATCCGTCAGCTGGGTGGCTCCCGATGGCC
***** ******** ** ** ** **** ********:***** ** *
C1 AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
C2 AAACTTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
C3 AAACTTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
C4 AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
C5 AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
C6 AGACCTACACCATTAACTTCGTGGCCGACGAGAACGGTTTCCAGCCGCAG
C7 AGACCTACTCCATTAACTTTGTGGCCGACGAGAATGGCTTCCAGCCGGAG
C8 AGACCTACACCATTAACTTTGTGGCCGACGAGAATGGTTTCCAGCCAGAG
C9 AAACATATACCATTAACTTTGTGGCCGACGAGAACGGTTTCCAGCCAGAG
C10 AGACCTACACCATCAACTTTGTGGCCGACGAGAACGGTTTCCAGCCGGAG
C11 AGACCTACACCATTAACTTTGTGGCCGACGAGAACGGCTTCCAGCCGGAG
*.** ** :**** ***** ************** ** ** *****. **
C1 GGTGCCCATCTGCCCAAG---
C2 GGCGCCCATCTGCCCAAG---
C3 GGCGCCCATCTGCCCAAG---
C4 GGCGCCCATCTGCCCAAG---
C5 GGCGCCCATCTGCCAAAG---
C6 GGCGACCATCTGCCCAAG---
C7 GGCGCCCACCTGCCCAAG---
C8 GGCGCCCACCTGCCCAAG---
C9 GGCGCACATCTGCCCAAG---
C10 GGTGCCCATCTGCCCAAG---
C11 GGTGCCCATCTGCCCAAG---
** *..** *****.***
>C1
ATGATGAAATTGATGCTAGTCGTTGGCTCGATAGCCCTTCTCCTGGCCCT
GGCCAGTGCCCGGCCGCAAAATGAT---GTGGAAGTTCTTGAGTACGAAT
CGGAGAACACCGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT
GGCACCAGTCGAACAGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA
CGAATCCATATCCATTCGGGGATCCGTCACCTGGGTGGCTCCCGATGGCC
AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
GGTGCCCATCTGCCCAAG---
>C2
ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCGTGCTCCTGGCGCT
GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT
CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT
GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAATGCGGGCACCGACAA
CGAATCCATATCCATTCGGGGGTCCGTCACCTGGGTGGCTCCCGATGGCC
AAACTTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
GGCGCCCATCTGCCCAAG---
>C3
ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCGTGCTCCTGGCGCT
GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT
CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT
GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAATGCGGGCACCGATAA
CGAATCCATATCCATTCGGGGATCCGTCACCTGGGTGGCTCCCGATGGCC
AAACTTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
GGCGCCCATCTGCCCAAG---
>C4
ATGATGAAATTGATGCTAGTCGTTAGCTCGATGGCCGTGCTCCTGGCCCT
GGCCAGTGCCCGTCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT
CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAATTAAGCGAT
GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA
CGAATCCATATCCATCCGCGGATCCGTCACCTGGGTGGCTCCCGATGGTC
AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
GGCGCCCATCTGCCCAAG---
>C5
ATGATGAAATTGATGCTAGTCGTTAGCTCGATAGCCCTGCTCCTGGCGCT
GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT
CGGAGAACACTGGCCTCGGTGGCTACAAGTTCAGCTACAAATTAAGCGAT
GGCACCAGTCGCACCGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA
CGAATCTATATCCATCCGGGGATCTGTCACCTGGGTGGCTCCCGATGGCC
AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG
GGCGCCCATCTGCCAAAG---
>C6
ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGATCCTGGCGCT
GGCCAGTGCCCGGCCCCAAAACGATGCTGTCGAGGTTCTGGAATACGAAT
CGGAGAACACCGGCCTAGGCGGCTACAAGTTCAGCTATAAACTAAGCGAT
GGCACTTCCCGCACGGAGGAGGGCACAGTGAACAATGCGGGCACCGAAAA
CGAATCGATATCCATTCGAGGATCCGTCAGTTGGGTGGCTCCCGACGGAC
AGACCTACACCATTAACTTCGTGGCCGACGAGAACGGTTTCCAGCCGCAG
GGCGACCATCTGCCCAAG---
>C7
ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT
GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAAATTCTGGAGTCCGAGT
CCGAAAACATCGGCATCGGTGGCTACAAGTTCAGCTACAAACTGAGCGAT
GGCACCACCCGCACGGAGGAGGGCGTGGTCAACAACGCGGGCACCGAAAA
TGAATCGATATCCATCCGGGGATCCGTCAGTTGGGTGGCTCCCGACGGCC
AGACCTACTCCATTAACTTTGTGGCCGACGAGAATGGCTTCCAGCCGGAG
GGCGCCCACCTGCCCAAG---
>C8
ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT
GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTCCTGGAGTACGAAT
CGGAGAACATCGGCCTCGGTGGCTACAAGTTCAGCTATAAATTGAGCGAC
GGCACCACCCGCTCGGAGGAGGGCACGGTTAACAACGCGGGCACCGAAAA
CGAATCGATATCCATCCGGGGATCCGTCAGTTGGGTGGCTCCCGATGGCC
AGACCTACACCATTAACTTTGTGGCCGACGAGAATGGTTTCCAGCCAGAG
GGCGCCCACCTGCCCAAG---
>C9
ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTACTCTTCGCACT
GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAAGTTCTGGAGTACGAAT
CGGAGAACACTGGCCTTGGCGGCTATAAGTTCAGCTATAAATTAAGCGAT
GGCACTAGCCGTACAGAGGAGGGCGTGGTCAACAACGCTGGCACCGATAA
CGAATCGATATCCATCCGTGGATCCGTCAGTTGGGTGGCACCCGATGGCC
AAACATATACCATTAACTTTGTGGCCGACGAGAACGGTTTCCAGCCAGAG
GGCGCACATCTGCCCAAG---
>C10
ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT
GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTATTGGAGTACGACT
CGGAGAACATTGGCATCGGCGGCTACAAGTTCAGCTATAAACTGAGTGAC
GGCACCACTCGCACGGAGGAGGGCGTGGTTAACAACGCGGGCACCGAGAA
CGAATCGATATCCATCCGAGGCTCCGTCAGCTGGGTGGCTCCCGATGGCC
AGACCTACACCATCAACTTTGTGGCCGACGAGAACGGTTTCCAGCCGGAG
GGTGCCCATCTGCCCAAG---
>C11
ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT
GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTGCTGGAGTACGAGT
CGGAGAACATTGGCATCGGAGGCTACAAGTTCAGCTACAAACTGAGTGAC
GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAACGCAGGCACCGAGAA
CGAATCGATATCCATCCGAGGATCCGTCAGCTGGGTGGCTCCCGATGGCC
AGACCTACACCATTAACTTTGTGGCCGACGAGAACGGCTTCCAGCCGGAG
GGTGCCCATCTGCCCAAG---
>C1
MMKLMLVVGSIALLLALASARPQNDoVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPK
>C2
MMKLMLVVGSMAVLLALASARPQNDoVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPK
>C3
MMKLMLVVGSMAVLLALASARPQNDoVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPK
>C4
MMKLMLVVSSMAVLLALASARPQNDoVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPK
>C5
MMKLMLVVSSIALLLALASARPQNDoVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
GAHLPK
>C6
MMKLMLVVGSMALILALASARPQNDAVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPQ
GDHLPK
>C7
MMKLMLVVGSMALLLALASARPQNDoVEILESESENIGIGGYKFSYKLSD
GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYSINFVADENGFQPE
GAHLPK
>C8
MMKLMLVVGSMALLLALASARPQNDoVEVLEYESENIGLGGYKFSYKLSD
GTTRSEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPK
>C9
MMKLMLVVGSMALLFALASARPQNDoVEVLEYESENTGLGGYKFSYKLSD
GTSRTEEGVVNNAGTDNESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPK
>C10
MMKLMLVVGSMALLLALASARPQNDoVEVLEYDSENIGIGGYKFSYKLSD
GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPK
>C11
MMKLMLVVGSMALLLALASARPQNDoVEVLEYESENIGIGGYKFSYKLSD
GTSRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
GAHLPK
MrBayes v3.2.2 x64
(Bayesian Analysis of Phylogeny)
Distributed under the GNU General Public License
Type "help" or "help <command>" for information
on the commands that are available.
Type "about" for authorship and general
information about the program.
Executing file "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb"
UNIX line termination
Longest line length = 63
Parsing file
Expecting NEXUS formatted file
Reading data block
Allocated taxon set
Allocated matrix
Defining new matrix with 11 taxa and 321 characters
Missing data coded as ?
Data matrix is interleaved
Data is Dna
Gaps coded as -
Matching characters coded as .
Taxon 1 -> C1
Taxon 2 -> C2
Taxon 3 -> C3
Taxon 4 -> C4
Taxon 5 -> C5
Taxon 6 -> C6
Taxon 7 -> C7
Taxon 8 -> C8
Taxon 9 -> C9
Taxon 10 -> C10
Taxon 11 -> C11
Successfully read matrix
Setting default partition (does not divide up characters)
Setting model defaults
Seed (for generating default start values) = 1479796191
Setting output file names to "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run<i>.<p|t>"
Exiting data block
Reading mrbayes block
Setting autoclose to yes
Setting nowarnings to yes
Defining charset called first_pos
Defining charset called second_pos
Defining charset called third_pos
Defining partition called by_codon
Setting by_codon as the partition, dividing characters into 3 parts.
Setting model defaults
Seed (for generating default start values) = 290459627
Setting Nst to 6 for partition 1
Setting Nst to 6 for partition 2
Setting Nst to 6 for partition 3
Setting Rates to Invgamma for partition 1
Setting Rates to Invgamma for partition 2
Setting Rates to Invgamma for partition 3
Successfully set likelihood model parameters to all
applicable data partitions
Unlinking
Setting number of generations to 1000000
Running Markov chain
MCMC stamp = 4862698291
Seed = 1666713098
Swapseed = 1479796191
Model settings:
Settings for partition 1 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 2 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Settings for partition 3 --
Datatype = DNA
Nucmodel = 4by4
Nst = 6
Substitution rates, expressed as proportions
of the rate sum, have a Dirichlet prior
(1.00,1.00,1.00,1.00,1.00,1.00)
Covarion = No
# States = 4
State frequencies have a Dirichlet prior
(1.00,1.00,1.00,1.00)
Rates = Invgamma
Gamma shape parameter is exponentially
distributed with parameter (2.00).
Proportion of invariable sites is uniformly dist-
ributed on the interval (0.00,1.00).
Gamma distribution is approximated using 4 categories.
Likelihood summarized over all rate categories in each generation.
Active parameters:
Partition(s)
Parameters 1 2 3
------------------------
Revmat 1 1 1
Statefreq 2 2 2
Shape 3 3 4
Pinvar 5 5 5
Ratemultiplier 6 6 6
Topology 7 7 7
Brlens 8 8 8
------------------------
Parameters can be linked or unlinked across partitions using 'link' and 'unlink'
1 -- Parameter = Revmat{all}
Type = Rates of reversible rate matrix
Prior = Dirichlet(1.00,1.00,1.00,1.00,1.00,1.00)
Partitions = All
2 -- Parameter = Pi{all}
Type = Stationary state frequencies
Prior = Dirichlet
Partitions = All
3 -- Parameter = Alpha{1,2}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partitions = 1 and 2
4 -- Parameter = Alpha{3}
Type = Shape of scaled gamma distribution of site rates
Prior = Exponential(2.00)
Partition = 3
5 -- Parameter = Pinvar{all}
Type = Proportion of invariable sites
Prior = Uniform(0.00,1.00)
Partitions = All
6 -- Parameter = Ratemultiplier{all}
Type = Partition-specific rate multiplier
Prior = Fixed(1.0)
Partitions = All
7 -- Parameter = Tau{all}
Type = Topology
Prior = All topologies equally probable a priori
Partitions = All
Subparam. = V{all}
8 -- Parameter = V{all}
Type = Branch lengths
Prior = Unconstrained:Exponential(10.0)
Partitions = All
The MCMC sampler will use the following moves:
With prob. Chain will use move
1.06 % Dirichlet(Revmat{all})
1.06 % Slider(Revmat{all})
1.06 % Dirichlet(Pi{all})
1.06 % Slider(Pi{all})
2.13 % Multiplier(Alpha{1,2})
2.13 % Multiplier(Alpha{3})
2.13 % Slider(Pinvar{all})
10.64 % ExtSPR(Tau{all},V{all})
10.64 % ExtTBR(Tau{all},V{all})
10.64 % NNI(Tau{all},V{all})
10.64 % ParsSPR(Tau{all},V{all})
31.91 % Multiplier(V{all})
10.64 % Nodeslider(V{all})
4.26 % TLMultiplier(V{all})
Division 1 has 19 unique site patterns
Division 2 has 12 unique site patterns
Division 3 has 58 unique site patterns
Initializing conditional likelihoods
Using standard SSE likelihood calculator for division 1 (single-precision)
Using standard SSE likelihood calculator for division 2 (single-precision)
Using standard SSE likelihood calculator for division 3 (single-precision)
Initializing invariable-site conditional likelihoods
Initial log likelihoods and log prior probs for run 1:
Chain 1 -- -1534.631125 -- -24.640631
Chain 2 -- -1493.835102 -- -24.640631
Chain 3 -- -1529.801563 -- -24.640631
Chain 4 -- -1445.259156 -- -24.640631
Initial log likelihoods and log prior probs for run 2:
Chain 1 -- -1550.557255 -- -24.640631
Chain 2 -- -1528.710275 -- -24.640631
Chain 3 -- -1537.696746 -- -24.640631
Chain 4 -- -1538.385267 -- -24.640631
Using a relative burnin of 25.0 % for diagnostics
Chain results (1000000 generations requested):
0 -- [-1534.631] (-1493.835) (-1529.802) (-1445.259) * [-1550.557] (-1528.710) (-1537.697) (-1538.385)
500 -- (-1131.754) [-1114.215] (-1135.125) (-1144.561) * (-1142.050) (-1134.610) [-1137.228] (-1122.041) -- 0:00:00
1000 -- (-1114.961) [-1107.372] (-1114.316) (-1119.190) * (-1140.105) (-1117.277) [-1104.334] (-1106.479) -- 0:00:00
1500 -- (-1121.146) [-1083.190] (-1094.181) (-1102.903) * (-1127.203) (-1114.598) (-1100.330) [-1096.330] -- 0:00:00
2000 -- (-1103.076) (-1084.700) [-1087.647] (-1095.872) * (-1087.058) [-1074.643] (-1079.163) (-1085.594) -- 0:08:19
2500 -- (-1085.999) [-1071.841] (-1080.343) (-1095.042) * (-1081.088) [-1066.202] (-1079.794) (-1080.414) -- 0:06:39
3000 -- (-1084.613) [-1069.870] (-1067.072) (-1079.554) * (-1080.149) (-1071.149) [-1077.262] (-1070.718) -- 0:05:32
3500 -- (-1085.922) (-1064.839) [-1071.016] (-1077.077) * (-1079.471) (-1071.187) [-1069.732] (-1060.958) -- 0:04:44
4000 -- (-1075.393) (-1070.939) (-1065.020) [-1075.411] * (-1075.512) (-1082.895) [-1065.918] (-1066.767) -- 0:04:09
4500 -- (-1084.662) (-1071.631) [-1058.700] (-1065.582) * (-1080.085) (-1067.443) [-1063.171] (-1067.767) -- 0:03:41
5000 -- (-1080.129) [-1067.523] (-1064.771) (-1074.149) * [-1069.184] (-1079.883) (-1067.506) (-1063.797) -- 0:03:19
Average standard deviation of split frequencies: 0.072524
5500 -- (-1071.084) (-1063.508) [-1060.766] (-1073.672) * (-1082.615) (-1067.290) (-1063.255) [-1061.338] -- 0:06:01
6000 -- (-1063.466) (-1069.509) (-1069.248) [-1057.956] * (-1069.292) (-1074.043) (-1065.643) [-1062.585] -- 0:05:31
6500 -- (-1073.136) (-1065.267) (-1058.320) [-1070.569] * (-1066.164) (-1072.295) [-1059.097] (-1062.798) -- 0:05:05
7000 -- (-1070.003) (-1066.963) (-1065.222) [-1059.221] * (-1069.455) [-1060.127] (-1068.438) (-1071.408) -- 0:04:43
7500 -- (-1065.794) (-1075.648) (-1064.792) [-1059.816] * (-1072.824) (-1064.487) (-1070.617) [-1065.274] -- 0:04:24
8000 -- (-1086.031) (-1061.223) (-1068.731) [-1060.443] * (-1071.056) (-1067.669) [-1061.906] (-1070.155) -- 0:04:08
8500 -- (-1076.811) (-1069.500) (-1065.977) [-1055.477] * [-1059.644] (-1069.701) (-1065.216) (-1066.905) -- 0:03:53
9000 -- (-1063.707) (-1072.525) (-1061.581) [-1058.858] * [-1059.443] (-1068.202) (-1069.150) (-1067.213) -- 0:05:30
9500 -- (-1063.424) (-1074.431) [-1063.073] (-1056.364) * [-1058.436] (-1067.387) (-1068.768) (-1070.449) -- 0:05:12
10000 -- [-1053.321] (-1065.732) (-1068.627) (-1053.715) * (-1067.652) [-1068.912] (-1084.984) (-1066.545) -- 0:04:57
Average standard deviation of split frequencies: 0.083736
10500 -- (-1069.905) (-1075.840) [-1060.028] (-1062.462) * (-1064.947) (-1072.542) [-1066.512] (-1072.447) -- 0:04:42
11000 -- (-1077.138) (-1067.633) (-1074.617) [-1062.820] * (-1070.241) (-1061.549) [-1069.290] (-1072.027) -- 0:04:29
11500 -- (-1065.112) (-1065.901) (-1068.186) [-1057.034] * (-1062.877) [-1058.338] (-1065.450) (-1079.848) -- 0:04:17
12000 -- (-1068.377) [-1062.357] (-1058.350) (-1064.516) * (-1064.171) (-1070.583) [-1070.795] (-1070.154) -- 0:04:07
12500 -- (-1072.804) [-1057.501] (-1070.809) (-1065.472) * (-1068.042) (-1068.148) [-1063.271] (-1066.952) -- 0:05:16
13000 -- [-1060.491] (-1064.856) (-1061.779) (-1067.992) * [-1068.008] (-1061.885) (-1067.715) (-1064.134) -- 0:05:03
13500 -- (-1070.508) (-1069.437) (-1058.674) [-1058.411] * (-1065.202) (-1060.229) [-1062.542] (-1069.563) -- 0:04:52
14000 -- (-1070.828) [-1060.285] (-1062.025) (-1071.114) * (-1067.756) (-1057.912) [-1060.658] (-1073.693) -- 0:04:41
14500 -- (-1067.567) [-1066.520] (-1066.558) (-1061.062) * (-1069.153) [-1058.918] (-1069.543) (-1066.206) -- 0:04:31
15000 -- (-1065.916) (-1055.936) (-1069.781) [-1064.390] * (-1061.126) (-1059.291) (-1075.839) [-1067.773] -- 0:04:22
Average standard deviation of split frequencies: 0.067110
15500 -- (-1069.401) (-1066.963) [-1064.485] (-1064.644) * (-1066.324) (-1058.906) [-1064.195] (-1071.574) -- 0:04:14
16000 -- (-1064.091) [-1065.782] (-1075.077) (-1065.937) * (-1068.476) (-1061.401) (-1058.973) [-1065.208] -- 0:04:06
16500 -- (-1064.360) (-1063.449) [-1063.211] (-1065.715) * (-1060.689) (-1067.000) (-1069.860) [-1079.833] -- 0:04:58
17000 -- (-1066.010) (-1065.998) [-1064.666] (-1068.306) * [-1067.182] (-1068.243) (-1066.260) (-1073.092) -- 0:04:49
17500 -- [-1063.132] (-1063.790) (-1064.745) (-1065.056) * (-1070.735) (-1062.125) (-1065.475) [-1057.030] -- 0:04:40
18000 -- (-1073.537) [-1063.718] (-1070.337) (-1064.227) * [-1061.182] (-1063.654) (-1061.420) (-1058.757) -- 0:04:32
18500 -- (-1065.125) (-1067.343) [-1057.874] (-1073.775) * (-1064.007) (-1065.244) [-1064.616] (-1059.926) -- 0:04:25
19000 -- (-1063.427) (-1059.633) [-1056.261] (-1069.245) * [-1059.591] (-1074.358) (-1068.098) (-1059.383) -- 0:04:18
19500 -- (-1065.427) (-1065.275) [-1060.971] (-1060.566) * [-1066.815] (-1063.389) (-1074.432) (-1069.990) -- 0:04:11
20000 -- (-1062.741) [-1056.403] (-1073.649) (-1070.037) * (-1066.926) (-1073.981) [-1060.010] (-1065.738) -- 0:04:54
Average standard deviation of split frequencies: 0.066029
20500 -- (-1075.255) (-1061.487) (-1066.551) [-1063.764] * (-1064.455) (-1068.213) (-1058.320) [-1062.616] -- 0:04:46
21000 -- (-1059.173) [-1056.461] (-1065.412) (-1063.938) * [-1057.938] (-1073.473) (-1059.460) (-1067.658) -- 0:04:39
21500 -- (-1067.052) (-1063.388) [-1068.125] (-1079.267) * (-1063.170) (-1073.200) (-1066.008) [-1062.602] -- 0:04:33
22000 -- (-1067.102) (-1060.631) [-1057.661] (-1067.692) * (-1065.333) [-1064.050] (-1065.281) (-1058.965) -- 0:04:26
22500 -- (-1072.184) (-1066.627) [-1064.414] (-1067.417) * [-1062.966] (-1065.935) (-1061.548) (-1069.655) -- 0:04:20
23000 -- (-1065.954) (-1060.998) (-1069.038) [-1064.848] * (-1071.078) [-1060.592] (-1061.678) (-1059.813) -- 0:04:14
23500 -- (-1067.778) [-1061.004] (-1064.949) (-1062.898) * (-1061.459) (-1062.529) [-1060.397] (-1069.052) -- 0:04:50
24000 -- (-1061.558) (-1065.562) [-1059.880] (-1068.812) * (-1065.242) [-1062.894] (-1070.918) (-1070.869) -- 0:04:44
24500 -- (-1077.409) (-1075.812) [-1055.715] (-1062.137) * (-1077.073) (-1075.498) [-1064.007] (-1070.672) -- 0:04:38
25000 -- (-1070.050) (-1061.606) (-1068.609) [-1061.897] * [-1066.456] (-1057.831) (-1066.914) (-1075.557) -- 0:04:33
Average standard deviation of split frequencies: 0.061073
25500 -- (-1061.628) (-1061.929) (-1072.790) [-1068.319] * (-1069.958) [-1054.769] (-1070.503) (-1075.958) -- 0:04:27
26000 -- (-1068.320) (-1068.806) [-1061.593] (-1060.767) * (-1065.399) [-1064.729] (-1065.976) (-1077.291) -- 0:04:22
26500 -- (-1070.124) (-1060.463) (-1064.000) [-1061.886] * [-1056.567] (-1065.450) (-1068.682) (-1071.609) -- 0:04:17
27000 -- (-1062.781) [-1060.719] (-1055.810) (-1077.694) * (-1065.286) [-1062.140] (-1077.161) (-1063.490) -- 0:04:48
27500 -- (-1060.711) (-1070.525) [-1059.361] (-1062.188) * (-1067.073) (-1061.013) (-1060.440) [-1065.537] -- 0:04:42
28000 -- (-1069.682) (-1070.754) [-1067.167] (-1075.829) * (-1074.010) (-1064.591) [-1059.131] (-1070.603) -- 0:04:37
28500 -- (-1061.893) (-1061.822) (-1062.559) [-1068.218] * (-1054.086) [-1063.928] (-1059.402) (-1058.859) -- 0:04:32
29000 -- (-1057.633) (-1063.613) (-1064.076) [-1065.263] * (-1066.407) (-1064.192) (-1075.485) [-1064.675] -- 0:04:27
29500 -- (-1060.554) (-1065.710) [-1067.927] (-1062.693) * (-1063.198) (-1076.947) [-1073.680] (-1068.125) -- 0:04:23
30000 -- (-1066.345) (-1062.273) (-1057.398) [-1061.888] * (-1070.406) (-1062.753) [-1063.478] (-1069.987) -- 0:04:18
Average standard deviation of split frequencies: 0.051240
30500 -- (-1075.380) (-1063.612) (-1066.493) [-1061.624] * (-1066.809) [-1069.922] (-1068.071) (-1065.356) -- 0:04:46
31000 -- (-1069.191) (-1061.075) [-1062.972] (-1063.204) * (-1067.129) (-1078.932) [-1057.436] (-1069.052) -- 0:04:41
31500 -- (-1067.350) (-1078.107) [-1063.847] (-1075.652) * [-1064.582] (-1069.289) (-1064.372) (-1072.662) -- 0:04:36
32000 -- (-1069.902) (-1062.943) [-1063.671] (-1069.051) * (-1068.015) (-1064.401) [-1064.579] (-1069.813) -- 0:04:32
32500 -- [-1062.760] (-1077.467) (-1062.689) (-1071.534) * (-1071.138) (-1066.930) (-1067.473) [-1064.624] -- 0:04:27
33000 -- (-1074.114) (-1076.310) [-1061.967] (-1063.387) * (-1072.029) (-1068.712) (-1063.484) [-1061.733] -- 0:04:23
33500 -- (-1070.777) (-1070.382) (-1061.848) [-1066.674] * (-1065.621) (-1073.606) [-1067.719] (-1063.973) -- 0:04:19
34000 -- (-1078.591) (-1061.710) [-1065.899] (-1064.664) * (-1065.452) (-1081.055) [-1057.953] (-1069.534) -- 0:04:44
34500 -- (-1062.436) (-1070.093) (-1076.665) [-1061.735] * (-1066.133) (-1066.456) (-1068.888) [-1067.342] -- 0:04:39
35000 -- [-1066.832] (-1064.313) (-1059.836) (-1066.209) * [-1077.379] (-1062.404) (-1065.827) (-1064.116) -- 0:04:35
Average standard deviation of split frequencies: 0.040662
35500 -- (-1064.464) [-1058.330] (-1061.394) (-1064.630) * (-1065.077) [-1061.160] (-1069.664) (-1071.629) -- 0:04:31
36000 -- (-1073.582) (-1066.501) [-1062.813] (-1058.934) * (-1070.225) (-1067.113) (-1060.838) [-1064.352] -- 0:04:27
36500 -- (-1065.653) [-1062.883] (-1060.958) (-1054.770) * (-1066.292) (-1066.315) [-1065.615] (-1061.738) -- 0:04:23
37000 -- (-1070.857) (-1057.440) (-1070.534) [-1058.305] * (-1065.713) (-1062.963) (-1067.801) [-1065.034] -- 0:04:20
37500 -- [-1058.776] (-1070.737) (-1062.985) (-1064.242) * [-1066.584] (-1060.249) (-1069.599) (-1068.892) -- 0:04:42
38000 -- [-1067.595] (-1060.094) (-1071.536) (-1058.798) * [-1065.652] (-1076.322) (-1068.746) (-1065.346) -- 0:04:38
38500 -- (-1064.573) [-1069.997] (-1059.433) (-1064.013) * (-1075.110) [-1061.722] (-1068.472) (-1070.390) -- 0:04:34
39000 -- (-1066.801) [-1053.994] (-1062.687) (-1057.836) * (-1066.169) [-1058.274] (-1059.784) (-1064.786) -- 0:04:31
39500 -- (-1070.409) [-1062.079] (-1056.228) (-1064.146) * (-1076.864) [-1059.377] (-1066.607) (-1066.633) -- 0:04:27
40000 -- (-1074.271) (-1065.696) (-1068.504) [-1061.309] * (-1067.132) (-1066.401) (-1064.521) [-1065.950] -- 0:04:24
Average standard deviation of split frequencies: 0.034132
40500 -- (-1067.577) (-1061.855) [-1060.967] (-1068.477) * [-1069.177] (-1065.736) (-1063.572) (-1075.754) -- 0:04:20
41000 -- (-1070.583) (-1063.583) [-1067.213] (-1066.837) * [-1061.994] (-1068.932) (-1073.041) (-1067.673) -- 0:04:40
41500 -- [-1066.605] (-1063.677) (-1066.392) (-1080.001) * [-1061.375] (-1073.678) (-1059.949) (-1072.722) -- 0:04:37
42000 -- (-1078.474) [-1064.314] (-1067.622) (-1061.074) * (-1063.376) [-1070.681] (-1068.310) (-1069.129) -- 0:04:33
42500 -- (-1064.656) (-1077.679) (-1066.316) [-1066.977] * [-1064.718] (-1065.792) (-1064.073) (-1076.277) -- 0:04:30
43000 -- (-1072.499) (-1072.996) [-1071.239] (-1065.914) * [-1064.449] (-1070.605) (-1058.819) (-1061.325) -- 0:04:27
43500 -- [-1062.738] (-1061.683) (-1088.177) (-1066.542) * (-1062.797) (-1064.923) (-1062.513) [-1061.701] -- 0:04:23
44000 -- (-1066.064) (-1071.445) (-1066.010) [-1064.097] * [-1061.329] (-1059.347) (-1060.405) (-1057.779) -- 0:04:20
44500 -- (-1070.555) (-1069.254) (-1079.463) [-1065.013] * [-1060.713] (-1061.830) (-1069.012) (-1066.969) -- 0:04:39
45000 -- (-1068.107) [-1058.149] (-1066.887) (-1069.926) * (-1064.704) (-1067.223) [-1066.002] (-1065.591) -- 0:04:35
Average standard deviation of split frequencies: 0.038714
45500 -- (-1067.258) [-1067.623] (-1061.593) (-1067.644) * (-1065.348) [-1061.433] (-1065.417) (-1071.492) -- 0:04:32
46000 -- (-1063.238) (-1063.192) [-1060.968] (-1064.406) * (-1063.923) [-1068.177] (-1065.254) (-1064.530) -- 0:04:29
46500 -- [-1072.356] (-1072.856) (-1065.648) (-1066.315) * (-1058.162) (-1065.694) (-1066.961) [-1065.591] -- 0:04:26
47000 -- [-1063.670] (-1071.828) (-1059.126) (-1069.896) * [-1061.467] (-1060.402) (-1077.611) (-1058.785) -- 0:04:23
47500 -- (-1060.127) (-1076.553) (-1061.006) [-1060.778] * (-1057.890) [-1061.495] (-1058.772) (-1064.282) -- 0:04:20
48000 -- (-1067.206) (-1069.335) [-1065.095] (-1062.832) * (-1069.726) (-1059.802) (-1070.049) [-1061.217] -- 0:04:37
48500 -- [-1063.431] (-1071.619) (-1062.940) (-1066.800) * [-1073.628] (-1065.001) (-1064.833) (-1065.748) -- 0:04:34
49000 -- [-1058.760] (-1067.272) (-1064.930) (-1074.818) * [-1061.960] (-1065.517) (-1063.861) (-1067.229) -- 0:04:31
49500 -- (-1060.159) (-1064.960) [-1068.712] (-1070.029) * (-1063.750) [-1056.537] (-1065.425) (-1064.723) -- 0:04:28
50000 -- (-1071.060) (-1074.012) [-1062.764] (-1077.422) * [-1067.415] (-1072.221) (-1065.810) (-1065.543) -- 0:04:26
Average standard deviation of split frequencies: 0.041868
50500 -- [-1063.344] (-1062.284) (-1062.316) (-1088.148) * (-1065.534) (-1072.055) (-1067.053) [-1063.787] -- 0:04:23
51000 -- (-1057.601) [-1064.595] (-1072.124) (-1070.079) * (-1058.419) [-1060.750] (-1058.199) (-1080.105) -- 0:04:20
51500 -- (-1069.224) (-1065.517) [-1064.877] (-1066.349) * (-1060.501) (-1066.036) (-1056.565) [-1064.652] -- 0:04:36
52000 -- (-1063.704) (-1062.669) [-1054.854] (-1068.195) * [-1060.606] (-1064.400) (-1074.150) (-1065.342) -- 0:04:33
52500 -- [-1065.802] (-1059.767) (-1068.155) (-1064.671) * (-1062.979) (-1069.405) [-1059.629] (-1067.782) -- 0:04:30
53000 -- [-1059.527] (-1066.336) (-1069.170) (-1076.349) * (-1069.084) (-1065.739) (-1062.971) [-1063.896] -- 0:04:28
53500 -- [-1065.595] (-1063.799) (-1068.976) (-1070.488) * (-1065.007) (-1065.733) [-1063.971] (-1068.792) -- 0:04:25
54000 -- (-1064.424) [-1067.941] (-1062.570) (-1068.993) * (-1065.073) (-1068.315) (-1062.024) [-1072.034] -- 0:04:22
54500 -- [-1063.216] (-1058.594) (-1060.293) (-1069.235) * (-1062.820) (-1065.640) [-1060.073] (-1071.997) -- 0:04:20
55000 -- (-1070.865) (-1067.361) (-1071.623) [-1067.582] * [-1058.469] (-1064.999) (-1070.452) (-1071.415) -- 0:04:17
Average standard deviation of split frequencies: 0.044428
55500 -- [-1062.469] (-1069.449) (-1066.099) (-1066.780) * (-1066.912) (-1063.529) (-1065.421) [-1059.335] -- 0:04:32
56000 -- (-1076.057) [-1063.502] (-1063.791) (-1072.703) * (-1062.684) [-1065.959] (-1071.423) (-1056.870) -- 0:04:29
56500 -- (-1065.699) [-1066.178] (-1060.789) (-1065.714) * [-1060.018] (-1067.552) (-1067.378) (-1056.702) -- 0:04:27
57000 -- (-1063.169) (-1067.508) [-1055.149] (-1082.077) * (-1061.159) (-1065.651) [-1069.609] (-1066.164) -- 0:04:24
57500 -- [-1062.508] (-1079.209) (-1062.997) (-1058.369) * (-1069.272) (-1069.182) [-1067.450] (-1063.178) -- 0:04:22
58000 -- [-1066.492] (-1072.452) (-1073.675) (-1065.865) * (-1079.191) (-1069.771) [-1058.704] (-1062.494) -- 0:04:19
58500 -- (-1065.993) (-1071.654) [-1061.773] (-1066.080) * [-1064.435] (-1074.083) (-1061.005) (-1062.928) -- 0:04:17
59000 -- (-1068.361) (-1061.883) [-1063.311] (-1068.808) * (-1071.546) (-1067.202) (-1060.065) [-1063.542] -- 0:04:31
59500 -- (-1071.410) (-1066.924) (-1066.356) [-1066.316] * (-1063.497) (-1071.005) [-1059.170] (-1062.882) -- 0:04:28
60000 -- (-1068.955) (-1065.175) [-1064.864] (-1059.687) * (-1066.800) (-1070.101) [-1063.358] (-1076.429) -- 0:04:26
Average standard deviation of split frequencies: 0.036262
60500 -- (-1075.331) (-1062.662) [-1064.303] (-1074.697) * [-1062.432] (-1076.013) (-1066.594) (-1063.713) -- 0:04:23
61000 -- (-1069.048) [-1070.988] (-1069.354) (-1065.436) * [-1064.427] (-1066.442) (-1063.477) (-1058.711) -- 0:04:21
61500 -- (-1074.834) [-1060.582] (-1068.405) (-1062.246) * (-1069.175) (-1063.657) [-1063.670] (-1067.153) -- 0:04:19
62000 -- (-1070.387) (-1059.100) (-1066.204) [-1068.983] * (-1066.376) [-1061.973] (-1077.598) (-1061.353) -- 0:04:17
62500 -- [-1063.472] (-1073.928) (-1066.225) (-1062.866) * [-1060.503] (-1068.352) (-1065.299) (-1069.073) -- 0:04:30
63000 -- (-1067.408) [-1068.418] (-1060.604) (-1075.195) * (-1061.219) [-1061.670] (-1077.517) (-1063.917) -- 0:04:27
63500 -- (-1057.996) (-1059.740) [-1068.699] (-1069.028) * [-1057.934] (-1065.176) (-1064.576) (-1067.041) -- 0:04:25
64000 -- (-1063.839) [-1064.116] (-1066.016) (-1068.902) * [-1062.511] (-1065.449) (-1065.034) (-1063.241) -- 0:04:23
64500 -- (-1064.476) (-1065.362) (-1072.357) [-1062.494] * (-1070.926) [-1060.917] (-1066.534) (-1056.428) -- 0:04:21
65000 -- [-1057.574] (-1060.935) (-1067.446) (-1064.695) * [-1059.476] (-1062.406) (-1066.600) (-1065.477) -- 0:04:18
Average standard deviation of split frequencies: 0.038233
65500 -- (-1069.955) (-1061.293) (-1063.177) [-1064.838] * (-1052.269) (-1064.604) [-1069.083] (-1070.917) -- 0:04:16
66000 -- (-1060.277) (-1068.889) (-1069.131) [-1062.325] * (-1059.702) [-1062.009] (-1062.884) (-1060.518) -- 0:04:28
66500 -- [-1064.418] (-1069.267) (-1067.717) (-1067.042) * [-1059.970] (-1064.249) (-1065.860) (-1064.248) -- 0:04:26
67000 -- [-1061.522] (-1065.619) (-1070.633) (-1065.149) * (-1064.397) (-1057.500) [-1061.647] (-1076.788) -- 0:04:24
67500 -- (-1059.950) (-1065.655) [-1065.545] (-1067.853) * (-1065.553) (-1066.197) [-1063.601] (-1071.073) -- 0:04:22
68000 -- [-1066.893] (-1067.189) (-1060.709) (-1062.160) * [-1064.465] (-1068.299) (-1058.638) (-1074.691) -- 0:04:20
68500 -- [-1058.887] (-1065.753) (-1070.937) (-1068.911) * (-1068.415) (-1061.003) [-1057.789] (-1067.910) -- 0:04:18
69000 -- [-1071.678] (-1060.252) (-1067.347) (-1066.486) * (-1069.366) (-1063.527) [-1062.083] (-1060.886) -- 0:04:16
69500 -- (-1075.174) [-1067.246] (-1063.586) (-1066.235) * (-1061.520) [-1063.430] (-1072.499) (-1068.478) -- 0:04:27
70000 -- (-1064.175) (-1069.552) [-1059.232] (-1079.186) * (-1062.465) (-1068.935) [-1057.827] (-1076.023) -- 0:04:25
Average standard deviation of split frequencies: 0.034531
70500 -- (-1063.685) [-1061.872] (-1074.513) (-1061.796) * (-1066.169) [-1063.191] (-1067.937) (-1063.348) -- 0:04:23
71000 -- (-1067.662) (-1061.643) (-1072.377) [-1065.499] * [-1058.973] (-1069.900) (-1069.017) (-1071.949) -- 0:04:21
71500 -- (-1055.280) [-1058.070] (-1057.224) (-1071.700) * (-1062.930) [-1063.134] (-1061.620) (-1078.732) -- 0:04:19
72000 -- [-1055.553] (-1067.410) (-1070.125) (-1069.577) * (-1061.640) (-1070.229) (-1067.678) [-1071.743] -- 0:04:17
72500 -- (-1062.939) (-1061.995) [-1068.480] (-1073.571) * (-1065.397) [-1066.320] (-1058.663) (-1073.287) -- 0:04:15
73000 -- (-1060.779) [-1056.893] (-1063.677) (-1072.276) * (-1067.076) [-1066.274] (-1054.093) (-1071.386) -- 0:04:26
73500 -- (-1066.464) (-1059.258) (-1063.413) [-1061.514] * (-1075.206) [-1068.312] (-1056.882) (-1071.538) -- 0:04:24
74000 -- (-1071.798) (-1062.691) [-1054.448] (-1072.285) * [-1061.710] (-1072.729) (-1077.762) (-1060.782) -- 0:04:22
74500 -- (-1067.422) (-1062.605) [-1058.898] (-1071.928) * (-1074.401) (-1074.283) [-1056.205] (-1066.750) -- 0:04:20
75000 -- (-1061.754) [-1059.396] (-1072.260) (-1067.807) * (-1066.319) (-1058.459) [-1066.899] (-1060.940) -- 0:04:19
Average standard deviation of split frequencies: 0.032473
75500 -- (-1069.755) (-1065.218) [-1059.399] (-1070.209) * (-1070.954) (-1072.737) (-1068.998) [-1057.071] -- 0:04:17
76000 -- (-1064.745) (-1068.039) (-1070.715) [-1069.670] * (-1070.552) (-1062.632) (-1068.029) [-1062.784] -- 0:04:15
76500 -- (-1061.945) (-1067.911) [-1060.197] (-1064.294) * (-1067.310) [-1062.566] (-1064.604) (-1065.064) -- 0:04:25
77000 -- (-1071.455) (-1069.997) [-1066.003] (-1063.065) * (-1072.546) (-1070.913) (-1074.310) [-1063.494] -- 0:04:23
77500 -- [-1056.325] (-1076.573) (-1063.401) (-1062.145) * (-1070.010) [-1066.420] (-1070.888) (-1061.366) -- 0:04:21
78000 -- (-1060.514) [-1064.652] (-1060.176) (-1070.855) * (-1055.882) [-1063.152] (-1085.444) (-1064.271) -- 0:04:20
78500 -- (-1071.641) [-1060.308] (-1065.312) (-1073.849) * (-1063.845) (-1068.013) [-1076.692] (-1060.858) -- 0:04:18
79000 -- [-1063.562] (-1067.280) (-1065.416) (-1070.078) * (-1069.621) [-1066.499] (-1063.249) (-1063.737) -- 0:04:16
79500 -- (-1074.780) [-1064.875] (-1072.003) (-1064.941) * (-1068.049) [-1057.374] (-1068.499) (-1072.780) -- 0:04:14
80000 -- (-1065.705) [-1070.488] (-1069.108) (-1070.461) * (-1079.735) [-1067.541] (-1065.428) (-1067.099) -- 0:04:13
Average standard deviation of split frequencies: 0.027844
80500 -- [-1063.812] (-1063.173) (-1066.636) (-1067.379) * (-1068.848) (-1063.771) (-1067.384) [-1059.482] -- 0:04:22
81000 -- (-1061.667) (-1066.998) [-1065.379] (-1065.866) * (-1064.065) (-1060.771) [-1061.364] (-1069.488) -- 0:04:20
81500 -- (-1058.516) (-1068.022) (-1062.100) [-1063.705] * (-1069.657) [-1069.265] (-1057.362) (-1071.803) -- 0:04:19
82000 -- (-1059.767) (-1077.719) (-1061.175) [-1060.621] * (-1066.074) (-1060.001) [-1064.994] (-1067.185) -- 0:04:17
82500 -- (-1067.468) [-1062.553] (-1071.609) (-1059.480) * [-1068.573] (-1059.422) (-1065.672) (-1063.960) -- 0:04:15
83000 -- (-1072.083) (-1070.313) [-1061.214] (-1069.727) * (-1074.839) (-1070.013) (-1060.244) [-1058.485] -- 0:04:14
83500 -- [-1061.057] (-1060.934) (-1076.329) (-1065.009) * (-1071.378) [-1059.766] (-1057.601) (-1065.976) -- 0:04:12
84000 -- (-1071.955) (-1064.268) (-1065.209) [-1066.022] * (-1070.923) [-1058.701] (-1064.075) (-1056.122) -- 0:04:21
84500 -- [-1061.921] (-1069.943) (-1063.412) (-1062.436) * (-1071.661) (-1063.778) (-1069.356) [-1056.909] -- 0:04:20
85000 -- (-1072.999) [-1060.186] (-1070.709) (-1072.612) * (-1074.209) (-1065.130) (-1063.809) [-1065.090] -- 0:04:18
Average standard deviation of split frequencies: 0.023860
85500 -- [-1063.112] (-1062.933) (-1068.367) (-1080.786) * (-1062.847) (-1061.057) (-1075.396) [-1064.265] -- 0:04:16
86000 -- (-1072.587) (-1065.335) [-1074.003] (-1065.489) * (-1056.921) (-1056.599) (-1070.944) [-1065.945] -- 0:04:15
86500 -- (-1070.932) (-1076.851) (-1068.109) [-1056.732] * [-1066.630] (-1064.783) (-1071.139) (-1060.616) -- 0:04:13
87000 -- (-1075.259) [-1063.173] (-1065.073) (-1069.946) * (-1060.022) (-1062.607) [-1068.629] (-1061.099) -- 0:04:11
87500 -- (-1076.775) (-1070.648) (-1070.802) [-1066.221] * (-1062.648) (-1064.969) (-1066.949) [-1064.140] -- 0:04:20
88000 -- (-1062.474) (-1077.521) (-1077.906) [-1063.716] * (-1074.334) [-1056.851] (-1065.188) (-1078.770) -- 0:04:19
88500 -- [-1062.852] (-1067.317) (-1064.277) (-1064.760) * [-1063.394] (-1066.982) (-1060.097) (-1066.755) -- 0:04:17
89000 -- (-1066.947) (-1059.221) [-1067.598] (-1063.432) * (-1062.098) (-1063.979) [-1063.569] (-1076.841) -- 0:04:15
89500 -- (-1058.609) (-1073.899) [-1063.963] (-1076.908) * (-1064.732) (-1067.266) [-1053.013] (-1073.115) -- 0:04:14
90000 -- (-1063.167) (-1065.450) [-1067.418] (-1075.159) * (-1059.602) (-1072.511) [-1061.664] (-1066.318) -- 0:04:12
Average standard deviation of split frequencies: 0.017223
90500 -- [-1062.381] (-1066.637) (-1066.013) (-1075.050) * [-1065.975] (-1067.303) (-1062.301) (-1067.745) -- 0:04:11
91000 -- [-1070.105] (-1067.534) (-1068.349) (-1070.370) * (-1072.927) [-1065.867] (-1059.434) (-1067.166) -- 0:04:19
91500 -- (-1067.721) [-1069.265] (-1064.628) (-1074.776) * (-1077.368) (-1078.036) [-1061.425] (-1058.855) -- 0:04:18
92000 -- [-1064.050] (-1068.252) (-1079.629) (-1080.921) * [-1061.760] (-1064.258) (-1076.574) (-1071.548) -- 0:04:16
92500 -- (-1064.802) (-1059.389) (-1063.164) [-1070.409] * (-1065.154) (-1068.118) [-1071.172] (-1068.406) -- 0:04:15
93000 -- (-1073.357) [-1071.547] (-1066.006) (-1080.079) * (-1068.165) (-1065.747) [-1065.029] (-1068.075) -- 0:04:13
93500 -- (-1072.042) [-1061.257] (-1078.810) (-1074.090) * (-1061.122) (-1071.294) [-1067.939] (-1067.549) -- 0:04:12
94000 -- (-1069.709) (-1063.663) [-1063.487] (-1092.806) * (-1064.017) (-1074.455) [-1060.600] (-1067.571) -- 0:04:10
94500 -- (-1064.764) (-1066.279) [-1064.990] (-1086.413) * (-1061.452) (-1076.529) (-1066.738) [-1059.485] -- 0:04:18
95000 -- (-1065.083) [-1059.978] (-1062.986) (-1069.988) * (-1063.097) (-1061.056) (-1060.910) [-1067.088] -- 0:04:17
Average standard deviation of split frequencies: 0.016880
95500 -- [-1062.989] (-1069.511) (-1064.821) (-1064.978) * (-1057.814) (-1066.024) [-1059.713] (-1071.284) -- 0:04:15
96000 -- (-1061.792) (-1070.273) (-1066.283) [-1064.634] * (-1067.066) [-1064.302] (-1066.958) (-1069.745) -- 0:04:14
96500 -- (-1062.782) (-1062.012) (-1072.837) [-1061.516] * (-1064.797) (-1060.947) [-1065.421] (-1076.212) -- 0:04:12
97000 -- (-1073.439) [-1062.380] (-1065.045) (-1074.301) * (-1068.388) (-1065.067) [-1070.412] (-1062.107) -- 0:04:11
97500 -- (-1067.468) [-1066.610] (-1069.855) (-1064.683) * (-1067.125) (-1069.087) [-1067.095] (-1068.796) -- 0:04:09
98000 -- (-1062.023) [-1066.087] (-1064.089) (-1062.286) * (-1069.806) (-1068.946) (-1070.090) [-1063.432] -- 0:04:17
98500 -- [-1057.703] (-1064.255) (-1068.236) (-1057.734) * (-1072.831) (-1070.302) [-1076.517] (-1058.729) -- 0:04:16
99000 -- [-1060.320] (-1057.321) (-1064.806) (-1076.381) * [-1060.872] (-1059.538) (-1067.157) (-1064.118) -- 0:04:14
99500 -- [-1067.108] (-1071.861) (-1062.479) (-1062.584) * (-1063.979) [-1065.942] (-1072.132) (-1066.084) -- 0:04:13
100000 -- (-1068.037) [-1057.179] (-1068.434) (-1076.625) * (-1067.457) (-1074.178) (-1062.952) [-1062.313] -- 0:04:11
Average standard deviation of split frequencies: 0.021073
100500 -- (-1065.222) [-1058.565] (-1058.737) (-1079.018) * [-1066.951] (-1071.159) (-1064.827) (-1064.248) -- 0:04:10
101000 -- (-1062.174) (-1055.373) [-1059.990] (-1062.579) * [-1063.283] (-1069.529) (-1074.908) (-1071.805) -- 0:04:09
101500 -- (-1062.593) [-1066.570] (-1062.754) (-1066.294) * [-1066.800] (-1063.565) (-1069.873) (-1065.318) -- 0:04:16
102000 -- (-1060.624) (-1062.393) (-1058.082) [-1059.963] * [-1057.363] (-1076.971) (-1066.564) (-1061.240) -- 0:04:15
102500 -- (-1077.614) (-1062.185) (-1067.204) [-1063.000] * [-1054.541] (-1077.296) (-1068.013) (-1062.683) -- 0:04:13
103000 -- (-1071.460) (-1085.589) (-1059.724) [-1061.338] * [-1057.404] (-1058.883) (-1068.069) (-1076.651) -- 0:04:12
103500 -- (-1075.444) (-1066.241) (-1063.322) [-1063.736] * (-1061.671) [-1061.236] (-1065.653) (-1069.908) -- 0:04:11
104000 -- (-1064.910) (-1061.410) (-1070.395) [-1064.995] * [-1061.951] (-1070.592) (-1068.570) (-1062.493) -- 0:04:09
104500 -- (-1060.061) (-1064.893) (-1061.717) [-1057.903] * [-1069.644] (-1068.570) (-1064.486) (-1065.496) -- 0:04:08
105000 -- (-1064.370) (-1082.144) (-1070.374) [-1059.114] * (-1065.870) (-1065.738) (-1072.281) [-1061.687] -- 0:04:15
Average standard deviation of split frequencies: 0.019358
105500 -- (-1062.322) (-1065.993) (-1066.654) [-1056.657] * (-1060.056) (-1072.516) [-1062.167] (-1063.908) -- 0:04:14
106000 -- (-1074.830) (-1071.160) (-1066.728) [-1061.998] * (-1060.475) [-1070.010] (-1064.898) (-1069.684) -- 0:04:13
106500 -- (-1067.131) (-1071.595) [-1067.875] (-1067.636) * (-1059.325) [-1061.405] (-1061.668) (-1068.617) -- 0:04:11
107000 -- (-1063.363) (-1062.793) [-1067.289] (-1062.834) * (-1067.497) [-1069.579] (-1059.864) (-1065.206) -- 0:04:10
107500 -- (-1074.913) (-1063.858) [-1064.210] (-1066.057) * (-1067.426) (-1069.603) [-1070.334] (-1059.267) -- 0:04:09
108000 -- (-1059.731) (-1060.659) (-1067.983) [-1055.825] * (-1067.495) (-1072.752) (-1058.981) [-1067.034] -- 0:04:07
108500 -- [-1063.270] (-1062.938) (-1064.460) (-1069.341) * (-1065.083) (-1070.079) (-1065.661) [-1067.107] -- 0:04:14
109000 -- (-1068.922) [-1071.124] (-1072.382) (-1069.329) * (-1056.885) (-1067.538) (-1068.246) [-1068.966] -- 0:04:13
109500 -- (-1063.805) (-1061.881) (-1068.594) [-1064.199] * (-1061.542) (-1065.376) (-1064.078) [-1059.354] -- 0:04:12
110000 -- (-1062.480) (-1066.098) (-1071.507) [-1066.300] * [-1059.509] (-1067.266) (-1058.339) (-1065.265) -- 0:04:10
Average standard deviation of split frequencies: 0.023804
110500 -- (-1065.409) (-1062.390) [-1063.658] (-1067.684) * [-1061.278] (-1065.630) (-1066.681) (-1077.284) -- 0:04:09
111000 -- (-1075.983) (-1069.567) [-1070.178] (-1061.174) * (-1061.980) (-1061.446) [-1063.910] (-1063.708) -- 0:04:08
111500 -- (-1065.767) (-1059.669) (-1081.394) [-1059.099] * (-1064.577) (-1063.021) [-1060.469] (-1070.289) -- 0:04:07
112000 -- (-1066.868) (-1063.366) [-1058.869] (-1067.694) * (-1058.073) [-1065.584] (-1069.024) (-1059.819) -- 0:04:13
112500 -- (-1062.638) (-1065.661) [-1060.364] (-1065.497) * (-1070.387) (-1057.695) [-1063.311] (-1069.670) -- 0:04:12
113000 -- [-1063.444] (-1069.003) (-1067.780) (-1064.918) * (-1061.353) [-1074.664] (-1063.267) (-1072.395) -- 0:04:11
113500 -- [-1068.995] (-1063.310) (-1067.208) (-1071.848) * (-1059.328) (-1071.945) (-1060.068) [-1068.208] -- 0:04:09
114000 -- (-1070.286) [-1059.646] (-1057.810) (-1058.729) * (-1076.795) (-1080.162) [-1061.820] (-1073.807) -- 0:04:08
114500 -- (-1077.162) (-1074.620) (-1063.994) [-1063.644] * (-1064.251) (-1076.946) [-1059.548] (-1072.557) -- 0:04:07
115000 -- (-1068.030) [-1058.890] (-1060.560) (-1072.093) * [-1071.727] (-1061.929) (-1065.259) (-1069.775) -- 0:04:06
Average standard deviation of split frequencies: 0.026415
115500 -- [-1069.960] (-1073.192) (-1065.520) (-1060.985) * [-1061.885] (-1063.420) (-1068.046) (-1063.098) -- 0:04:05
116000 -- (-1062.817) (-1064.144) [-1059.772] (-1065.297) * (-1060.101) (-1070.758) [-1064.254] (-1059.619) -- 0:04:11
116500 -- (-1063.026) (-1072.624) [-1064.133] (-1064.518) * [-1059.585] (-1074.450) (-1073.204) (-1057.044) -- 0:04:10
117000 -- (-1079.416) (-1068.524) [-1066.782] (-1066.723) * (-1064.858) (-1079.976) [-1061.886] (-1059.431) -- 0:04:09
117500 -- [-1061.172] (-1073.037) (-1068.716) (-1063.728) * (-1065.045) (-1075.496) [-1061.995] (-1062.952) -- 0:04:07
118000 -- (-1072.055) (-1063.619) (-1067.757) [-1065.721] * [-1063.616] (-1073.380) (-1069.054) (-1067.590) -- 0:04:06
118500 -- (-1065.924) (-1061.289) (-1066.063) [-1065.649] * (-1067.488) (-1066.914) (-1071.480) [-1066.538] -- 0:04:05
119000 -- [-1066.563] (-1063.340) (-1076.861) (-1063.631) * (-1064.284) [-1069.221] (-1071.026) (-1083.358) -- 0:04:04
119500 -- (-1058.428) [-1063.228] (-1072.245) (-1061.872) * (-1063.518) [-1056.080] (-1065.471) (-1065.445) -- 0:04:10
120000 -- (-1069.336) [-1062.436] (-1072.707) (-1063.881) * [-1062.625] (-1065.732) (-1067.310) (-1073.161) -- 0:04:09
Average standard deviation of split frequencies: 0.021921
120500 -- [-1062.072] (-1074.429) (-1068.655) (-1058.311) * (-1059.845) (-1077.625) (-1070.267) [-1071.862] -- 0:04:08
121000 -- (-1065.791) (-1061.757) (-1069.289) [-1063.418] * [-1060.854] (-1067.433) (-1074.027) (-1068.294) -- 0:04:06
121500 -- (-1066.706) (-1059.555) (-1065.745) [-1064.712] * (-1074.628) (-1059.132) [-1063.375] (-1066.149) -- 0:04:05
122000 -- (-1064.281) [-1064.508] (-1072.961) (-1086.983) * (-1075.017) [-1060.810] (-1063.438) (-1067.704) -- 0:04:04
122500 -- (-1067.921) [-1066.688] (-1066.996) (-1070.286) * (-1070.389) (-1063.902) [-1065.932] (-1057.238) -- 0:04:03
123000 -- (-1073.970) (-1067.779) [-1059.065] (-1068.739) * (-1068.881) (-1065.259) (-1065.458) [-1055.322] -- 0:04:09
123500 -- (-1068.513) (-1064.688) [-1068.318] (-1072.378) * [-1061.407] (-1061.449) (-1066.014) (-1062.650) -- 0:04:08
124000 -- (-1065.859) [-1063.204] (-1071.116) (-1079.481) * (-1065.713) (-1061.170) (-1068.929) [-1070.704] -- 0:04:07
124500 -- (-1069.993) [-1059.689] (-1062.301) (-1068.141) * [-1068.843] (-1064.130) (-1064.966) (-1073.443) -- 0:04:06
125000 -- (-1070.551) (-1064.887) (-1067.724) [-1066.741] * [-1057.352] (-1062.705) (-1072.932) (-1070.720) -- 0:04:04
Average standard deviation of split frequencies: 0.022656
125500 -- [-1061.808] (-1058.463) (-1057.361) (-1064.466) * (-1067.658) (-1069.687) (-1066.443) [-1062.665] -- 0:04:03
126000 -- (-1068.112) (-1064.681) [-1058.564] (-1059.234) * (-1065.984) [-1061.259] (-1073.960) (-1065.175) -- 0:04:02
126500 -- (-1072.839) (-1074.444) (-1057.811) [-1066.016] * (-1070.743) (-1065.214) [-1064.611] (-1068.393) -- 0:04:08
127000 -- [-1067.275] (-1061.496) (-1059.376) (-1066.388) * [-1061.638] (-1068.373) (-1065.103) (-1072.292) -- 0:04:07
127500 -- (-1056.353) (-1070.256) (-1063.966) [-1065.239] * (-1063.331) (-1058.827) (-1064.261) [-1070.196] -- 0:04:06
128000 -- (-1061.562) (-1065.778) [-1060.541] (-1057.908) * (-1075.529) (-1064.311) (-1062.363) [-1067.008] -- 0:04:05
128500 -- [-1061.635] (-1058.108) (-1065.877) (-1064.763) * (-1076.829) (-1059.353) [-1065.826] (-1072.046) -- 0:04:04
129000 -- [-1061.756] (-1067.367) (-1059.514) (-1062.042) * [-1061.596] (-1066.556) (-1056.190) (-1084.886) -- 0:04:03
129500 -- (-1061.135) (-1069.700) [-1064.060] (-1062.123) * [-1065.605] (-1066.539) (-1068.064) (-1062.695) -- 0:04:01
130000 -- [-1061.343] (-1060.981) (-1061.478) (-1069.995) * (-1063.130) (-1068.428) [-1064.291] (-1075.853) -- 0:04:07
Average standard deviation of split frequencies: 0.021434
130500 -- (-1069.247) [-1062.684] (-1064.003) (-1063.024) * (-1059.940) [-1062.063] (-1062.144) (-1062.141) -- 0:04:06
131000 -- (-1068.978) [-1060.735] (-1063.881) (-1068.300) * (-1056.200) (-1061.361) (-1068.673) [-1063.619] -- 0:04:05
131500 -- (-1071.756) (-1065.283) [-1058.376] (-1073.383) * (-1067.296) (-1067.043) [-1064.757] (-1069.534) -- 0:04:04
132000 -- [-1064.899] (-1074.204) (-1062.165) (-1069.360) * (-1072.557) (-1061.330) (-1065.514) [-1062.412] -- 0:04:03
132500 -- (-1057.458) (-1069.534) [-1070.025] (-1063.731) * (-1069.489) (-1071.012) [-1061.673] (-1063.909) -- 0:04:02
133000 -- (-1060.789) [-1067.009] (-1066.567) (-1072.125) * (-1068.990) [-1059.982] (-1064.928) (-1073.672) -- 0:04:01
133500 -- [-1056.167] (-1059.112) (-1065.941) (-1072.511) * [-1057.617] (-1065.831) (-1066.849) (-1066.477) -- 0:04:06
134000 -- [-1059.773] (-1064.713) (-1066.962) (-1066.222) * (-1064.214) [-1056.870] (-1064.051) (-1066.983) -- 0:04:05
134500 -- [-1062.710] (-1068.974) (-1072.643) (-1063.411) * (-1064.481) (-1065.341) (-1062.265) [-1064.883] -- 0:04:04
135000 -- (-1065.945) [-1067.117] (-1070.611) (-1069.227) * (-1061.165) [-1059.602] (-1065.081) (-1064.661) -- 0:04:03
Average standard deviation of split frequencies: 0.024456
135500 -- (-1063.700) (-1065.457) [-1063.832] (-1066.994) * (-1069.679) (-1062.684) [-1062.796] (-1065.171) -- 0:04:02
136000 -- (-1067.222) [-1058.746] (-1075.696) (-1075.356) * (-1074.245) (-1064.644) (-1078.135) [-1054.960] -- 0:04:01
136500 -- (-1068.455) [-1057.411] (-1070.504) (-1067.587) * [-1062.411] (-1062.145) (-1071.717) (-1068.384) -- 0:04:00
137000 -- (-1072.170) (-1057.600) (-1072.113) [-1063.708] * (-1071.370) [-1058.257] (-1066.931) (-1061.761) -- 0:03:59
137500 -- [-1060.080] (-1061.774) (-1064.906) (-1065.872) * (-1069.394) (-1062.950) (-1062.603) [-1074.940] -- 0:04:04
138000 -- (-1056.387) (-1069.455) (-1074.117) [-1065.717] * (-1069.610) [-1063.184] (-1061.847) (-1065.904) -- 0:04:03
138500 -- [-1058.514] (-1063.808) (-1077.165) (-1068.589) * [-1056.512] (-1065.931) (-1070.696) (-1070.452) -- 0:04:02
139000 -- [-1064.402] (-1063.187) (-1072.209) (-1070.188) * (-1062.370) (-1058.364) [-1066.784] (-1068.214) -- 0:04:01
139500 -- (-1075.215) [-1067.229] (-1064.238) (-1073.480) * (-1062.796) [-1065.417] (-1074.903) (-1071.312) -- 0:04:00
140000 -- [-1066.954] (-1068.859) (-1065.684) (-1068.571) * (-1067.980) (-1061.234) (-1060.311) [-1064.877] -- 0:03:59
Average standard deviation of split frequencies: 0.025506
140500 -- (-1067.552) (-1063.523) [-1061.456] (-1066.306) * (-1066.074) (-1076.209) [-1063.677] (-1076.124) -- 0:03:58
141000 -- (-1057.909) [-1069.492] (-1063.437) (-1069.517) * (-1079.941) (-1069.137) [-1058.253] (-1073.410) -- 0:04:03
141500 -- (-1075.815) (-1076.061) (-1061.252) [-1063.835] * (-1077.120) [-1066.659] (-1063.869) (-1067.590) -- 0:04:02
142000 -- [-1065.148] (-1061.449) (-1068.776) (-1059.695) * (-1069.692) (-1068.878) [-1059.438] (-1062.405) -- 0:04:01
142500 -- (-1067.147) (-1060.062) [-1057.909] (-1064.528) * [-1059.559] (-1064.471) (-1064.680) (-1070.995) -- 0:04:00
143000 -- [-1072.845] (-1064.169) (-1065.556) (-1075.872) * (-1061.841) (-1064.866) (-1071.837) [-1063.212] -- 0:03:59
143500 -- (-1071.833) [-1056.803] (-1068.821) (-1063.095) * (-1060.506) (-1076.184) [-1057.697] (-1065.785) -- 0:03:58
144000 -- (-1066.997) [-1059.699] (-1071.969) (-1056.595) * [-1062.950] (-1059.365) (-1066.049) (-1070.864) -- 0:03:57
144500 -- [-1061.428] (-1069.953) (-1072.279) (-1067.668) * (-1061.285) (-1065.267) [-1061.777] (-1064.910) -- 0:04:02
145000 -- (-1057.194) [-1064.044] (-1066.332) (-1060.433) * (-1061.233) (-1063.758) (-1063.495) [-1059.782] -- 0:04:01
Average standard deviation of split frequencies: 0.024933
145500 -- [-1062.742] (-1062.199) (-1059.140) (-1073.441) * (-1064.424) (-1064.386) [-1063.852] (-1059.703) -- 0:04:00
146000 -- (-1065.539) (-1065.570) (-1060.670) [-1059.597] * (-1078.058) [-1066.066] (-1069.106) (-1067.923) -- 0:03:59
146500 -- (-1062.208) (-1070.863) [-1063.889] (-1068.748) * (-1069.486) (-1064.149) [-1060.352] (-1078.756) -- 0:03:58
147000 -- (-1062.044) [-1055.471] (-1076.165) (-1075.216) * (-1069.990) [-1065.739] (-1067.406) (-1065.094) -- 0:03:57
147500 -- (-1065.909) (-1063.885) [-1059.761] (-1070.356) * (-1070.888) [-1058.842] (-1068.750) (-1066.541) -- 0:03:56
148000 -- (-1068.003) (-1080.081) [-1066.299] (-1064.272) * (-1062.732) [-1062.100] (-1073.397) (-1068.254) -- 0:04:01
148500 -- (-1064.002) (-1071.689) (-1061.733) [-1069.042] * (-1078.605) (-1066.835) [-1072.223] (-1057.265) -- 0:04:00
149000 -- (-1074.030) (-1069.418) (-1071.546) [-1062.631] * (-1072.329) [-1060.959] (-1063.339) (-1073.082) -- 0:03:59
149500 -- [-1064.534] (-1064.152) (-1068.618) (-1069.011) * [-1059.645] (-1060.826) (-1065.256) (-1085.643) -- 0:03:58
150000 -- [-1058.621] (-1064.017) (-1059.586) (-1069.870) * (-1058.290) (-1064.850) [-1068.850] (-1074.014) -- 0:03:57
Average standard deviation of split frequencies: 0.025030
150500 -- (-1062.221) (-1065.303) [-1058.827] (-1068.221) * (-1059.292) (-1062.264) [-1060.375] (-1064.672) -- 0:03:57
151000 -- [-1064.727] (-1064.910) (-1067.976) (-1059.989) * (-1068.636) (-1072.841) (-1058.907) [-1058.922] -- 0:03:56
151500 -- (-1065.384) [-1063.305] (-1068.306) (-1065.154) * [-1055.857] (-1068.656) (-1066.015) (-1070.158) -- 0:04:00
152000 -- (-1071.339) (-1056.723) [-1068.258] (-1063.047) * (-1064.366) (-1067.977) [-1063.440] (-1069.161) -- 0:03:59
152500 -- [-1062.874] (-1058.014) (-1072.085) (-1070.624) * (-1064.802) [-1066.273] (-1061.681) (-1067.143) -- 0:03:58
153000 -- [-1060.207] (-1062.560) (-1061.130) (-1069.701) * (-1069.459) (-1068.070) [-1068.606] (-1078.623) -- 0:03:58
153500 -- [-1057.450] (-1063.077) (-1067.061) (-1062.432) * (-1068.106) (-1061.147) (-1070.035) [-1058.804] -- 0:03:57
154000 -- (-1068.809) (-1055.284) [-1057.987] (-1078.504) * (-1059.272) (-1061.805) [-1071.313] (-1062.339) -- 0:03:56
154500 -- (-1064.342) [-1060.052] (-1071.437) (-1066.092) * (-1064.692) (-1064.403) (-1068.604) [-1061.137] -- 0:03:55
155000 -- (-1073.688) [-1062.526] (-1075.427) (-1061.405) * [-1066.318] (-1063.115) (-1082.901) (-1066.718) -- 0:03:59
Average standard deviation of split frequencies: 0.024510
155500 -- (-1069.699) [-1058.544] (-1071.280) (-1067.785) * (-1060.049) (-1065.746) (-1071.263) [-1061.699] -- 0:03:58
156000 -- (-1067.651) (-1072.982) (-1070.535) [-1059.053] * (-1061.521) (-1071.732) (-1065.169) [-1064.612] -- 0:03:58
156500 -- [-1068.113] (-1077.669) (-1063.337) (-1068.083) * [-1062.753] (-1068.517) (-1074.396) (-1062.860) -- 0:03:57
157000 -- (-1065.518) (-1079.387) [-1069.655] (-1065.633) * (-1056.838) [-1064.774] (-1077.697) (-1067.396) -- 0:03:56
157500 -- (-1060.422) [-1063.369] (-1068.950) (-1061.446) * (-1072.582) (-1065.704) (-1067.976) [-1061.361] -- 0:03:55
158000 -- (-1064.897) [-1061.544] (-1061.059) (-1058.913) * (-1063.530) (-1061.639) (-1067.662) [-1066.734] -- 0:03:54
158500 -- (-1065.833) (-1069.364) (-1079.149) [-1062.974] * (-1062.567) (-1067.965) (-1063.480) [-1062.893] -- 0:03:58
159000 -- (-1067.657) (-1070.472) (-1070.615) [-1065.499] * (-1068.879) (-1074.972) (-1064.748) [-1062.364] -- 0:03:58
159500 -- (-1074.007) (-1063.975) (-1075.260) [-1062.152] * (-1061.887) (-1063.593) (-1078.827) [-1073.113] -- 0:03:57
160000 -- (-1084.056) (-1068.354) (-1068.747) [-1057.060] * (-1064.110) [-1058.565] (-1070.619) (-1061.758) -- 0:03:56
Average standard deviation of split frequencies: 0.021747
160500 -- (-1071.122) (-1068.247) [-1061.697] (-1065.019) * (-1064.138) (-1063.736) [-1060.557] (-1067.614) -- 0:03:55
161000 -- (-1066.802) [-1064.216] (-1059.011) (-1067.547) * (-1074.304) [-1070.403] (-1070.051) (-1056.382) -- 0:03:54
161500 -- (-1065.693) [-1057.059] (-1068.497) (-1062.812) * (-1068.703) (-1066.764) [-1066.165] (-1071.373) -- 0:03:53
162000 -- (-1075.498) (-1069.696) [-1064.632] (-1074.756) * [-1064.871] (-1064.530) (-1065.014) (-1066.739) -- 0:03:52
162500 -- (-1067.796) [-1078.671] (-1070.132) (-1064.694) * (-1064.348) (-1072.074) [-1070.580] (-1073.697) -- 0:03:57
163000 -- (-1070.817) (-1068.096) [-1071.848] (-1066.391) * (-1065.144) (-1067.026) (-1062.357) [-1065.238] -- 0:03:56
163500 -- (-1071.659) (-1068.084) [-1060.806] (-1060.755) * (-1069.272) (-1066.689) [-1061.955] (-1065.207) -- 0:03:55
164000 -- (-1064.112) [-1064.703] (-1068.828) (-1068.612) * (-1071.492) (-1057.264) [-1060.149] (-1071.581) -- 0:03:54
164500 -- (-1069.835) (-1066.838) (-1059.559) [-1064.558] * (-1069.295) (-1067.732) [-1061.197] (-1059.899) -- 0:03:53
165000 -- (-1062.641) (-1070.593) [-1066.696] (-1066.001) * (-1070.267) [-1068.565] (-1073.476) (-1063.632) -- 0:03:52
Average standard deviation of split frequencies: 0.020352
165500 -- (-1058.661) (-1075.981) (-1069.268) [-1071.585] * (-1069.748) (-1065.306) (-1072.228) [-1068.457] -- 0:03:51
166000 -- [-1059.681] (-1065.329) (-1071.825) (-1070.387) * [-1066.898] (-1070.819) (-1061.429) (-1065.382) -- 0:03:56
166500 -- (-1067.177) (-1068.455) [-1058.797] (-1068.026) * (-1061.086) (-1065.751) [-1061.247] (-1077.121) -- 0:03:55
167000 -- (-1073.020) [-1067.100] (-1071.803) (-1069.643) * (-1072.417) (-1069.554) [-1063.032] (-1079.959) -- 0:03:54
167500 -- [-1059.773] (-1076.194) (-1066.417) (-1070.571) * [-1059.995] (-1072.397) (-1068.565) (-1077.013) -- 0:03:53
168000 -- (-1065.445) (-1081.833) [-1062.792] (-1067.868) * (-1063.845) (-1066.350) (-1067.888) [-1061.388] -- 0:03:52
168500 -- [-1067.741] (-1065.099) (-1060.463) (-1065.727) * [-1065.106] (-1065.278) (-1068.948) (-1063.420) -- 0:03:51
169000 -- (-1065.397) (-1072.358) (-1075.390) [-1061.502] * (-1076.650) (-1066.535) [-1058.716] (-1062.528) -- 0:03:51
169500 -- (-1061.525) (-1069.695) [-1066.748] (-1065.200) * (-1067.367) (-1067.102) [-1061.635] (-1059.297) -- 0:03:55
170000 -- [-1062.301] (-1069.612) (-1070.697) (-1070.388) * (-1066.027) (-1063.800) [-1064.054] (-1056.603) -- 0:03:54
Average standard deviation of split frequencies: 0.017385
170500 -- (-1060.299) [-1065.512] (-1073.019) (-1062.344) * [-1063.884] (-1067.778) (-1066.141) (-1065.138) -- 0:03:53
171000 -- (-1070.838) [-1066.269] (-1066.698) (-1064.149) * (-1067.095) [-1060.808] (-1070.594) (-1074.520) -- 0:03:52
171500 -- (-1064.892) (-1067.242) (-1062.842) [-1060.569] * [-1064.085] (-1076.576) (-1065.548) (-1062.931) -- 0:03:51
172000 -- [-1067.737] (-1069.311) (-1070.512) (-1064.344) * (-1065.375) (-1075.896) (-1064.621) [-1066.118] -- 0:03:51
172500 -- (-1066.324) (-1074.298) [-1065.742] (-1072.193) * (-1068.902) (-1069.080) (-1067.928) [-1057.806] -- 0:03:50
173000 -- (-1068.089) [-1067.924] (-1066.145) (-1066.667) * (-1063.248) (-1083.721) [-1066.946] (-1066.258) -- 0:03:54
173500 -- (-1066.422) (-1060.809) [-1062.311] (-1058.068) * [-1061.064] (-1070.916) (-1061.161) (-1077.429) -- 0:03:53
174000 -- (-1061.330) (-1075.099) [-1058.145] (-1073.498) * [-1062.300] (-1068.885) (-1064.871) (-1068.249) -- 0:03:52
174500 -- [-1063.939] (-1066.946) (-1064.931) (-1069.797) * [-1055.653] (-1071.658) (-1064.492) (-1072.280) -- 0:03:51
175000 -- (-1056.789) (-1063.278) [-1072.153] (-1066.448) * (-1060.729) (-1067.358) (-1072.179) [-1060.529] -- 0:03:50
Average standard deviation of split frequencies: 0.018434
175500 -- (-1061.489) (-1070.807) [-1069.581] (-1067.813) * (-1061.809) (-1068.081) (-1070.171) [-1059.287] -- 0:03:50
176000 -- [-1065.435] (-1061.849) (-1073.318) (-1074.308) * (-1075.108) (-1067.392) [-1058.855] (-1065.937) -- 0:03:49
176500 -- (-1072.296) [-1061.629] (-1078.007) (-1063.740) * [-1060.495] (-1064.946) (-1065.074) (-1073.063) -- 0:03:53
177000 -- (-1068.152) [-1059.602] (-1080.036) (-1073.964) * (-1061.473) (-1066.011) [-1060.352] (-1068.096) -- 0:03:52
177500 -- (-1066.255) (-1062.951) [-1062.995] (-1061.428) * (-1069.617) (-1064.809) (-1067.510) [-1063.846] -- 0:03:51
178000 -- (-1067.019) (-1064.051) [-1070.071] (-1063.096) * (-1068.842) [-1061.422] (-1074.710) (-1063.421) -- 0:03:50
178500 -- (-1070.489) (-1071.558) (-1064.454) [-1068.474] * [-1064.757] (-1067.867) (-1062.724) (-1060.001) -- 0:03:50
179000 -- [-1064.352] (-1056.096) (-1070.768) (-1067.133) * (-1060.625) [-1065.671] (-1064.330) (-1065.153) -- 0:03:49
179500 -- (-1076.744) (-1067.807) (-1067.197) [-1058.489] * (-1068.441) (-1062.455) [-1068.483] (-1064.982) -- 0:03:48
180000 -- (-1077.994) (-1067.224) (-1057.374) [-1056.470] * (-1060.421) (-1067.126) [-1070.709] (-1067.195) -- 0:03:52
Average standard deviation of split frequencies: 0.018265
180500 -- (-1064.830) (-1078.386) (-1068.044) [-1057.806] * [-1062.307] (-1071.125) (-1073.030) (-1065.156) -- 0:03:51
181000 -- (-1069.368) (-1065.458) [-1071.223] (-1064.962) * (-1057.882) [-1061.252] (-1063.520) (-1064.499) -- 0:03:50
181500 -- (-1066.440) [-1066.033] (-1066.357) (-1062.338) * [-1063.717] (-1069.206) (-1074.824) (-1071.603) -- 0:03:49
182000 -- [-1062.124] (-1071.398) (-1062.561) (-1066.195) * (-1066.109) (-1059.127) [-1063.657] (-1063.095) -- 0:03:49
182500 -- (-1068.530) (-1069.233) [-1061.327] (-1067.236) * (-1060.859) (-1061.513) [-1065.720] (-1065.798) -- 0:03:48
183000 -- (-1058.692) (-1067.738) (-1063.694) [-1057.592] * (-1058.445) (-1069.148) [-1064.032] (-1066.463) -- 0:03:47
183500 -- (-1070.326) (-1063.808) (-1063.828) [-1066.995] * [-1063.531] (-1074.953) (-1063.146) (-1066.580) -- 0:03:51
184000 -- (-1075.785) [-1060.775] (-1072.428) (-1065.813) * (-1064.358) [-1057.415] (-1073.199) (-1067.213) -- 0:03:50
184500 -- (-1066.791) (-1063.503) (-1066.912) [-1066.139] * (-1071.642) [-1060.508] (-1076.266) (-1068.224) -- 0:03:49
185000 -- (-1067.235) (-1058.670) (-1059.562) [-1060.631] * (-1067.888) (-1069.224) [-1061.035] (-1075.447) -- 0:03:49
Average standard deviation of split frequencies: 0.019853
185500 -- (-1061.819) [-1057.442] (-1070.495) (-1060.775) * (-1069.106) [-1062.244] (-1064.080) (-1065.771) -- 0:03:48
186000 -- (-1077.047) [-1062.976] (-1066.486) (-1063.808) * (-1069.630) [-1059.312] (-1062.457) (-1059.622) -- 0:03:47
186500 -- (-1080.738) [-1056.367] (-1073.071) (-1064.913) * [-1064.273] (-1062.785) (-1071.232) (-1073.853) -- 0:03:46
187000 -- (-1071.957) (-1062.649) [-1057.725] (-1069.567) * (-1076.133) (-1058.950) [-1062.376] (-1065.789) -- 0:03:50
187500 -- (-1069.692) [-1062.853] (-1071.052) (-1060.207) * (-1062.392) (-1067.722) (-1063.752) [-1064.286] -- 0:03:49
188000 -- (-1073.131) (-1068.971) (-1065.193) [-1062.365] * (-1073.657) [-1064.177] (-1062.532) (-1062.567) -- 0:03:48
188500 -- (-1057.920) [-1053.408] (-1075.605) (-1066.201) * (-1071.359) (-1067.135) (-1065.909) [-1064.047] -- 0:03:48
189000 -- (-1067.015) [-1069.052] (-1058.368) (-1063.972) * (-1071.782) (-1061.089) (-1060.806) [-1065.435] -- 0:03:47
189500 -- (-1068.036) [-1056.961] (-1067.610) (-1070.494) * (-1063.004) (-1066.128) (-1061.210) [-1066.419] -- 0:03:46
190000 -- [-1062.676] (-1059.600) (-1063.873) (-1065.786) * (-1066.671) (-1065.877) (-1064.868) [-1058.048] -- 0:03:45
Average standard deviation of split frequencies: 0.020054
190500 -- [-1062.965] (-1060.729) (-1074.287) (-1066.200) * (-1065.916) [-1062.072] (-1064.716) (-1069.282) -- 0:03:49
191000 -- [-1059.977] (-1073.720) (-1069.219) (-1076.055) * (-1066.267) [-1054.668] (-1060.336) (-1070.705) -- 0:03:48
191500 -- (-1070.920) [-1062.549] (-1061.249) (-1063.050) * (-1071.992) (-1057.591) (-1066.586) [-1065.087] -- 0:03:47
192000 -- (-1067.730) (-1062.437) [-1057.746] (-1057.403) * (-1072.849) (-1065.379) (-1064.738) [-1063.413] -- 0:03:47
192500 -- (-1071.724) (-1061.163) [-1060.744] (-1068.654) * (-1068.372) (-1066.564) (-1068.623) [-1066.581] -- 0:03:46
193000 -- (-1072.378) (-1060.987) (-1069.214) [-1065.597] * (-1069.784) (-1064.176) (-1075.981) [-1066.456] -- 0:03:45
193500 -- (-1071.079) [-1062.430] (-1063.318) (-1067.177) * (-1070.606) (-1067.522) [-1064.386] (-1073.708) -- 0:03:45
194000 -- (-1067.251) (-1075.868) [-1060.158] (-1064.639) * (-1064.121) (-1072.464) (-1074.253) [-1057.999] -- 0:03:48
194500 -- (-1063.771) (-1063.164) (-1064.645) [-1067.159] * (-1069.419) [-1064.890] (-1065.650) (-1065.516) -- 0:03:47
195000 -- (-1060.453) (-1070.097) (-1067.150) [-1060.839] * (-1062.236) (-1071.116) (-1067.020) [-1058.112] -- 0:03:47
Average standard deviation of split frequencies: 0.017968
195500 -- (-1061.309) [-1063.300] (-1069.390) (-1068.052) * (-1058.875) (-1072.431) (-1075.302) [-1060.961] -- 0:03:46
196000 -- (-1065.157) [-1060.660] (-1080.251) (-1069.457) * [-1062.162] (-1056.948) (-1075.415) (-1065.365) -- 0:03:45
196500 -- (-1071.765) (-1061.917) [-1070.132] (-1062.107) * (-1062.148) (-1066.748) (-1071.114) [-1069.931] -- 0:03:44
197000 -- (-1061.636) [-1064.922] (-1069.995) (-1073.588) * (-1067.052) [-1061.305] (-1073.641) (-1069.301) -- 0:03:44
197500 -- (-1067.303) (-1063.802) [-1060.621] (-1072.514) * (-1066.592) [-1053.265] (-1083.830) (-1059.170) -- 0:03:47
198000 -- (-1068.036) [-1061.859] (-1075.145) (-1062.391) * (-1068.077) [-1062.583] (-1070.217) (-1066.856) -- 0:03:46
198500 -- (-1065.586) (-1066.215) (-1066.235) [-1060.791] * (-1067.708) [-1054.484] (-1074.210) (-1075.749) -- 0:03:46
199000 -- [-1063.780] (-1063.302) (-1068.018) (-1063.453) * [-1061.106] (-1065.506) (-1064.745) (-1065.138) -- 0:03:45
199500 -- [-1071.110] (-1061.653) (-1064.279) (-1064.687) * (-1059.345) (-1077.055) (-1064.762) [-1057.388] -- 0:03:44
200000 -- (-1064.570) [-1061.619] (-1068.962) (-1070.738) * (-1072.186) [-1076.519] (-1059.083) (-1060.800) -- 0:03:43
Average standard deviation of split frequencies: 0.017273
200500 -- (-1061.162) (-1061.720) (-1061.004) [-1070.966] * [-1064.580] (-1074.750) (-1065.885) (-1064.322) -- 0:03:43
201000 -- (-1059.309) (-1072.522) [-1066.917] (-1057.289) * (-1058.848) (-1067.335) (-1063.025) [-1059.730] -- 0:03:46
201500 -- (-1064.054) [-1075.844] (-1059.791) (-1066.891) * (-1067.459) [-1062.713] (-1068.216) (-1064.617) -- 0:03:45
202000 -- (-1071.313) (-1086.641) (-1071.724) [-1070.670] * [-1060.987] (-1064.957) (-1063.530) (-1064.213) -- 0:03:45
202500 -- (-1066.753) (-1064.762) [-1056.923] (-1068.175) * (-1064.877) (-1062.797) (-1073.703) [-1057.664] -- 0:03:44
203000 -- (-1060.837) [-1060.416] (-1071.388) (-1063.693) * (-1070.354) (-1065.382) [-1063.960] (-1065.160) -- 0:03:43
203500 -- (-1067.428) (-1073.413) (-1068.786) [-1064.832] * (-1075.872) [-1061.282] (-1066.667) (-1070.079) -- 0:03:43
204000 -- (-1067.667) (-1065.024) (-1064.823) [-1064.448] * (-1067.627) [-1062.738] (-1058.914) (-1063.886) -- 0:03:42
204500 -- (-1077.245) [-1060.856] (-1069.448) (-1064.697) * (-1065.680) (-1067.930) [-1062.905] (-1062.385) -- 0:03:45
205000 -- (-1069.706) (-1057.114) (-1067.121) [-1061.057] * (-1068.279) (-1063.507) [-1060.037] (-1064.173) -- 0:03:44
Average standard deviation of split frequencies: 0.015346
205500 -- (-1081.916) [-1057.166] (-1061.667) (-1060.714) * (-1059.508) (-1062.299) (-1068.631) [-1065.781] -- 0:03:44
206000 -- (-1061.085) (-1065.351) [-1058.282] (-1063.730) * (-1066.718) [-1057.243] (-1074.953) (-1067.539) -- 0:03:43
206500 -- [-1063.996] (-1063.985) (-1067.989) (-1062.840) * (-1064.974) (-1075.065) [-1063.874] (-1075.921) -- 0:03:42
207000 -- [-1055.081] (-1064.092) (-1069.024) (-1068.682) * (-1076.380) (-1065.787) [-1060.378] (-1070.237) -- 0:03:42
207500 -- (-1059.864) [-1060.566] (-1066.226) (-1064.698) * (-1063.056) [-1065.468] (-1072.798) (-1072.098) -- 0:03:41
208000 -- (-1076.073) (-1059.485) (-1065.261) [-1061.583] * (-1067.230) [-1078.728] (-1073.915) (-1061.599) -- 0:03:44
208500 -- (-1063.114) (-1068.718) [-1067.673] (-1061.080) * (-1082.722) [-1067.887] (-1061.982) (-1071.033) -- 0:03:43
209000 -- [-1063.028] (-1065.670) (-1068.635) (-1062.046) * (-1065.252) [-1063.680] (-1060.158) (-1063.404) -- 0:03:43
209500 -- (-1068.392) (-1061.769) (-1068.460) [-1058.354] * (-1069.367) [-1066.246] (-1071.890) (-1071.262) -- 0:03:42
210000 -- (-1067.366) (-1063.091) [-1062.518] (-1064.380) * (-1064.762) (-1071.512) [-1059.520] (-1065.820) -- 0:03:41
Average standard deviation of split frequencies: 0.015927
210500 -- (-1060.497) (-1065.775) [-1061.206] (-1067.905) * (-1063.051) [-1059.907] (-1063.969) (-1065.574) -- 0:03:41
211000 -- [-1067.604] (-1065.002) (-1058.586) (-1071.053) * (-1061.766) [-1060.101] (-1074.291) (-1065.009) -- 0:03:40
211500 -- [-1068.813] (-1056.026) (-1061.021) (-1067.251) * [-1066.274] (-1067.138) (-1055.929) (-1070.708) -- 0:03:43
212000 -- (-1070.009) [-1060.740] (-1067.530) (-1071.642) * [-1058.700] (-1072.357) (-1059.127) (-1071.913) -- 0:03:43
212500 -- (-1077.670) (-1072.531) (-1073.931) [-1067.415] * (-1072.521) (-1072.534) [-1064.482] (-1081.886) -- 0:03:42
213000 -- (-1070.059) [-1062.645] (-1072.984) (-1065.698) * (-1061.814) (-1070.231) [-1067.056] (-1065.741) -- 0:03:41
213500 -- (-1065.184) (-1068.243) [-1054.928] (-1068.847) * [-1062.678] (-1068.086) (-1063.280) (-1061.600) -- 0:03:41
214000 -- (-1058.120) [-1058.174] (-1057.793) (-1067.847) * (-1057.980) [-1066.913] (-1066.433) (-1059.783) -- 0:03:40
214500 -- (-1063.622) (-1057.587) [-1059.415] (-1086.164) * (-1064.729) (-1067.334) [-1064.574] (-1061.567) -- 0:03:39
215000 -- [-1063.459] (-1061.825) (-1064.666) (-1071.079) * (-1060.041) [-1062.638] (-1065.738) (-1073.144) -- 0:03:42
Average standard deviation of split frequencies: 0.017845
215500 -- [-1060.964] (-1076.339) (-1069.022) (-1068.538) * (-1060.359) (-1071.194) (-1066.967) [-1063.996] -- 0:03:42
216000 -- (-1060.505) (-1068.106) (-1064.460) [-1060.699] * (-1062.855) (-1062.465) (-1074.077) [-1062.762] -- 0:03:41
216500 -- (-1073.390) (-1073.380) [-1065.454] (-1061.289) * (-1062.853) [-1072.218] (-1058.796) (-1062.972) -- 0:03:40
217000 -- [-1059.071] (-1071.992) (-1065.113) (-1066.957) * (-1060.570) (-1064.910) [-1062.369] (-1066.018) -- 0:03:40
217500 -- [-1059.345] (-1070.628) (-1066.782) (-1069.003) * [-1061.047] (-1063.322) (-1064.909) (-1062.160) -- 0:03:39
218000 -- [-1061.190] (-1063.607) (-1071.668) (-1076.371) * (-1070.008) [-1059.418] (-1061.349) (-1072.160) -- 0:03:38
218500 -- [-1063.911] (-1058.870) (-1065.825) (-1062.267) * (-1063.155) [-1063.630] (-1069.412) (-1078.101) -- 0:03:41
219000 -- [-1058.087] (-1062.979) (-1060.469) (-1059.500) * [-1063.985] (-1059.759) (-1062.406) (-1065.647) -- 0:03:41
219500 -- (-1057.457) [-1061.386] (-1063.799) (-1054.656) * (-1068.582) (-1072.901) [-1059.122] (-1063.364) -- 0:03:40
220000 -- [-1068.588] (-1069.869) (-1063.984) (-1068.254) * (-1064.213) [-1066.043] (-1061.862) (-1071.692) -- 0:03:39
Average standard deviation of split frequencies: 0.018095
220500 -- [-1059.105] (-1062.989) (-1073.435) (-1072.345) * (-1054.159) [-1058.404] (-1076.927) (-1070.417) -- 0:03:39
221000 -- [-1065.321] (-1070.790) (-1068.303) (-1075.379) * (-1063.691) [-1062.464] (-1072.531) (-1067.732) -- 0:03:38
221500 -- [-1067.478] (-1068.682) (-1068.754) (-1062.731) * (-1063.588) (-1066.122) (-1073.516) [-1067.335] -- 0:03:37
222000 -- (-1062.967) (-1072.140) [-1057.945] (-1064.890) * (-1062.068) (-1072.101) (-1071.268) [-1061.990] -- 0:03:40
222500 -- (-1062.342) [-1067.598] (-1069.712) (-1063.311) * [-1064.382] (-1073.818) (-1063.581) (-1072.982) -- 0:03:40
223000 -- (-1062.474) [-1063.115] (-1067.372) (-1063.174) * (-1072.221) (-1068.654) (-1073.308) [-1071.178] -- 0:03:39
223500 -- [-1060.529] (-1061.384) (-1069.888) (-1075.241) * (-1058.628) [-1065.679] (-1074.759) (-1070.404) -- 0:03:38
224000 -- (-1066.809) (-1069.956) (-1071.123) [-1068.469] * [-1061.851] (-1068.054) (-1065.737) (-1065.807) -- 0:03:38
224500 -- (-1058.935) (-1063.550) (-1059.638) [-1062.283] * (-1066.017) (-1070.018) [-1069.113] (-1075.737) -- 0:03:37
225000 -- (-1063.140) [-1060.536] (-1071.327) (-1062.991) * (-1074.208) (-1063.841) [-1072.813] (-1071.192) -- 0:03:36
Average standard deviation of split frequencies: 0.016687
225500 -- [-1058.049] (-1061.414) (-1060.689) (-1067.141) * (-1063.356) (-1065.562) (-1063.755) [-1067.005] -- 0:03:39
226000 -- (-1060.263) [-1068.592] (-1063.928) (-1075.054) * (-1068.875) [-1058.268] (-1063.921) (-1076.139) -- 0:03:39
226500 -- (-1064.685) (-1076.827) [-1059.442] (-1057.800) * (-1057.823) (-1069.573) (-1065.412) [-1062.159] -- 0:03:38
227000 -- (-1059.059) [-1056.701] (-1060.572) (-1069.165) * (-1059.885) (-1067.895) [-1062.949] (-1064.618) -- 0:03:37
227500 -- [-1062.851] (-1068.689) (-1059.195) (-1073.252) * (-1060.623) (-1061.738) [-1060.539] (-1084.309) -- 0:03:37
228000 -- (-1060.180) (-1058.047) [-1058.643] (-1070.465) * (-1064.643) (-1072.403) [-1068.938] (-1068.343) -- 0:03:36
228500 -- [-1062.873] (-1070.495) (-1062.504) (-1069.457) * (-1074.184) [-1062.696] (-1068.105) (-1062.106) -- 0:03:36
229000 -- (-1064.311) (-1070.521) (-1066.886) [-1062.256] * (-1063.169) (-1071.441) [-1068.011] (-1072.540) -- 0:03:38
229500 -- (-1072.664) (-1069.965) (-1066.287) [-1061.039] * (-1068.671) (-1060.777) [-1069.573] (-1068.410) -- 0:03:38
230000 -- (-1063.198) [-1063.387] (-1072.164) (-1072.178) * (-1069.005) (-1062.352) [-1062.830] (-1065.824) -- 0:03:37
Average standard deviation of split frequencies: 0.015508
230500 -- [-1057.519] (-1058.798) (-1067.025) (-1060.531) * (-1062.205) (-1064.969) [-1064.457] (-1067.261) -- 0:03:36
231000 -- (-1062.799) (-1068.978) [-1065.382] (-1064.449) * (-1069.718) (-1062.959) (-1062.057) [-1061.730] -- 0:03:36
231500 -- (-1063.390) (-1061.480) (-1080.253) [-1066.036] * [-1065.514] (-1065.734) (-1059.905) (-1060.608) -- 0:03:35
232000 -- (-1069.870) [-1061.910] (-1063.300) (-1056.569) * (-1074.040) [-1060.345] (-1066.301) (-1068.503) -- 0:03:35
232500 -- (-1070.281) [-1058.716] (-1068.588) (-1066.855) * (-1080.887) (-1058.040) (-1079.774) [-1056.662] -- 0:03:37
233000 -- (-1059.830) [-1056.727] (-1059.445) (-1058.089) * (-1070.606) [-1066.762] (-1078.996) (-1066.086) -- 0:03:37
233500 -- (-1070.271) (-1058.275) (-1070.720) [-1068.799] * [-1066.927] (-1075.494) (-1062.256) (-1064.626) -- 0:03:36
234000 -- (-1071.847) (-1063.544) (-1065.680) [-1061.477] * (-1074.910) (-1061.750) (-1063.390) [-1063.969] -- 0:03:36
234500 -- (-1076.348) (-1071.164) [-1058.356] (-1064.067) * (-1067.372) (-1071.675) [-1063.496] (-1066.393) -- 0:03:35
235000 -- (-1066.861) (-1071.057) [-1058.070] (-1057.247) * [-1059.645] (-1069.351) (-1073.291) (-1058.594) -- 0:03:34
Average standard deviation of split frequencies: 0.014335
235500 -- (-1070.312) (-1063.003) (-1065.509) [-1062.429] * (-1079.512) [-1064.242] (-1072.155) (-1064.392) -- 0:03:34
236000 -- (-1072.586) [-1070.053] (-1067.414) (-1059.817) * (-1062.384) (-1067.003) (-1069.897) [-1058.716] -- 0:03:36
236500 -- (-1079.407) (-1072.791) [-1058.502] (-1070.161) * [-1061.169] (-1056.326) (-1078.300) (-1067.786) -- 0:03:36
237000 -- (-1063.960) (-1056.426) (-1067.265) [-1062.648] * [-1064.017] (-1063.270) (-1062.310) (-1066.367) -- 0:03:35
237500 -- (-1075.927) (-1072.986) [-1065.101] (-1062.086) * (-1061.544) [-1064.489] (-1063.354) (-1071.164) -- 0:03:35
238000 -- (-1070.653) (-1065.985) (-1064.858) [-1061.220] * [-1060.335] (-1060.136) (-1078.476) (-1069.606) -- 0:03:34
238500 -- [-1071.424] (-1068.273) (-1073.459) (-1062.758) * [-1058.815] (-1077.352) (-1064.187) (-1077.572) -- 0:03:33
239000 -- [-1072.463] (-1071.348) (-1062.835) (-1068.407) * [-1061.105] (-1067.115) (-1070.752) (-1073.033) -- 0:03:33
239500 -- (-1065.287) (-1076.726) [-1064.519] (-1072.502) * (-1066.899) (-1073.979) (-1074.222) [-1060.295] -- 0:03:35
240000 -- (-1068.869) (-1065.429) [-1054.131] (-1062.236) * (-1063.448) (-1071.735) (-1066.375) [-1061.561] -- 0:03:35
Average standard deviation of split frequencies: 0.015440
240500 -- (-1072.938) (-1060.607) (-1058.014) [-1056.018] * (-1066.863) (-1069.348) [-1061.328] (-1059.410) -- 0:03:34
241000 -- (-1069.459) (-1067.744) (-1055.477) [-1063.534] * (-1060.578) (-1061.116) (-1062.508) [-1068.953] -- 0:03:34
241500 -- (-1067.450) [-1060.087] (-1076.516) (-1061.590) * [-1059.274] (-1074.367) (-1068.998) (-1064.084) -- 0:03:33
242000 -- [-1063.249] (-1078.412) (-1061.040) (-1056.265) * [-1068.233] (-1062.383) (-1068.029) (-1068.149) -- 0:03:32
242500 -- (-1070.013) (-1070.026) (-1072.755) [-1057.773] * (-1065.206) (-1068.025) [-1058.013] (-1067.043) -- 0:03:32
243000 -- (-1062.883) [-1062.254] (-1066.197) (-1068.488) * (-1068.900) (-1070.145) (-1055.553) [-1052.369] -- 0:03:34
243500 -- (-1067.357) (-1062.593) [-1052.935] (-1069.979) * [-1068.504] (-1074.416) (-1059.251) (-1065.485) -- 0:03:34
244000 -- (-1062.956) (-1075.068) (-1067.865) [-1056.760] * (-1066.014) [-1055.157] (-1061.862) (-1069.857) -- 0:03:33
244500 -- [-1058.942] (-1060.644) (-1069.108) (-1073.001) * (-1072.748) (-1070.123) (-1063.339) [-1064.669] -- 0:03:33
245000 -- (-1063.413) (-1066.351) [-1061.689] (-1062.233) * (-1068.376) [-1063.433] (-1070.683) (-1067.123) -- 0:03:32
Average standard deviation of split frequencies: 0.014992
245500 -- (-1065.276) (-1064.766) [-1062.718] (-1069.795) * (-1071.579) [-1058.026] (-1060.860) (-1056.915) -- 0:03:32
246000 -- (-1072.777) (-1069.497) (-1062.456) [-1065.688] * (-1069.050) (-1066.991) [-1057.021] (-1073.261) -- 0:03:31
246500 -- (-1071.785) (-1061.620) [-1069.034] (-1061.959) * (-1064.269) (-1076.744) (-1070.121) [-1066.559] -- 0:03:33
247000 -- [-1061.028] (-1059.520) (-1064.729) (-1071.632) * (-1081.595) (-1062.990) [-1068.918] (-1064.079) -- 0:03:33
247500 -- (-1065.111) (-1059.906) (-1065.980) [-1061.630] * (-1068.792) [-1060.258] (-1083.348) (-1073.653) -- 0:03:32
248000 -- (-1064.237) (-1067.494) [-1061.250] (-1065.011) * [-1065.456] (-1065.818) (-1079.021) (-1068.174) -- 0:03:32
248500 -- (-1061.487) (-1074.036) (-1063.936) [-1061.685] * (-1070.936) (-1065.679) [-1065.550] (-1062.425) -- 0:03:31
249000 -- (-1069.190) [-1065.616] (-1075.606) (-1057.840) * [-1061.308] (-1070.402) (-1063.941) (-1063.617) -- 0:03:31
249500 -- [-1063.667] (-1063.646) (-1074.701) (-1062.000) * (-1072.099) (-1064.751) (-1070.120) [-1060.862] -- 0:03:30
250000 -- (-1072.565) [-1060.208] (-1065.270) (-1072.223) * (-1066.788) (-1058.754) (-1063.190) [-1065.324] -- 0:03:33
Average standard deviation of split frequencies: 0.014824
250500 -- [-1059.009] (-1067.005) (-1070.779) (-1067.348) * (-1064.500) (-1064.061) (-1069.143) [-1059.391] -- 0:03:32
251000 -- (-1069.190) (-1064.327) [-1060.676] (-1069.623) * (-1074.893) (-1069.692) [-1057.926] (-1066.676) -- 0:03:31
251500 -- (-1059.412) [-1073.267] (-1070.642) (-1062.216) * (-1065.991) (-1067.551) (-1061.010) [-1063.749] -- 0:03:31
252000 -- [-1062.221] (-1062.994) (-1058.173) (-1063.764) * [-1070.298] (-1062.929) (-1060.750) (-1069.849) -- 0:03:30
252500 -- (-1056.998) (-1059.943) [-1057.496] (-1069.384) * [-1057.797] (-1069.076) (-1062.434) (-1065.833) -- 0:03:30
253000 -- (-1066.154) [-1058.887] (-1064.298) (-1062.840) * (-1060.224) [-1069.499] (-1070.330) (-1063.035) -- 0:03:29
253500 -- (-1068.693) (-1080.894) [-1065.968] (-1068.232) * (-1072.871) [-1063.350] (-1074.702) (-1065.486) -- 0:03:32
254000 -- (-1063.807) [-1066.735] (-1064.511) (-1064.621) * (-1080.458) (-1064.431) (-1071.699) [-1067.248] -- 0:03:31
254500 -- [-1066.849] (-1072.483) (-1067.936) (-1072.591) * (-1061.468) [-1062.668] (-1062.690) (-1068.707) -- 0:03:30
255000 -- (-1080.622) (-1064.608) (-1065.080) [-1068.319] * (-1061.309) [-1067.183] (-1069.508) (-1055.378) -- 0:03:30
Average standard deviation of split frequencies: 0.014515
255500 -- (-1078.882) [-1070.823] (-1068.524) (-1058.846) * (-1070.014) [-1064.105] (-1064.406) (-1061.678) -- 0:03:29
256000 -- (-1075.205) (-1059.851) (-1069.822) [-1066.051] * [-1064.943] (-1063.511) (-1068.484) (-1064.250) -- 0:03:29
256500 -- (-1067.776) (-1071.550) (-1072.537) [-1058.813] * (-1072.501) [-1061.811] (-1057.869) (-1068.580) -- 0:03:28
257000 -- [-1064.976] (-1066.842) (-1061.335) (-1069.691) * (-1062.848) (-1071.243) (-1067.119) [-1065.823] -- 0:03:31
257500 -- (-1066.097) (-1071.505) [-1064.902] (-1065.013) * (-1060.182) (-1065.808) [-1063.883] (-1067.216) -- 0:03:30
258000 -- (-1077.640) (-1065.230) [-1057.282] (-1072.369) * [-1060.592] (-1062.415) (-1064.832) (-1074.365) -- 0:03:29
258500 -- (-1063.053) (-1074.041) [-1060.319] (-1071.338) * (-1060.051) [-1062.006] (-1068.516) (-1075.077) -- 0:03:29
259000 -- [-1058.454] (-1066.754) (-1070.964) (-1057.625) * [-1061.697] (-1059.556) (-1066.277) (-1061.375) -- 0:03:28
259500 -- (-1066.565) (-1080.666) [-1058.151] (-1074.646) * (-1057.957) (-1058.341) (-1067.643) [-1063.011] -- 0:03:28
260000 -- (-1060.616) [-1069.227] (-1070.419) (-1070.180) * [-1060.533] (-1064.586) (-1063.092) (-1058.319) -- 0:03:27
Average standard deviation of split frequencies: 0.014149
260500 -- (-1068.010) [-1065.379] (-1079.018) (-1062.676) * (-1065.360) (-1057.444) [-1061.795] (-1061.501) -- 0:03:30
261000 -- (-1064.944) (-1065.586) [-1064.875] (-1068.584) * [-1056.604] (-1057.573) (-1065.928) (-1067.490) -- 0:03:29
261500 -- [-1067.230] (-1066.129) (-1076.072) (-1054.233) * (-1070.398) (-1062.170) (-1054.651) [-1059.324] -- 0:03:28
262000 -- (-1065.115) (-1069.265) [-1077.058] (-1058.868) * (-1073.246) (-1063.160) [-1064.262] (-1065.024) -- 0:03:28
262500 -- [-1056.780] (-1080.736) (-1063.763) (-1057.337) * (-1070.305) [-1062.947] (-1072.686) (-1076.764) -- 0:03:27
263000 -- (-1066.886) (-1081.894) (-1065.370) [-1061.089] * (-1059.641) [-1060.642] (-1067.593) (-1064.578) -- 0:03:27
263500 -- (-1068.513) (-1078.619) [-1067.489] (-1068.507) * (-1062.124) (-1064.526) (-1062.868) [-1063.031] -- 0:03:26
264000 -- (-1074.660) (-1076.371) [-1060.907] (-1060.030) * (-1070.580) (-1071.517) [-1067.335] (-1063.901) -- 0:03:26
264500 -- (-1065.733) (-1057.492) [-1059.936] (-1064.237) * (-1069.956) [-1062.354] (-1064.189) (-1056.754) -- 0:03:28
265000 -- (-1067.102) (-1059.836) (-1070.173) [-1055.493] * [-1064.270] (-1065.457) (-1064.284) (-1057.977) -- 0:03:28
Average standard deviation of split frequencies: 0.012927
265500 -- (-1058.264) (-1065.216) (-1068.541) [-1053.371] * [-1067.505] (-1063.702) (-1063.228) (-1070.988) -- 0:03:27
266000 -- (-1074.192) (-1078.614) [-1067.971] (-1065.858) * (-1074.307) [-1070.761] (-1066.113) (-1060.200) -- 0:03:26
266500 -- (-1068.409) (-1071.229) (-1060.200) [-1056.977] * (-1080.025) (-1067.022) [-1061.481] (-1077.130) -- 0:03:26
267000 -- (-1061.460) [-1065.514] (-1066.412) (-1061.106) * (-1064.207) [-1061.187] (-1069.863) (-1074.071) -- 0:03:25
267500 -- [-1065.080] (-1067.525) (-1070.478) (-1075.374) * [-1067.914] (-1065.054) (-1073.133) (-1063.589) -- 0:03:25
268000 -- (-1063.428) (-1072.741) [-1056.696] (-1062.006) * (-1076.594) [-1058.893] (-1063.959) (-1073.213) -- 0:03:27
268500 -- (-1064.107) (-1059.238) (-1065.762) [-1061.769] * [-1066.754] (-1063.060) (-1062.155) (-1075.052) -- 0:03:27
269000 -- (-1064.465) [-1060.220] (-1070.693) (-1067.223) * (-1067.516) (-1067.183) [-1060.955] (-1071.954) -- 0:03:26
269500 -- (-1068.789) (-1056.854) [-1057.598] (-1061.195) * (-1059.298) [-1058.335] (-1064.744) (-1072.365) -- 0:03:26
270000 -- [-1061.053] (-1067.755) (-1069.184) (-1059.590) * (-1072.883) (-1060.929) (-1067.408) [-1062.040] -- 0:03:25
Average standard deviation of split frequencies: 0.013626
270500 -- [-1055.655] (-1064.263) (-1068.131) (-1056.446) * (-1063.011) (-1069.296) (-1073.877) [-1059.205] -- 0:03:24
271000 -- [-1061.806] (-1066.065) (-1063.616) (-1072.958) * (-1064.772) (-1069.751) (-1058.586) [-1067.063] -- 0:03:27
271500 -- (-1072.738) (-1068.704) [-1064.133] (-1059.284) * [-1063.707] (-1064.675) (-1066.041) (-1077.170) -- 0:03:26
272000 -- (-1057.416) (-1071.089) (-1065.348) [-1061.137] * (-1065.483) [-1052.275] (-1060.071) (-1069.259) -- 0:03:26
272500 -- [-1058.665] (-1071.468) (-1064.324) (-1067.602) * [-1061.449] (-1065.028) (-1066.755) (-1064.214) -- 0:03:25
273000 -- (-1062.234) (-1062.746) [-1072.022] (-1062.037) * (-1068.447) (-1075.023) [-1061.362] (-1062.824) -- 0:03:25
273500 -- (-1070.742) [-1055.722] (-1067.299) (-1072.065) * [-1059.703] (-1067.985) (-1062.271) (-1061.918) -- 0:03:24
274000 -- (-1068.278) [-1059.518] (-1066.824) (-1070.361) * [-1057.713] (-1071.320) (-1069.208) (-1065.568) -- 0:03:24
274500 -- (-1076.002) (-1064.199) (-1068.668) [-1063.846] * (-1069.362) (-1081.305) (-1073.864) [-1064.234] -- 0:03:26
275000 -- (-1060.865) (-1063.106) (-1063.514) [-1060.325] * (-1073.227) [-1063.808] (-1062.083) (-1067.293) -- 0:03:25
Average standard deviation of split frequencies: 0.013362
275500 -- (-1068.917) [-1067.431] (-1061.590) (-1064.859) * (-1070.280) [-1062.361] (-1066.148) (-1066.259) -- 0:03:25
276000 -- [-1063.345] (-1068.154) (-1064.606) (-1070.813) * [-1061.989] (-1058.108) (-1066.994) (-1064.437) -- 0:03:24
276500 -- (-1076.027) [-1063.986] (-1062.082) (-1064.088) * (-1067.905) [-1063.196] (-1062.402) (-1068.470) -- 0:03:24
277000 -- (-1059.165) (-1062.991) (-1059.040) [-1062.904] * (-1069.046) (-1065.495) (-1065.294) [-1059.322] -- 0:03:23
277500 -- (-1068.303) (-1076.721) (-1057.862) [-1067.691] * (-1065.843) [-1062.625] (-1065.443) (-1060.523) -- 0:03:23
278000 -- (-1070.996) [-1060.658] (-1063.368) (-1065.139) * (-1074.251) [-1064.123] (-1067.797) (-1064.930) -- 0:03:22
278500 -- (-1059.348) (-1067.924) [-1064.150] (-1063.837) * (-1072.703) [-1063.559] (-1073.154) (-1061.597) -- 0:03:24
279000 -- (-1055.264) (-1069.360) [-1066.624] (-1062.341) * (-1064.962) [-1064.187] (-1080.098) (-1066.933) -- 0:03:24
279500 -- (-1060.547) (-1067.734) [-1071.093] (-1054.291) * (-1063.632) [-1065.876] (-1060.755) (-1060.999) -- 0:03:23
280000 -- (-1062.878) (-1065.275) [-1074.651] (-1066.879) * [-1073.956] (-1069.009) (-1065.408) (-1064.009) -- 0:03:23
Average standard deviation of split frequencies: 0.012350
280500 -- (-1078.086) (-1059.617) [-1065.471] (-1069.744) * (-1074.107) [-1060.112] (-1067.137) (-1073.761) -- 0:03:22
281000 -- [-1056.953] (-1064.213) (-1063.903) (-1077.101) * [-1056.297] (-1063.266) (-1061.537) (-1063.319) -- 0:03:22
281500 -- (-1071.788) [-1064.279] (-1064.609) (-1062.648) * [-1056.978] (-1069.096) (-1061.431) (-1067.990) -- 0:03:21
282000 -- (-1058.136) (-1075.091) [-1059.462] (-1069.402) * (-1059.374) (-1061.681) (-1064.827) [-1057.680] -- 0:03:23
282500 -- (-1070.686) (-1063.278) (-1064.870) [-1068.420] * (-1059.549) (-1070.701) (-1066.649) [-1060.435] -- 0:03:23
283000 -- [-1061.060] (-1064.259) (-1062.114) (-1068.820) * [-1062.047] (-1077.814) (-1063.491) (-1061.478) -- 0:03:22
283500 -- (-1070.279) [-1061.627] (-1061.208) (-1068.694) * (-1068.444) [-1066.893] (-1071.404) (-1066.059) -- 0:03:22
284000 -- (-1060.709) [-1058.346] (-1071.701) (-1058.360) * (-1064.864) (-1070.648) (-1066.664) [-1065.270] -- 0:03:21
284500 -- (-1060.015) (-1059.058) [-1071.923] (-1072.948) * (-1064.103) (-1079.053) [-1061.738] (-1063.008) -- 0:03:21
285000 -- (-1068.177) [-1066.282] (-1072.983) (-1071.201) * (-1070.520) [-1063.737] (-1064.407) (-1068.771) -- 0:03:20
Average standard deviation of split frequencies: 0.012023
285500 -- (-1058.008) [-1054.144] (-1079.902) (-1056.617) * (-1070.406) [-1063.758] (-1065.785) (-1065.337) -- 0:03:22
286000 -- (-1074.288) [-1063.584] (-1071.947) (-1064.178) * (-1061.787) (-1060.048) [-1072.133] (-1075.076) -- 0:03:22
286500 -- (-1068.275) (-1070.823) (-1069.173) [-1070.769] * (-1067.693) (-1063.991) [-1060.246] (-1075.783) -- 0:03:21
287000 -- [-1066.507] (-1057.221) (-1072.064) (-1065.134) * (-1077.499) [-1061.431] (-1064.486) (-1067.280) -- 0:03:21
287500 -- (-1065.396) (-1063.047) (-1063.979) [-1062.043] * (-1067.108) [-1062.399] (-1071.702) (-1065.459) -- 0:03:20
288000 -- (-1064.992) [-1064.999] (-1061.463) (-1067.968) * (-1060.108) [-1062.683] (-1060.737) (-1069.455) -- 0:03:20
288500 -- (-1069.070) (-1065.429) [-1066.234] (-1071.456) * (-1064.795) [-1059.681] (-1065.740) (-1066.711) -- 0:03:19
289000 -- (-1063.453) (-1073.405) (-1063.874) [-1063.835] * (-1062.684) (-1063.195) (-1064.224) [-1074.108] -- 0:03:21
289500 -- [-1064.831] (-1066.945) (-1062.163) (-1069.115) * [-1068.016] (-1059.738) (-1064.619) (-1077.933) -- 0:03:21
290000 -- (-1064.128) (-1063.946) [-1069.467] (-1066.388) * (-1074.320) [-1067.491] (-1064.110) (-1074.534) -- 0:03:20
Average standard deviation of split frequencies: 0.012593
290500 -- (-1064.204) (-1060.429) [-1061.908] (-1068.598) * (-1072.177) (-1061.425) [-1057.171] (-1070.273) -- 0:03:20
291000 -- (-1059.893) (-1067.562) [-1061.562] (-1069.857) * (-1074.399) [-1061.913] (-1059.968) (-1071.594) -- 0:03:19
291500 -- (-1067.097) [-1059.442] (-1070.536) (-1063.911) * [-1063.801] (-1062.382) (-1061.896) (-1069.441) -- 0:03:19
292000 -- (-1069.022) (-1065.503) [-1063.521] (-1070.932) * [-1055.493] (-1063.173) (-1065.516) (-1071.687) -- 0:03:18
292500 -- [-1071.465] (-1066.172) (-1065.485) (-1065.705) * (-1060.476) (-1075.084) (-1068.332) [-1064.495] -- 0:03:20
293000 -- (-1063.073) (-1060.159) [-1057.729] (-1076.739) * [-1061.713] (-1065.757) (-1064.272) (-1077.330) -- 0:03:20
293500 -- (-1075.790) (-1062.691) (-1059.557) [-1061.945] * (-1070.198) (-1060.362) (-1066.275) [-1071.840] -- 0:03:19
294000 -- (-1071.676) (-1066.344) (-1067.076) [-1068.777] * (-1056.985) (-1076.434) (-1070.946) [-1059.015] -- 0:03:19
294500 -- (-1071.607) (-1065.050) (-1064.112) [-1064.733] * (-1064.184) [-1069.925] (-1059.883) (-1071.446) -- 0:03:18
295000 -- (-1070.941) [-1057.968] (-1069.344) (-1069.514) * (-1066.874) (-1068.272) [-1055.177] (-1077.648) -- 0:03:18
Average standard deviation of split frequencies: 0.014521
295500 -- (-1076.208) [-1057.588] (-1068.176) (-1059.561) * (-1072.504) (-1084.976) [-1066.837] (-1071.820) -- 0:03:17
296000 -- (-1061.988) [-1062.360] (-1063.489) (-1070.311) * (-1075.463) (-1065.478) (-1060.930) [-1066.175] -- 0:03:19
296500 -- (-1064.541) (-1079.307) (-1067.759) [-1056.730] * (-1065.145) (-1069.024) (-1064.545) [-1062.024] -- 0:03:19
297000 -- [-1059.134] (-1069.675) (-1065.717) (-1065.266) * (-1061.285) (-1063.713) (-1065.718) [-1067.026] -- 0:03:18
297500 -- [-1057.182] (-1062.137) (-1066.617) (-1063.135) * (-1065.064) [-1064.814] (-1066.940) (-1073.484) -- 0:03:18
298000 -- [-1062.800] (-1066.483) (-1067.699) (-1067.111) * (-1067.426) [-1066.000] (-1069.146) (-1076.177) -- 0:03:17
298500 -- (-1059.740) [-1071.286] (-1073.810) (-1062.564) * (-1073.757) (-1072.784) [-1062.550] (-1060.539) -- 0:03:17
299000 -- (-1067.118) [-1059.779] (-1077.629) (-1073.547) * (-1062.267) (-1076.535) (-1083.346) [-1060.178] -- 0:03:16
299500 -- (-1067.153) (-1063.104) (-1062.877) [-1074.456] * (-1070.156) (-1064.526) (-1076.147) [-1061.605] -- 0:03:18
300000 -- (-1074.820) (-1064.114) [-1068.229] (-1064.997) * (-1065.907) (-1069.624) (-1080.041) [-1062.278] -- 0:03:18
Average standard deviation of split frequencies: 0.013189
300500 -- (-1069.846) (-1064.522) (-1074.126) [-1069.026] * (-1071.586) (-1067.278) [-1062.952] (-1063.194) -- 0:03:17
301000 -- (-1065.440) (-1058.564) [-1062.861] (-1070.380) * (-1064.822) (-1060.817) (-1066.298) [-1065.263] -- 0:03:17
301500 -- (-1065.875) [-1076.211] (-1072.489) (-1068.387) * (-1070.799) (-1056.460) [-1059.715] (-1072.025) -- 0:03:16
302000 -- (-1066.456) [-1062.805] (-1067.436) (-1064.519) * (-1065.230) (-1069.151) (-1075.325) [-1057.573] -- 0:03:16
302500 -- [-1060.245] (-1071.647) (-1061.606) (-1063.015) * (-1065.988) (-1058.333) (-1071.087) [-1064.720] -- 0:03:15
303000 -- (-1057.164) [-1058.498] (-1074.542) (-1064.437) * (-1058.818) [-1061.258] (-1071.778) (-1065.776) -- 0:03:17
303500 -- (-1071.472) [-1069.681] (-1078.934) (-1073.095) * (-1078.274) [-1062.716] (-1069.354) (-1069.093) -- 0:03:17
304000 -- (-1063.938) [-1057.376] (-1070.805) (-1062.309) * [-1068.977] (-1074.225) (-1066.220) (-1059.064) -- 0:03:16
304500 -- (-1063.010) (-1060.836) [-1060.891] (-1068.307) * [-1055.645] (-1063.875) (-1063.231) (-1063.375) -- 0:03:16
305000 -- (-1067.324) (-1067.004) [-1062.790] (-1065.952) * (-1068.511) (-1067.735) [-1061.484] (-1060.947) -- 0:03:15
Average standard deviation of split frequencies: 0.013321
305500 -- (-1064.903) (-1065.487) [-1059.556] (-1059.501) * [-1058.507] (-1064.355) (-1070.854) (-1071.645) -- 0:03:15
306000 -- (-1068.823) (-1058.113) (-1076.130) [-1056.653] * (-1061.610) [-1066.902] (-1062.914) (-1066.529) -- 0:03:15
306500 -- (-1067.695) [-1055.579] (-1072.297) (-1063.134) * [-1063.597] (-1068.404) (-1062.542) (-1065.635) -- 0:03:16
307000 -- [-1063.887] (-1066.187) (-1062.654) (-1069.990) * (-1072.573) (-1092.654) (-1060.511) [-1060.058] -- 0:03:16
307500 -- (-1061.531) [-1058.216] (-1068.222) (-1072.117) * [-1057.230] (-1065.839) (-1068.317) (-1068.713) -- 0:03:15
308000 -- (-1072.540) (-1061.702) [-1070.475] (-1061.842) * (-1062.273) (-1067.095) (-1061.286) [-1066.697] -- 0:03:15
308500 -- (-1072.778) [-1066.723] (-1063.678) (-1074.259) * [-1061.690] (-1077.037) (-1067.886) (-1064.132) -- 0:03:15
309000 -- (-1069.608) (-1064.812) [-1056.833] (-1067.836) * (-1068.697) (-1061.610) (-1062.515) [-1062.075] -- 0:03:14
309500 -- [-1066.191] (-1064.077) (-1071.978) (-1069.268) * (-1062.897) (-1059.058) [-1073.322] (-1064.636) -- 0:03:14
310000 -- [-1065.289] (-1068.014) (-1063.237) (-1064.870) * [-1068.480] (-1073.503) (-1062.782) (-1063.974) -- 0:03:13
Average standard deviation of split frequencies: 0.013746
310500 -- (-1066.698) (-1070.592) [-1070.906] (-1064.716) * [-1067.614] (-1060.418) (-1072.164) (-1066.672) -- 0:03:15
311000 -- [-1062.029] (-1061.399) (-1060.156) (-1068.690) * (-1070.863) (-1061.168) (-1070.551) [-1063.759] -- 0:03:14
311500 -- [-1071.252] (-1063.910) (-1059.887) (-1070.070) * (-1068.046) [-1067.226] (-1069.885) (-1066.677) -- 0:03:14
312000 -- [-1054.136] (-1067.294) (-1067.560) (-1071.580) * (-1070.507) [-1059.410] (-1069.272) (-1070.506) -- 0:03:14
312500 -- (-1065.469) (-1061.249) [-1061.905] (-1068.344) * (-1064.063) (-1068.860) [-1067.507] (-1069.506) -- 0:03:13
313000 -- [-1061.985] (-1066.783) (-1063.925) (-1061.033) * [-1070.674] (-1078.195) (-1071.756) (-1062.874) -- 0:03:13
313500 -- (-1066.688) (-1066.513) [-1058.105] (-1070.076) * [-1055.139] (-1064.583) (-1066.525) (-1064.675) -- 0:03:12
314000 -- (-1065.056) (-1067.435) (-1058.164) [-1071.514] * (-1060.523) [-1062.498] (-1074.315) (-1070.258) -- 0:03:14
314500 -- (-1061.987) (-1068.887) (-1064.762) [-1061.170] * [-1059.399] (-1072.789) (-1064.558) (-1071.889) -- 0:03:13
315000 -- [-1061.509] (-1063.392) (-1061.615) (-1067.123) * (-1070.657) (-1065.485) (-1069.213) [-1067.237] -- 0:03:13
Average standard deviation of split frequencies: 0.012812
315500 -- (-1063.718) (-1068.191) [-1069.867] (-1068.228) * (-1069.936) (-1067.251) [-1058.709] (-1074.661) -- 0:03:13
316000 -- (-1069.230) (-1066.255) (-1054.586) [-1061.472] * (-1063.139) (-1072.967) (-1066.011) [-1067.223] -- 0:03:12
316500 -- (-1063.776) [-1068.294] (-1064.979) (-1064.739) * [-1066.964] (-1069.586) (-1059.748) (-1066.033) -- 0:03:12
317000 -- (-1068.696) (-1070.529) (-1064.333) [-1061.795] * (-1060.573) (-1060.496) (-1062.857) [-1070.115] -- 0:03:11
317500 -- [-1063.131] (-1072.618) (-1060.225) (-1073.026) * (-1068.265) (-1070.332) [-1060.342] (-1067.091) -- 0:03:13
318000 -- [-1066.453] (-1068.361) (-1067.669) (-1065.505) * (-1071.949) (-1070.168) [-1061.458] (-1064.398) -- 0:03:13
318500 -- (-1065.847) [-1071.897] (-1062.639) (-1059.610) * [-1071.307] (-1069.475) (-1071.596) (-1062.009) -- 0:03:12
319000 -- (-1062.231) [-1065.937] (-1064.206) (-1068.012) * (-1072.686) (-1082.372) [-1058.842] (-1063.570) -- 0:03:12
319500 -- (-1066.988) [-1060.506] (-1066.804) (-1061.399) * (-1070.178) (-1064.364) [-1066.146] (-1068.881) -- 0:03:11
320000 -- (-1063.823) (-1066.885) [-1061.184] (-1066.144) * (-1073.223) (-1069.343) (-1067.005) [-1064.686] -- 0:03:11
Average standard deviation of split frequencies: 0.013577
320500 -- (-1064.547) (-1060.652) [-1063.638] (-1059.240) * (-1071.155) (-1057.554) [-1064.502] (-1065.872) -- 0:03:10
321000 -- (-1068.710) (-1055.171) [-1070.322] (-1065.616) * (-1069.293) [-1068.008] (-1073.001) (-1066.786) -- 0:03:12
321500 -- (-1070.777) [-1072.743] (-1074.853) (-1067.733) * [-1066.677] (-1066.450) (-1068.181) (-1060.771) -- 0:03:12
322000 -- (-1065.953) (-1070.439) (-1064.990) [-1066.650] * (-1066.825) (-1070.805) [-1064.287] (-1071.493) -- 0:03:11
322500 -- (-1062.150) [-1069.757] (-1061.117) (-1069.288) * (-1066.311) [-1064.151] (-1058.344) (-1066.359) -- 0:03:11
323000 -- [-1062.099] (-1061.825) (-1070.138) (-1067.296) * (-1075.473) (-1060.889) [-1060.245] (-1075.194) -- 0:03:10
323500 -- (-1072.915) (-1062.755) [-1070.322] (-1061.421) * [-1064.276] (-1067.649) (-1056.177) (-1063.174) -- 0:03:10
324000 -- [-1065.105] (-1069.432) (-1084.205) (-1070.273) * (-1071.745) (-1071.894) (-1063.610) [-1060.851] -- 0:03:11
324500 -- [-1070.721] (-1066.720) (-1081.048) (-1062.844) * (-1069.023) [-1068.616] (-1071.172) (-1065.061) -- 0:03:11
325000 -- (-1081.209) (-1067.133) (-1065.120) [-1061.123] * (-1070.488) (-1065.660) [-1065.278] (-1070.379) -- 0:03:11
Average standard deviation of split frequencies: 0.012929
325500 -- [-1057.655] (-1067.183) (-1069.290) (-1070.125) * [-1057.969] (-1077.046) (-1067.890) (-1059.777) -- 0:03:10
326000 -- [-1064.829] (-1071.650) (-1074.308) (-1063.972) * [-1060.677] (-1074.673) (-1061.992) (-1058.787) -- 0:03:10
326500 -- (-1064.166) [-1065.356] (-1068.521) (-1066.554) * (-1062.459) (-1072.663) [-1059.552] (-1063.794) -- 0:03:09
327000 -- (-1072.067) (-1065.191) [-1061.751] (-1060.979) * [-1064.489] (-1064.615) (-1076.677) (-1064.805) -- 0:03:09
327500 -- (-1062.289) [-1057.200] (-1069.167) (-1070.044) * [-1068.878] (-1069.267) (-1070.581) (-1065.051) -- 0:03:10
328000 -- (-1061.689) (-1068.632) (-1074.474) [-1057.051] * (-1074.385) [-1066.179] (-1063.974) (-1069.086) -- 0:03:10
328500 -- (-1061.796) [-1066.560] (-1057.204) (-1064.233) * (-1066.904) [-1070.094] (-1061.705) (-1063.506) -- 0:03:10
329000 -- [-1067.175] (-1062.905) (-1064.486) (-1072.095) * (-1064.020) [-1067.574] (-1072.997) (-1059.442) -- 0:03:09
329500 -- (-1065.768) (-1057.567) (-1063.116) [-1068.008] * (-1063.578) (-1077.853) (-1069.906) [-1060.454] -- 0:03:09
330000 -- [-1059.941] (-1062.092) (-1067.704) (-1078.369) * [-1061.048] (-1086.458) (-1066.218) (-1070.140) -- 0:03:08
Average standard deviation of split frequencies: 0.012998
330500 -- [-1061.652] (-1063.407) (-1067.003) (-1072.208) * [-1059.576] (-1066.276) (-1068.759) (-1066.539) -- 0:03:08
331000 -- (-1064.768) (-1071.051) [-1065.418] (-1072.793) * (-1071.011) [-1061.245] (-1070.199) (-1067.199) -- 0:03:09
331500 -- (-1068.496) [-1062.489] (-1081.614) (-1058.805) * (-1059.328) [-1071.897] (-1062.014) (-1065.667) -- 0:03:09
332000 -- (-1071.294) [-1066.599] (-1064.207) (-1061.811) * (-1066.590) (-1071.045) (-1062.631) [-1074.671] -- 0:03:09
332500 -- (-1059.272) [-1065.878] (-1063.581) (-1067.021) * (-1066.435) (-1060.579) (-1064.010) [-1062.003] -- 0:03:08
333000 -- [-1063.018] (-1064.500) (-1067.020) (-1062.110) * (-1068.537) (-1066.201) [-1067.351] (-1061.341) -- 0:03:08
333500 -- (-1066.034) (-1061.747) (-1069.665) [-1063.209] * (-1063.953) (-1066.601) (-1059.647) [-1061.490] -- 0:03:07
334000 -- (-1071.592) (-1063.776) [-1059.141] (-1063.262) * (-1057.988) (-1069.261) (-1068.337) [-1060.591] -- 0:03:07
334500 -- (-1070.634) (-1064.940) [-1063.542] (-1059.552) * (-1069.562) (-1066.831) [-1072.011] (-1073.649) -- 0:03:09
335000 -- [-1065.174] (-1061.506) (-1069.041) (-1068.618) * (-1064.946) [-1062.729] (-1077.418) (-1070.001) -- 0:03:08
Average standard deviation of split frequencies: 0.013040
335500 -- (-1065.959) (-1061.683) (-1058.760) [-1064.534] * [-1059.844] (-1068.346) (-1061.881) (-1067.859) -- 0:03:08
336000 -- (-1065.393) (-1067.126) (-1062.448) [-1065.398] * (-1068.585) [-1065.321] (-1070.057) (-1069.181) -- 0:03:07
336500 -- [-1066.471] (-1060.105) (-1062.351) (-1068.088) * (-1064.587) (-1069.948) [-1064.778] (-1061.395) -- 0:03:07
337000 -- (-1061.487) (-1064.533) (-1075.635) [-1062.885] * (-1066.019) (-1074.510) [-1063.912] (-1064.603) -- 0:03:06
337500 -- (-1061.906) [-1063.415] (-1062.082) (-1070.990) * (-1068.135) [-1062.333] (-1084.191) (-1064.713) -- 0:03:06
338000 -- (-1063.231) (-1064.802) [-1062.816] (-1065.855) * (-1064.124) [-1061.541] (-1066.602) (-1068.539) -- 0:03:06
338500 -- (-1060.129) (-1086.623) [-1066.722] (-1066.219) * (-1061.769) (-1055.333) (-1065.015) [-1074.275] -- 0:03:07
339000 -- (-1062.575) (-1075.890) [-1065.586] (-1066.122) * (-1064.283) (-1059.846) [-1059.075] (-1070.992) -- 0:03:07
339500 -- [-1061.022] (-1064.728) (-1057.390) (-1075.788) * (-1060.464) (-1071.130) (-1059.044) [-1057.145] -- 0:03:06
340000 -- [-1062.539] (-1069.978) (-1069.223) (-1061.154) * (-1061.663) (-1066.380) [-1058.930] (-1060.044) -- 0:03:06
Average standard deviation of split frequencies: 0.011640
340500 -- (-1067.941) [-1067.631] (-1061.130) (-1069.153) * [-1062.990] (-1078.784) (-1062.095) (-1069.545) -- 0:03:05
341000 -- (-1070.820) [-1062.159] (-1070.934) (-1071.236) * [-1059.199] (-1064.948) (-1069.323) (-1066.892) -- 0:03:05
341500 -- (-1073.992) [-1066.665] (-1066.857) (-1072.070) * (-1072.300) (-1063.930) [-1067.662] (-1074.690) -- 0:03:05
342000 -- (-1070.330) (-1075.761) [-1062.508] (-1068.796) * (-1065.874) [-1066.965] (-1065.669) (-1068.437) -- 0:03:06
342500 -- (-1062.467) [-1064.244] (-1061.383) (-1075.159) * [-1067.257] (-1062.374) (-1066.777) (-1067.605) -- 0:03:06
343000 -- [-1061.698] (-1066.416) (-1063.380) (-1069.879) * [-1064.886] (-1063.835) (-1080.273) (-1065.410) -- 0:03:05
343500 -- [-1059.668] (-1068.125) (-1060.155) (-1060.020) * (-1065.978) (-1067.621) (-1060.259) [-1067.471] -- 0:03:05
344000 -- (-1067.428) [-1058.681] (-1081.063) (-1068.892) * [-1065.138] (-1062.900) (-1061.050) (-1064.390) -- 0:03:04
344500 -- [-1078.382] (-1069.749) (-1078.354) (-1074.060) * (-1059.075) [-1057.888] (-1069.161) (-1069.591) -- 0:03:04
345000 -- [-1063.106] (-1063.949) (-1075.514) (-1065.390) * [-1062.145] (-1055.239) (-1069.958) (-1072.847) -- 0:03:04
Average standard deviation of split frequencies: 0.010980
345500 -- (-1077.307) (-1074.534) (-1082.082) [-1068.833] * (-1069.845) (-1057.236) [-1059.377] (-1067.653) -- 0:03:05
346000 -- (-1069.113) [-1073.283] (-1077.817) (-1071.372) * (-1070.512) (-1065.781) [-1064.431] (-1065.764) -- 0:03:05
346500 -- [-1064.175] (-1065.550) (-1074.448) (-1070.156) * (-1072.958) (-1067.989) [-1064.236] (-1061.015) -- 0:03:04
347000 -- (-1059.216) [-1059.385] (-1078.563) (-1063.905) * (-1062.221) (-1061.735) [-1064.027] (-1070.443) -- 0:03:04
347500 -- [-1065.576] (-1061.858) (-1062.140) (-1063.932) * [-1070.384] (-1067.924) (-1065.180) (-1065.660) -- 0:03:04
348000 -- (-1058.499) (-1067.334) (-1063.994) [-1062.133] * [-1060.176] (-1063.073) (-1080.272) (-1061.824) -- 0:03:03
348500 -- (-1064.063) [-1057.245] (-1066.982) (-1075.399) * (-1068.504) (-1059.456) [-1058.233] (-1064.958) -- 0:03:03
349000 -- [-1061.224] (-1065.253) (-1063.764) (-1067.426) * (-1068.895) (-1065.157) (-1060.084) [-1064.328] -- 0:03:04
349500 -- (-1067.513) [-1060.846] (-1060.924) (-1061.889) * (-1070.336) (-1059.945) [-1059.909] (-1080.891) -- 0:03:04
350000 -- (-1063.372) [-1060.437] (-1055.025) (-1063.531) * (-1062.199) (-1068.051) (-1069.032) [-1062.575] -- 0:03:03
Average standard deviation of split frequencies: 0.010754
350500 -- (-1061.201) (-1063.636) (-1062.820) [-1057.364] * (-1065.771) (-1062.266) (-1062.008) [-1070.532] -- 0:03:03
351000 -- (-1065.028) (-1069.368) [-1063.542] (-1062.564) * (-1071.991) [-1061.505] (-1063.137) (-1062.915) -- 0:03:03
351500 -- (-1061.397) (-1062.996) (-1063.825) [-1067.417] * (-1066.867) [-1063.418] (-1060.242) (-1069.944) -- 0:03:02
352000 -- (-1068.583) (-1069.516) [-1061.919] (-1064.421) * (-1066.782) (-1072.181) (-1056.007) [-1067.497] -- 0:03:02
352500 -- (-1079.089) (-1061.971) (-1065.206) [-1066.546] * (-1060.496) (-1065.224) [-1059.621] (-1066.918) -- 0:03:03
353000 -- (-1064.532) (-1055.695) (-1066.395) [-1061.723] * [-1069.756] (-1068.553) (-1071.935) (-1076.022) -- 0:03:03
353500 -- (-1070.862) (-1073.208) (-1071.380) [-1058.917] * (-1060.450) [-1068.331] (-1068.880) (-1064.929) -- 0:03:02
354000 -- (-1067.184) [-1063.321] (-1070.300) (-1065.703) * (-1061.600) (-1066.225) [-1066.261] (-1069.313) -- 0:03:02
354500 -- (-1068.233) [-1061.902] (-1069.614) (-1065.803) * (-1064.720) [-1059.254] (-1072.660) (-1064.725) -- 0:03:02
355000 -- (-1060.662) (-1078.327) (-1067.370) [-1070.116] * [-1060.211] (-1057.682) (-1066.945) (-1064.385) -- 0:03:01
Average standard deviation of split frequencies: 0.011139
355500 -- (-1066.638) [-1060.194] (-1064.635) (-1062.406) * (-1075.805) (-1068.000) [-1068.226] (-1077.917) -- 0:03:01
356000 -- [-1063.219] (-1063.621) (-1074.222) (-1073.130) * [-1063.468] (-1057.052) (-1067.291) (-1065.219) -- 0:03:02
356500 -- (-1062.518) (-1064.965) (-1070.232) [-1062.897] * (-1069.577) (-1066.500) [-1069.756] (-1059.518) -- 0:03:02
357000 -- (-1063.174) (-1059.044) (-1079.570) [-1061.614] * (-1068.435) (-1073.027) (-1069.386) [-1060.280] -- 0:03:01
357500 -- (-1060.121) (-1062.106) (-1065.675) [-1062.489] * (-1068.895) (-1068.416) (-1061.616) [-1068.622] -- 0:03:01
358000 -- [-1067.075] (-1062.018) (-1079.598) (-1072.609) * (-1073.931) (-1067.211) (-1061.237) [-1059.996] -- 0:03:01
358500 -- [-1065.067] (-1064.623) (-1068.881) (-1075.802) * (-1068.042) (-1071.517) (-1063.785) [-1058.858] -- 0:03:00
359000 -- (-1064.111) (-1073.636) (-1070.890) [-1066.581] * [-1069.201] (-1074.124) (-1071.025) (-1063.709) -- 0:03:00
359500 -- [-1060.197] (-1071.243) (-1061.959) (-1074.765) * (-1059.102) (-1069.872) [-1063.080] (-1075.672) -- 0:03:01
360000 -- (-1062.314) [-1064.376] (-1057.258) (-1068.657) * (-1066.174) (-1065.328) (-1060.702) [-1057.744] -- 0:03:01
Average standard deviation of split frequencies: 0.010918
360500 -- (-1063.112) (-1072.918) [-1064.229] (-1061.067) * [-1066.522] (-1070.503) (-1064.036) (-1064.283) -- 0:03:00
361000 -- (-1063.949) (-1075.053) [-1065.073] (-1067.507) * (-1066.742) [-1065.654] (-1065.620) (-1067.979) -- 0:03:00
361500 -- [-1062.314] (-1085.448) (-1063.859) (-1061.975) * [-1065.295] (-1061.530) (-1063.298) (-1063.942) -- 0:03:00
362000 -- [-1062.675] (-1069.598) (-1061.656) (-1071.403) * (-1066.781) [-1069.160] (-1073.499) (-1076.944) -- 0:02:59
362500 -- [-1071.430] (-1056.070) (-1063.519) (-1067.193) * (-1068.776) (-1071.357) [-1065.147] (-1061.919) -- 0:02:59
363000 -- [-1061.873] (-1066.218) (-1069.696) (-1066.933) * [-1066.587] (-1067.516) (-1061.440) (-1063.005) -- 0:03:00
363500 -- (-1070.736) [-1061.394] (-1067.953) (-1064.519) * (-1075.756) (-1070.333) [-1060.832] (-1063.168) -- 0:03:00
364000 -- (-1072.932) (-1066.285) (-1066.893) [-1065.058] * (-1063.799) [-1069.121] (-1056.591) (-1065.806) -- 0:02:59
364500 -- (-1072.968) (-1073.039) [-1068.718] (-1061.612) * (-1070.940) (-1058.594) [-1061.720] (-1065.660) -- 0:02:59
365000 -- (-1064.541) [-1066.594] (-1061.594) (-1061.353) * [-1058.853] (-1072.636) (-1056.976) (-1068.365) -- 0:02:59
Average standard deviation of split frequencies: 0.010001
365500 -- (-1061.780) (-1068.703) [-1059.718] (-1064.571) * (-1076.623) [-1058.489] (-1059.807) (-1065.235) -- 0:02:58
366000 -- (-1061.565) (-1060.935) [-1069.743] (-1070.692) * (-1066.500) [-1066.706] (-1065.059) (-1067.283) -- 0:02:58
366500 -- (-1065.170) (-1070.220) [-1061.668] (-1066.737) * (-1069.256) [-1061.167] (-1061.794) (-1073.991) -- 0:02:59
367000 -- (-1057.021) (-1074.303) [-1060.129] (-1067.999) * (-1069.111) (-1066.807) (-1059.941) [-1063.843] -- 0:02:59
367500 -- (-1060.095) (-1061.882) (-1073.689) [-1062.521] * (-1071.251) [-1062.444] (-1064.690) (-1059.373) -- 0:02:58
368000 -- (-1070.760) (-1067.816) [-1066.004] (-1068.271) * (-1068.674) [-1065.400] (-1071.256) (-1061.461) -- 0:02:58
368500 -- (-1068.416) (-1059.092) (-1067.698) [-1060.211] * (-1071.324) (-1068.610) (-1071.398) [-1064.847] -- 0:02:58
369000 -- (-1071.429) [-1064.090] (-1064.660) (-1068.020) * [-1067.401] (-1059.726) (-1069.575) (-1075.024) -- 0:02:57
369500 -- (-1073.492) (-1059.986) [-1062.083] (-1071.322) * [-1064.909] (-1066.251) (-1068.289) (-1061.318) -- 0:02:57
370000 -- (-1064.382) [-1063.655] (-1077.327) (-1062.161) * (-1066.615) (-1066.341) (-1078.992) [-1059.336] -- 0:02:58
Average standard deviation of split frequencies: 0.008828
370500 -- (-1071.036) (-1063.300) (-1065.740) [-1064.217] * [-1064.314] (-1069.394) (-1066.256) (-1064.756) -- 0:02:58
371000 -- (-1085.866) [-1068.884] (-1074.407) (-1065.609) * (-1069.339) (-1066.487) (-1062.421) [-1069.176] -- 0:02:58
371500 -- [-1070.297] (-1069.884) (-1061.780) (-1066.746) * (-1075.582) (-1061.192) (-1076.199) [-1068.319] -- 0:02:57
372000 -- (-1073.366) [-1067.753] (-1073.313) (-1070.658) * (-1070.452) (-1066.865) (-1066.289) [-1063.767] -- 0:02:57
372500 -- (-1060.296) (-1063.034) [-1058.458] (-1077.849) * (-1071.252) (-1066.987) [-1070.439] (-1068.711) -- 0:02:56
373000 -- (-1073.503) [-1064.485] (-1057.589) (-1064.812) * (-1064.510) (-1076.509) [-1072.873] (-1063.705) -- 0:02:56
373500 -- (-1075.265) (-1057.249) (-1068.403) [-1061.563] * (-1072.761) [-1068.769] (-1072.678) (-1063.537) -- 0:02:57
374000 -- (-1070.607) (-1063.947) [-1063.137] (-1064.670) * [-1060.649] (-1062.098) (-1066.107) (-1072.999) -- 0:02:57
374500 -- [-1067.057] (-1070.433) (-1059.697) (-1061.422) * (-1078.306) (-1064.527) [-1058.929] (-1073.306) -- 0:02:57
375000 -- (-1079.238) (-1061.012) (-1067.816) [-1064.734] * [-1059.875] (-1063.522) (-1069.299) (-1063.687) -- 0:02:56
Average standard deviation of split frequencies: 0.009514
375500 -- (-1067.563) [-1062.369] (-1069.595) (-1069.762) * (-1064.037) (-1075.137) [-1059.169] (-1062.739) -- 0:02:56
376000 -- (-1064.960) (-1069.117) (-1067.589) [-1072.645] * (-1061.888) (-1068.281) [-1061.433] (-1072.534) -- 0:02:55
376500 -- (-1060.989) [-1066.729] (-1079.081) (-1068.467) * [-1063.853] (-1070.812) (-1061.154) (-1067.117) -- 0:02:55
377000 -- [-1064.561] (-1063.492) (-1077.684) (-1063.237) * (-1065.499) (-1071.365) (-1074.414) [-1067.019] -- 0:02:56
377500 -- [-1059.413] (-1071.654) (-1059.132) (-1062.607) * (-1064.366) (-1062.806) (-1065.716) [-1067.246] -- 0:02:56
378000 -- [-1065.204] (-1063.923) (-1062.708) (-1058.805) * (-1063.371) [-1063.723] (-1060.241) (-1074.532) -- 0:02:56
378500 -- (-1066.815) (-1061.523) [-1060.460] (-1064.895) * (-1067.672) (-1062.362) [-1064.456] (-1069.632) -- 0:02:55
379000 -- [-1072.769] (-1067.037) (-1069.435) (-1064.189) * (-1064.990) (-1074.339) [-1056.282] (-1075.514) -- 0:02:55
379500 -- [-1063.277] (-1066.300) (-1070.947) (-1070.967) * (-1065.250) (-1081.577) [-1064.987] (-1074.602) -- 0:02:54
380000 -- (-1061.215) [-1060.625] (-1070.731) (-1073.116) * [-1060.201] (-1071.848) (-1070.790) (-1071.059) -- 0:02:54
Average standard deviation of split frequencies: 0.009980
380500 -- [-1057.892] (-1059.791) (-1074.774) (-1065.271) * [-1065.950] (-1074.217) (-1058.211) (-1063.168) -- 0:02:55
381000 -- [-1064.627] (-1063.966) (-1069.188) (-1056.885) * [-1060.676] (-1067.770) (-1066.404) (-1065.586) -- 0:02:55
381500 -- (-1069.488) [-1067.225] (-1067.758) (-1070.700) * [-1061.840] (-1062.609) (-1062.348) (-1063.681) -- 0:02:55
382000 -- (-1073.001) [-1059.763] (-1066.332) (-1061.169) * (-1061.538) (-1060.955) (-1070.081) [-1063.896] -- 0:02:54
382500 -- (-1068.594) (-1068.777) [-1062.055] (-1058.003) * (-1058.916) (-1068.573) (-1059.447) [-1064.486] -- 0:02:54
383000 -- (-1060.935) [-1054.496] (-1069.353) (-1069.650) * [-1067.985] (-1073.753) (-1065.519) (-1064.699) -- 0:02:53
383500 -- (-1066.095) (-1070.680) (-1078.317) [-1060.660] * [-1066.026] (-1058.506) (-1059.753) (-1071.914) -- 0:02:53
384000 -- [-1055.276] (-1068.715) (-1074.751) (-1058.625) * (-1066.936) (-1069.601) (-1064.886) [-1064.853] -- 0:02:54
384500 -- (-1066.528) (-1061.286) [-1063.691] (-1073.777) * (-1069.603) (-1058.695) (-1064.894) [-1060.191] -- 0:02:54
385000 -- [-1057.950] (-1060.346) (-1067.613) (-1067.435) * (-1070.102) (-1056.867) (-1061.512) [-1067.902] -- 0:02:54
Average standard deviation of split frequencies: 0.008764
385500 -- [-1063.541] (-1058.951) (-1067.974) (-1065.741) * (-1070.555) [-1061.364] (-1060.482) (-1062.153) -- 0:02:53
386000 -- (-1066.321) (-1058.177) (-1065.491) [-1064.403] * (-1065.965) [-1063.999] (-1073.385) (-1063.357) -- 0:02:53
386500 -- (-1058.088) [-1065.870] (-1070.154) (-1067.702) * (-1069.064) (-1067.148) [-1069.237] (-1061.540) -- 0:02:53
387000 -- (-1070.347) [-1056.984] (-1067.813) (-1062.407) * [-1061.386] (-1057.609) (-1063.054) (-1065.894) -- 0:02:52
387500 -- (-1064.166) (-1059.711) (-1065.772) [-1060.637] * [-1063.002] (-1062.752) (-1075.783) (-1067.276) -- 0:02:52
388000 -- (-1065.185) [-1067.586] (-1063.027) (-1066.489) * (-1073.645) [-1070.901] (-1076.475) (-1060.720) -- 0:02:53
388500 -- (-1067.746) (-1064.049) (-1061.652) [-1058.341] * (-1063.451) (-1058.540) (-1075.142) [-1067.960] -- 0:02:53
389000 -- (-1074.900) (-1062.911) [-1061.902] (-1066.478) * (-1065.667) (-1078.310) (-1061.455) [-1068.077] -- 0:02:52
389500 -- (-1084.308) (-1059.810) [-1061.024] (-1071.626) * [-1062.839] (-1085.397) (-1064.707) (-1064.675) -- 0:02:52
390000 -- (-1073.013) (-1058.750) (-1070.186) [-1065.548] * [-1070.005] (-1066.303) (-1079.140) (-1064.735) -- 0:02:52
Average standard deviation of split frequencies: 0.008234
390500 -- (-1063.496) (-1062.255) (-1080.750) [-1067.444] * (-1063.330) [-1059.007] (-1062.832) (-1064.400) -- 0:02:51
391000 -- (-1061.153) (-1072.657) (-1070.814) [-1061.182] * (-1064.808) (-1072.135) [-1063.290] (-1058.888) -- 0:02:52
391500 -- [-1061.835] (-1067.319) (-1073.845) (-1072.014) * (-1068.433) (-1065.532) [-1052.877] (-1070.692) -- 0:02:52
392000 -- [-1059.505] (-1058.823) (-1070.679) (-1069.063) * (-1067.290) (-1060.882) [-1070.076] (-1063.776) -- 0:02:52
392500 -- (-1058.966) (-1066.760) [-1061.533] (-1071.914) * [-1068.614] (-1061.082) (-1065.921) (-1064.334) -- 0:02:51
393000 -- (-1059.648) [-1058.466] (-1068.314) (-1075.616) * (-1065.051) [-1059.878] (-1067.608) (-1073.615) -- 0:02:51
393500 -- (-1064.791) (-1073.591) [-1066.241] (-1067.587) * (-1070.386) (-1064.402) [-1061.625] (-1065.945) -- 0:02:51
394000 -- (-1062.424) (-1066.816) (-1067.588) [-1070.998] * (-1060.198) [-1064.367] (-1059.038) (-1071.373) -- 0:02:50
394500 -- (-1061.457) [-1062.976] (-1068.299) (-1059.264) * [-1060.149] (-1070.760) (-1070.458) (-1075.656) -- 0:02:51
395000 -- (-1066.976) (-1062.557) (-1064.294) [-1057.316] * (-1065.839) [-1063.742] (-1065.097) (-1077.000) -- 0:02:51
Average standard deviation of split frequencies: 0.008193
395500 -- [-1064.808] (-1077.809) (-1071.421) (-1065.302) * (-1068.665) [-1062.041] (-1061.346) (-1066.697) -- 0:02:51
396000 -- (-1064.630) (-1062.421) (-1065.134) [-1054.675] * [-1061.580] (-1057.500) (-1070.796) (-1068.612) -- 0:02:50
396500 -- (-1072.379) (-1065.732) [-1061.196] (-1063.483) * (-1064.842) (-1061.129) (-1065.919) [-1055.344] -- 0:02:50
397000 -- (-1068.368) [-1058.570] (-1062.711) (-1065.818) * (-1067.918) [-1059.904] (-1071.298) (-1062.971) -- 0:02:50
397500 -- (-1065.285) [-1065.514] (-1066.021) (-1089.753) * (-1079.262) [-1061.769] (-1062.463) (-1070.583) -- 0:02:49
398000 -- [-1070.367] (-1059.602) (-1067.107) (-1064.419) * (-1074.125) (-1060.684) [-1063.907] (-1065.818) -- 0:02:49
398500 -- (-1057.413) (-1067.108) (-1063.230) [-1067.656] * (-1068.719) [-1064.791] (-1064.436) (-1062.689) -- 0:02:50
399000 -- (-1066.824) (-1063.653) (-1063.622) [-1068.994] * (-1071.514) (-1058.999) [-1060.724] (-1063.122) -- 0:02:50
399500 -- (-1073.161) (-1066.704) (-1068.199) [-1061.553] * (-1073.608) [-1063.455] (-1064.979) (-1068.277) -- 0:02:49
400000 -- [-1066.706] (-1066.274) (-1069.055) (-1066.300) * (-1064.971) [-1058.967] (-1065.862) (-1072.323) -- 0:02:49
Average standard deviation of split frequencies: 0.008790
400500 -- [-1065.460] (-1069.762) (-1068.866) (-1063.835) * (-1069.708) [-1058.351] (-1070.346) (-1066.667) -- 0:02:49
401000 -- (-1067.778) (-1063.209) (-1068.115) [-1061.931] * (-1061.137) (-1075.452) (-1061.019) [-1062.455] -- 0:02:48
401500 -- (-1062.495) (-1071.478) (-1070.958) [-1058.879] * (-1071.138) (-1076.828) [-1061.926] (-1071.167) -- 0:02:48
402000 -- (-1060.020) (-1058.331) (-1062.096) [-1065.220] * (-1066.837) (-1065.495) (-1068.664) [-1073.669] -- 0:02:49
402500 -- (-1067.783) (-1061.744) [-1060.402] (-1063.775) * (-1071.645) (-1062.161) (-1068.427) [-1066.718] -- 0:02:49
403000 -- (-1075.167) (-1067.129) [-1059.933] (-1073.190) * (-1068.378) (-1062.990) [-1069.783] (-1071.469) -- 0:02:48
403500 -- [-1060.950] (-1069.849) (-1065.192) (-1064.263) * (-1062.660) (-1063.360) [-1062.480] (-1072.186) -- 0:02:48
404000 -- (-1057.270) (-1065.035) [-1061.963] (-1068.715) * [-1060.633] (-1066.848) (-1062.339) (-1066.191) -- 0:02:48
404500 -- [-1060.662] (-1071.379) (-1065.612) (-1066.135) * (-1067.949) [-1072.886] (-1071.455) (-1068.272) -- 0:02:47
405000 -- (-1060.711) (-1063.273) (-1065.085) [-1059.518] * [-1066.965] (-1062.150) (-1066.278) (-1069.792) -- 0:02:47
Average standard deviation of split frequencies: 0.010108
405500 -- (-1058.956) [-1060.073] (-1063.755) (-1063.537) * (-1058.045) [-1068.686] (-1066.978) (-1062.789) -- 0:02:48
406000 -- (-1068.481) (-1062.021) (-1075.325) [-1058.312] * (-1062.667) (-1066.383) (-1060.818) [-1064.007] -- 0:02:48
406500 -- (-1062.093) (-1070.205) [-1076.433] (-1066.054) * [-1067.340] (-1060.728) (-1072.605) (-1065.803) -- 0:02:47
407000 -- (-1067.843) [-1065.964] (-1068.454) (-1076.225) * (-1067.107) (-1062.606) (-1067.289) [-1063.623] -- 0:02:47
407500 -- (-1060.889) (-1071.144) [-1062.334] (-1065.265) * (-1075.114) (-1075.410) (-1061.993) [-1064.297] -- 0:02:47
408000 -- [-1059.394] (-1071.033) (-1067.689) (-1074.310) * (-1066.110) [-1056.879] (-1064.642) (-1066.694) -- 0:02:46
408500 -- [-1062.956] (-1079.240) (-1070.711) (-1066.648) * (-1070.804) [-1065.343] (-1065.669) (-1060.464) -- 0:02:46
409000 -- (-1062.081) (-1073.015) (-1068.938) [-1059.816] * (-1072.802) [-1059.670] (-1058.212) (-1062.299) -- 0:02:47
409500 -- [-1070.437] (-1070.636) (-1060.495) (-1068.853) * (-1061.149) [-1058.790] (-1069.809) (-1066.301) -- 0:02:47
410000 -- [-1057.028] (-1066.177) (-1062.513) (-1060.133) * (-1067.091) [-1062.332] (-1067.135) (-1069.211) -- 0:02:46
Average standard deviation of split frequencies: 0.009453
410500 -- (-1058.525) [-1068.853] (-1066.558) (-1075.831) * [-1068.399] (-1070.049) (-1058.761) (-1058.664) -- 0:02:46
411000 -- (-1066.859) (-1060.436) (-1074.509) [-1064.768] * (-1070.918) [-1065.211] (-1070.393) (-1076.813) -- 0:02:46
411500 -- [-1059.025] (-1057.972) (-1065.383) (-1060.697) * (-1061.508) (-1068.453) (-1070.926) [-1054.951] -- 0:02:45
412000 -- [-1057.974] (-1077.964) (-1065.388) (-1077.661) * (-1060.037) (-1064.736) [-1062.045] (-1060.638) -- 0:02:45
412500 -- (-1064.297) (-1069.650) (-1066.476) [-1063.335] * (-1063.033) [-1063.526] (-1060.756) (-1057.341) -- 0:02:46
413000 -- (-1064.592) (-1062.854) (-1072.338) [-1067.054] * [-1071.949] (-1063.306) (-1068.899) (-1064.874) -- 0:02:46
413500 -- (-1073.319) [-1061.872] (-1060.278) (-1075.401) * (-1065.279) (-1060.759) [-1067.773] (-1074.778) -- 0:02:45
414000 -- [-1064.456] (-1067.416) (-1062.091) (-1061.702) * (-1065.606) (-1074.156) [-1060.805] (-1061.230) -- 0:02:45
414500 -- [-1062.359] (-1067.338) (-1064.400) (-1062.369) * [-1058.029] (-1078.461) (-1059.570) (-1066.020) -- 0:02:45
415000 -- (-1061.117) (-1067.984) [-1063.886] (-1064.144) * (-1074.389) [-1057.950] (-1064.950) (-1064.214) -- 0:02:44
Average standard deviation of split frequencies: 0.009265
415500 -- [-1065.310] (-1062.059) (-1079.591) (-1072.969) * (-1075.641) (-1064.237) [-1058.412] (-1071.635) -- 0:02:44
416000 -- (-1064.001) [-1067.627] (-1073.888) (-1067.022) * (-1063.826) [-1069.202] (-1073.171) (-1070.960) -- 0:02:45
416500 -- (-1065.757) (-1066.328) [-1062.247] (-1065.391) * [-1059.537] (-1068.309) (-1058.986) (-1082.333) -- 0:02:45
417000 -- (-1072.746) [-1061.473] (-1063.428) (-1069.295) * (-1060.767) [-1058.155] (-1064.726) (-1070.443) -- 0:02:44
417500 -- (-1068.704) (-1068.239) (-1067.064) [-1064.350] * [-1066.604] (-1067.303) (-1061.505) (-1065.603) -- 0:02:44
418000 -- (-1063.187) (-1068.858) (-1063.222) [-1065.427] * [-1063.325] (-1059.747) (-1068.905) (-1072.147) -- 0:02:44
418500 -- (-1068.606) [-1062.048] (-1069.623) (-1064.345) * [-1067.087] (-1067.783) (-1065.885) (-1066.421) -- 0:02:43
419000 -- [-1068.770] (-1065.489) (-1065.855) (-1060.432) * (-1068.815) (-1065.267) (-1064.200) [-1064.354] -- 0:02:43
419500 -- (-1062.590) (-1067.096) (-1059.900) [-1069.342] * [-1060.656] (-1064.006) (-1062.556) (-1061.185) -- 0:02:44
420000 -- (-1067.781) [-1060.534] (-1069.343) (-1066.073) * (-1062.891) [-1061.832] (-1063.545) (-1068.322) -- 0:02:44
Average standard deviation of split frequencies: 0.009360
420500 -- (-1064.668) (-1078.937) (-1061.162) [-1059.053] * (-1069.250) (-1064.986) (-1070.943) [-1069.601] -- 0:02:43
421000 -- [-1064.434] (-1065.876) (-1055.941) (-1073.012) * (-1062.022) (-1065.501) (-1072.808) [-1059.837] -- 0:02:43
421500 -- (-1070.047) (-1070.662) [-1060.847] (-1064.062) * (-1083.063) (-1069.778) [-1065.530] (-1069.764) -- 0:02:43
422000 -- (-1062.240) (-1060.386) (-1071.593) [-1058.347] * (-1059.784) (-1067.242) (-1064.754) [-1065.005] -- 0:02:42
422500 -- (-1063.306) (-1066.888) [-1066.735] (-1068.384) * [-1068.873] (-1060.065) (-1069.684) (-1067.168) -- 0:02:42
423000 -- (-1066.584) (-1072.260) [-1065.516] (-1068.491) * [-1059.913] (-1066.620) (-1070.862) (-1059.307) -- 0:02:43
423500 -- [-1060.306] (-1071.456) (-1067.311) (-1066.380) * (-1067.028) (-1060.784) [-1064.763] (-1078.218) -- 0:02:43
424000 -- (-1056.379) (-1068.198) [-1062.750] (-1065.054) * [-1064.518] (-1065.661) (-1060.293) (-1066.910) -- 0:02:43
424500 -- (-1067.236) (-1062.407) (-1074.377) [-1063.129] * (-1062.672) [-1067.413] (-1069.804) (-1061.371) -- 0:02:42
425000 -- (-1064.250) [-1060.740] (-1079.037) (-1071.520) * (-1058.839) (-1067.018) [-1060.130] (-1062.685) -- 0:02:42
Average standard deviation of split frequencies: 0.010155
425500 -- (-1071.212) (-1062.234) [-1060.769] (-1080.229) * (-1067.598) [-1063.360] (-1058.059) (-1067.209) -- 0:02:42
426000 -- (-1066.517) (-1061.848) [-1058.662] (-1071.423) * (-1069.800) (-1071.872) [-1064.573] (-1066.182) -- 0:02:41
426500 -- (-1071.648) (-1064.185) [-1065.134] (-1067.588) * (-1077.037) [-1066.020] (-1057.466) (-1066.701) -- 0:02:42
427000 -- [-1057.897] (-1065.659) (-1070.523) (-1070.405) * (-1064.007) [-1062.423] (-1068.076) (-1074.136) -- 0:02:42
427500 -- (-1074.833) (-1068.486) [-1062.075] (-1064.740) * (-1065.696) [-1064.342] (-1060.993) (-1072.112) -- 0:02:42
428000 -- [-1065.607] (-1066.739) (-1062.500) (-1070.546) * (-1064.107) [-1067.597] (-1064.685) (-1066.736) -- 0:02:41
428500 -- (-1066.636) (-1060.282) [-1070.173] (-1063.729) * (-1063.742) (-1067.424) (-1067.366) [-1063.134] -- 0:02:41
429000 -- (-1063.135) (-1080.117) [-1057.694] (-1058.078) * (-1064.468) (-1071.118) (-1069.581) [-1064.112] -- 0:02:41
429500 -- (-1067.367) (-1066.248) [-1068.426] (-1065.693) * (-1063.783) (-1068.675) (-1069.864) [-1061.292] -- 0:02:40
430000 -- (-1061.314) [-1068.652] (-1078.155) (-1059.182) * [-1059.213] (-1061.620) (-1056.845) (-1066.679) -- 0:02:41
Average standard deviation of split frequencies: 0.009079
430500 -- (-1065.735) [-1063.033] (-1071.473) (-1075.263) * [-1056.973] (-1063.294) (-1079.152) (-1067.675) -- 0:02:41
431000 -- [-1062.358] (-1061.504) (-1071.987) (-1061.175) * [-1061.821] (-1065.647) (-1067.587) (-1064.295) -- 0:02:41
431500 -- (-1068.854) [-1059.310] (-1086.629) (-1065.497) * (-1068.355) [-1058.482] (-1065.703) (-1061.432) -- 0:02:40
432000 -- [-1067.805] (-1063.497) (-1073.388) (-1076.936) * (-1072.494) [-1068.100] (-1064.715) (-1062.902) -- 0:02:40
432500 -- (-1066.549) (-1072.449) [-1065.341] (-1079.845) * [-1064.855] (-1064.379) (-1070.511) (-1064.852) -- 0:02:40
433000 -- (-1071.878) (-1070.421) (-1064.538) [-1072.223] * (-1064.737) (-1070.001) [-1064.659] (-1073.106) -- 0:02:39
433500 -- (-1064.222) (-1064.883) [-1062.973] (-1065.101) * (-1055.536) [-1064.428] (-1074.665) (-1070.668) -- 0:02:39
434000 -- (-1059.315) [-1061.336] (-1068.394) (-1066.797) * (-1064.584) [-1063.394] (-1062.432) (-1062.516) -- 0:02:40
434500 -- (-1067.229) [-1059.962] (-1072.442) (-1060.593) * (-1061.058) (-1072.246) [-1072.345] (-1069.823) -- 0:02:40
435000 -- (-1066.364) (-1058.016) (-1068.130) [-1058.738] * (-1060.776) (-1058.282) (-1066.744) [-1065.620] -- 0:02:39
Average standard deviation of split frequencies: 0.008268
435500 -- [-1064.667] (-1062.076) (-1065.951) (-1068.787) * (-1066.931) [-1055.606] (-1060.121) (-1062.997) -- 0:02:39
436000 -- (-1074.732) [-1062.763] (-1059.031) (-1070.524) * [-1062.620] (-1063.256) (-1063.299) (-1069.398) -- 0:02:39
436500 -- (-1066.585) [-1054.933] (-1059.317) (-1077.504) * [-1062.537] (-1060.336) (-1068.409) (-1068.794) -- 0:02:38
437000 -- (-1064.241) (-1060.421) (-1063.139) [-1056.281] * [-1058.947] (-1069.070) (-1065.617) (-1069.129) -- 0:02:38
437500 -- [-1064.018] (-1063.471) (-1065.065) (-1068.936) * (-1062.764) (-1065.714) [-1065.939] (-1066.367) -- 0:02:39
438000 -- (-1060.432) [-1078.234] (-1057.787) (-1067.232) * (-1063.783) (-1070.151) [-1067.089] (-1071.934) -- 0:02:39
438500 -- [-1064.040] (-1080.175) (-1072.088) (-1062.630) * (-1067.290) (-1063.904) [-1064.249] (-1072.375) -- 0:02:38
439000 -- [-1062.281] (-1058.502) (-1068.545) (-1061.119) * (-1063.889) (-1061.584) [-1067.240] (-1058.076) -- 0:02:38
439500 -- (-1063.510) [-1067.565] (-1063.798) (-1077.631) * [-1057.395] (-1062.572) (-1063.383) (-1054.870) -- 0:02:38
440000 -- (-1067.732) [-1054.695] (-1071.553) (-1064.528) * [-1064.074] (-1064.294) (-1060.296) (-1061.753) -- 0:02:37
Average standard deviation of split frequencies: 0.009817
440500 -- (-1064.094) (-1066.314) (-1071.206) [-1067.041] * (-1060.273) (-1066.542) (-1063.413) [-1054.913] -- 0:02:37
441000 -- (-1073.946) [-1065.723] (-1061.545) (-1073.044) * (-1062.802) (-1067.067) (-1061.830) [-1064.480] -- 0:02:38
441500 -- (-1074.358) [-1061.267] (-1062.129) (-1062.792) * (-1072.923) (-1064.563) (-1066.547) [-1063.348] -- 0:02:38
442000 -- (-1070.034) (-1059.035) [-1070.300] (-1072.719) * (-1073.123) [-1069.022] (-1072.538) (-1070.436) -- 0:02:37
442500 -- (-1068.012) (-1058.911) (-1069.767) [-1071.639] * (-1066.346) (-1061.283) (-1078.775) [-1058.584] -- 0:02:37
443000 -- (-1064.881) (-1058.503) [-1070.988] (-1072.960) * [-1069.148] (-1066.914) (-1065.235) (-1072.708) -- 0:02:37
443500 -- (-1062.112) (-1074.652) [-1068.238] (-1067.192) * [-1072.519] (-1061.922) (-1060.050) (-1059.197) -- 0:02:36
444000 -- (-1064.389) (-1060.705) (-1071.998) [-1060.768] * (-1067.074) (-1066.253) (-1066.931) [-1068.797] -- 0:02:36
444500 -- (-1062.330) [-1063.473] (-1078.145) (-1066.540) * (-1069.363) (-1078.268) (-1065.144) [-1060.543] -- 0:02:37
445000 -- (-1067.498) [-1058.202] (-1058.920) (-1067.021) * (-1074.011) (-1074.778) [-1077.126] (-1064.280) -- 0:02:37
Average standard deviation of split frequencies: 0.009637
445500 -- (-1066.492) (-1062.377) (-1076.852) [-1059.154] * [-1070.003] (-1064.917) (-1063.319) (-1056.170) -- 0:02:36
446000 -- [-1064.928] (-1065.015) (-1070.368) (-1055.423) * (-1062.264) (-1072.290) (-1066.537) [-1066.888] -- 0:02:36
446500 -- (-1076.369) [-1063.776] (-1063.533) (-1059.070) * (-1067.321) (-1056.772) [-1062.038] (-1064.630) -- 0:02:36
447000 -- (-1066.915) (-1061.345) [-1054.762] (-1063.928) * (-1065.284) (-1063.599) [-1065.104] (-1070.523) -- 0:02:35
447500 -- [-1072.451] (-1066.015) (-1062.376) (-1071.318) * (-1063.042) (-1068.897) (-1073.546) [-1058.472] -- 0:02:35
448000 -- (-1068.292) [-1064.129] (-1069.713) (-1081.171) * (-1074.886) (-1072.543) [-1068.332] (-1067.771) -- 0:02:36
448500 -- [-1065.527] (-1067.063) (-1073.423) (-1074.183) * (-1065.722) (-1059.279) (-1065.334) [-1069.854] -- 0:02:36
449000 -- (-1061.773) [-1060.877] (-1071.995) (-1059.588) * (-1059.433) [-1055.456] (-1062.105) (-1064.109) -- 0:02:35
449500 -- (-1055.390) (-1067.513) [-1061.608] (-1061.118) * (-1065.865) (-1060.223) (-1068.529) [-1062.791] -- 0:02:35
450000 -- [-1060.501] (-1071.667) (-1060.920) (-1064.789) * [-1058.906] (-1060.770) (-1062.567) (-1065.166) -- 0:02:35
Average standard deviation of split frequencies: 0.010337
450500 -- (-1059.337) (-1068.186) (-1065.330) [-1054.307] * (-1060.423) [-1067.868] (-1066.989) (-1062.861) -- 0:02:34
451000 -- (-1063.092) (-1072.273) [-1062.871] (-1061.874) * (-1062.940) (-1066.766) (-1071.101) [-1069.703] -- 0:02:34
451500 -- [-1067.814] (-1061.800) (-1062.707) (-1073.937) * [-1070.506] (-1059.952) (-1064.826) (-1079.425) -- 0:02:35
452000 -- (-1081.083) [-1065.510] (-1065.747) (-1072.338) * (-1067.159) (-1070.679) [-1066.836] (-1075.807) -- 0:02:35
452500 -- [-1055.527] (-1072.884) (-1065.321) (-1059.221) * (-1067.393) (-1056.886) (-1057.901) [-1073.850] -- 0:02:34
453000 -- (-1057.858) (-1073.248) (-1070.450) [-1054.341] * (-1070.127) (-1067.058) (-1069.636) [-1067.939] -- 0:02:34
453500 -- (-1072.044) [-1059.661] (-1068.574) (-1062.084) * (-1067.692) [-1067.926] (-1065.480) (-1070.820) -- 0:02:34
454000 -- (-1064.188) (-1070.347) (-1070.925) [-1062.116] * (-1072.743) (-1063.579) [-1061.522] (-1074.035) -- 0:02:33
454500 -- (-1065.160) [-1063.925] (-1068.344) (-1073.790) * (-1068.872) [-1060.100] (-1064.699) (-1065.288) -- 0:02:33
455000 -- (-1075.852) [-1063.447] (-1072.162) (-1069.755) * (-1073.777) (-1066.108) (-1068.015) [-1068.702] -- 0:02:34
Average standard deviation of split frequencies: 0.009791
455500 -- (-1066.716) (-1066.094) (-1066.405) [-1071.304] * (-1082.782) (-1059.161) [-1060.948] (-1075.805) -- 0:02:34
456000 -- (-1061.019) (-1067.526) (-1065.963) [-1065.864] * [-1058.340] (-1066.991) (-1061.878) (-1065.093) -- 0:02:33
456500 -- (-1067.321) (-1066.221) [-1057.924] (-1064.297) * [-1059.603] (-1065.929) (-1063.589) (-1064.479) -- 0:02:33
457000 -- (-1066.307) (-1083.071) [-1064.546] (-1066.264) * (-1060.135) (-1073.015) (-1065.648) [-1067.681] -- 0:02:33
457500 -- (-1065.343) [-1058.469] (-1060.476) (-1066.134) * [-1064.390] (-1073.417) (-1066.025) (-1066.990) -- 0:02:32
458000 -- (-1080.379) [-1072.074] (-1075.058) (-1079.633) * [-1058.154] (-1059.140) (-1072.101) (-1061.103) -- 0:02:32
458500 -- (-1068.629) [-1057.365] (-1056.968) (-1073.942) * [-1059.143] (-1063.840) (-1060.258) (-1061.430) -- 0:02:32
459000 -- (-1072.492) (-1067.850) (-1061.528) [-1067.435] * (-1065.197) [-1068.606] (-1061.004) (-1064.285) -- 0:02:33
459500 -- (-1069.211) (-1065.207) (-1075.618) [-1066.891] * (-1071.246) [-1066.826] (-1065.845) (-1065.895) -- 0:02:32
460000 -- (-1062.003) (-1062.291) (-1062.843) [-1064.030] * (-1057.237) (-1065.739) (-1072.498) [-1062.665] -- 0:02:32
Average standard deviation of split frequencies: 0.008969
460500 -- (-1064.146) [-1059.368] (-1062.645) (-1069.882) * (-1056.681) (-1062.871) (-1063.636) [-1058.726] -- 0:02:32
461000 -- (-1070.500) (-1067.428) [-1060.378] (-1065.520) * [-1062.091] (-1068.955) (-1058.584) (-1065.206) -- 0:02:31
461500 -- (-1060.575) [-1069.697] (-1066.884) (-1076.909) * [-1069.586] (-1070.418) (-1060.492) (-1073.058) -- 0:02:31
462000 -- (-1058.786) (-1072.551) [-1059.052] (-1067.149) * (-1068.246) (-1066.687) (-1070.296) [-1058.858] -- 0:02:31
462500 -- (-1070.486) [-1055.971] (-1066.626) (-1072.471) * (-1068.264) [-1065.675] (-1066.623) (-1063.429) -- 0:02:32
463000 -- [-1061.205] (-1067.472) (-1066.493) (-1069.536) * [-1068.606] (-1065.640) (-1068.368) (-1060.907) -- 0:02:31
463500 -- [-1062.950] (-1064.270) (-1062.157) (-1068.143) * (-1066.817) (-1064.801) (-1062.354) [-1066.533] -- 0:02:31
464000 -- (-1061.048) (-1069.725) [-1065.889] (-1066.688) * (-1066.353) [-1064.697] (-1072.442) (-1073.906) -- 0:02:31
464500 -- (-1059.522) (-1065.932) (-1065.888) [-1061.122] * (-1077.385) [-1067.283] (-1063.342) (-1075.990) -- 0:02:31
465000 -- (-1065.023) [-1057.929] (-1064.338) (-1066.570) * (-1075.494) [-1069.838] (-1071.674) (-1066.141) -- 0:02:30
Average standard deviation of split frequencies: 0.009521
465500 -- [-1065.478] (-1057.330) (-1066.534) (-1057.975) * (-1064.283) (-1076.911) [-1064.069] (-1068.049) -- 0:02:30
466000 -- (-1069.979) (-1059.533) [-1065.964] (-1061.669) * (-1060.931) (-1068.254) [-1056.108] (-1067.454) -- 0:02:31
466500 -- (-1069.539) (-1067.439) (-1068.815) [-1071.282] * (-1062.107) [-1065.999] (-1062.004) (-1063.211) -- 0:02:30
467000 -- (-1067.275) (-1069.140) [-1058.424] (-1066.907) * (-1058.663) (-1072.002) [-1062.433] (-1060.767) -- 0:02:30
467500 -- [-1066.526] (-1066.312) (-1068.491) (-1060.368) * [-1061.511] (-1058.895) (-1066.419) (-1062.280) -- 0:02:30
468000 -- (-1061.421) (-1063.404) (-1062.978) [-1070.194] * (-1062.449) (-1064.134) (-1071.500) [-1065.769] -- 0:02:30
468500 -- (-1067.135) (-1059.311) (-1059.200) [-1064.639] * (-1074.228) (-1058.966) [-1063.477] (-1069.482) -- 0:02:29
469000 -- [-1065.830] (-1070.761) (-1073.217) (-1066.421) * (-1071.420) (-1068.332) [-1057.128] (-1065.897) -- 0:02:29
469500 -- [-1061.418] (-1065.170) (-1072.709) (-1068.181) * [-1057.953] (-1059.943) (-1068.469) (-1070.575) -- 0:02:30
470000 -- [-1065.822] (-1068.926) (-1066.018) (-1072.138) * (-1066.160) (-1073.693) (-1064.694) [-1070.140] -- 0:02:29
Average standard deviation of split frequencies: 0.009603
470500 -- (-1066.388) (-1058.917) [-1063.468] (-1062.823) * (-1062.070) [-1058.062] (-1069.312) (-1065.487) -- 0:02:29
471000 -- [-1061.531] (-1067.938) (-1060.729) (-1073.891) * (-1062.804) (-1067.207) [-1068.577] (-1066.664) -- 0:02:29
471500 -- (-1072.424) (-1064.670) (-1058.338) [-1061.000] * (-1066.139) (-1075.089) (-1063.882) [-1057.477] -- 0:02:29
472000 -- (-1066.012) [-1074.114] (-1073.962) (-1062.306) * (-1070.452) (-1063.267) [-1059.035] (-1073.739) -- 0:02:28
472500 -- (-1069.048) [-1063.885] (-1070.363) (-1065.861) * (-1064.833) (-1065.075) [-1059.890] (-1064.312) -- 0:02:28
473000 -- (-1064.573) (-1067.037) (-1072.108) [-1064.925] * (-1064.257) (-1061.004) [-1062.397] (-1062.272) -- 0:02:29
473500 -- (-1074.005) (-1060.088) (-1062.905) [-1056.902] * (-1064.431) (-1062.660) (-1066.818) [-1066.062] -- 0:02:28
474000 -- (-1074.597) (-1060.775) (-1067.658) [-1056.189] * [-1063.575] (-1073.030) (-1073.603) (-1075.490) -- 0:02:28
474500 -- (-1069.697) (-1059.906) (-1070.563) [-1058.758] * [-1060.599] (-1065.973) (-1062.678) (-1062.064) -- 0:02:28
475000 -- (-1061.006) [-1063.888] (-1060.372) (-1068.041) * (-1060.146) (-1064.012) (-1073.990) [-1063.336] -- 0:02:28
Average standard deviation of split frequencies: 0.010078
475500 -- (-1062.973) (-1060.481) [-1069.174] (-1067.524) * [-1062.604] (-1074.501) (-1078.726) (-1062.611) -- 0:02:27
476000 -- (-1071.894) [-1063.917] (-1059.699) (-1066.742) * [-1057.231] (-1073.248) (-1070.988) (-1065.311) -- 0:02:27
476500 -- (-1073.004) [-1065.557] (-1065.180) (-1070.778) * (-1070.288) (-1084.486) [-1072.719] (-1065.078) -- 0:02:27
477000 -- (-1068.212) [-1061.729] (-1065.658) (-1073.009) * (-1067.891) (-1069.968) [-1062.279] (-1067.040) -- 0:02:28
477500 -- (-1067.856) (-1071.723) [-1062.061] (-1064.953) * (-1069.971) (-1067.553) [-1070.363] (-1070.414) -- 0:02:27
478000 -- (-1073.562) (-1061.080) (-1063.128) [-1057.612] * (-1065.308) (-1068.604) (-1061.998) [-1060.384] -- 0:02:27
478500 -- [-1060.542] (-1067.628) (-1070.618) (-1068.763) * (-1061.050) [-1068.211] (-1065.499) (-1064.133) -- 0:02:27
479000 -- (-1072.960) (-1068.228) [-1071.474] (-1069.658) * [-1064.110] (-1061.810) (-1069.007) (-1063.400) -- 0:02:26
479500 -- (-1075.933) (-1059.127) (-1069.754) [-1067.066] * (-1067.376) [-1060.315] (-1064.374) (-1062.760) -- 0:02:26
480000 -- [-1073.315] (-1069.647) (-1061.562) (-1069.811) * [-1059.177] (-1062.207) (-1061.025) (-1074.554) -- 0:02:26
Average standard deviation of split frequencies: 0.011192
480500 -- [-1063.182] (-1062.531) (-1063.646) (-1068.690) * (-1061.412) (-1056.600) (-1061.814) [-1061.947] -- 0:02:27
481000 -- (-1064.628) (-1071.577) [-1071.587] (-1072.601) * (-1065.491) [-1062.709] (-1072.346) (-1062.295) -- 0:02:26
481500 -- (-1061.553) [-1066.013] (-1073.146) (-1075.487) * (-1067.797) [-1063.392] (-1062.828) (-1061.405) -- 0:02:26
482000 -- (-1062.193) (-1074.823) (-1064.329) [-1069.027] * [-1060.792] (-1067.664) (-1082.279) (-1069.916) -- 0:02:26
482500 -- (-1065.329) (-1067.936) [-1067.976] (-1072.605) * (-1065.631) (-1071.894) [-1070.246] (-1068.358) -- 0:02:25
483000 -- (-1074.890) [-1068.286] (-1061.265) (-1076.781) * (-1066.854) [-1063.533] (-1070.849) (-1068.391) -- 0:02:25
483500 -- (-1063.506) (-1065.772) [-1058.485] (-1075.187) * (-1065.745) (-1067.917) [-1063.191] (-1069.355) -- 0:02:25
484000 -- [-1071.036] (-1066.333) (-1065.371) (-1078.186) * [-1061.785] (-1061.883) (-1068.482) (-1064.460) -- 0:02:26
484500 -- (-1070.255) (-1058.822) [-1067.432] (-1072.894) * (-1067.858) (-1071.915) (-1071.316) [-1061.821] -- 0:02:25
485000 -- (-1065.643) (-1070.700) (-1073.415) [-1075.272] * (-1069.268) (-1062.969) (-1066.735) [-1057.672] -- 0:02:25
Average standard deviation of split frequencies: 0.011411
485500 -- [-1061.284] (-1071.801) (-1070.922) (-1076.111) * (-1065.352) [-1060.089] (-1060.555) (-1062.942) -- 0:02:25
486000 -- (-1077.911) [-1065.227] (-1057.239) (-1075.318) * (-1069.060) [-1060.224] (-1062.801) (-1062.304) -- 0:02:24
486500 -- (-1074.375) (-1066.389) [-1066.222] (-1076.515) * (-1070.808) (-1073.868) (-1060.127) [-1061.852] -- 0:02:24
487000 -- (-1068.841) (-1068.943) (-1063.229) [-1073.364] * (-1064.679) (-1066.212) [-1059.117] (-1067.259) -- 0:02:24
487500 -- (-1069.305) [-1060.005] (-1079.240) (-1066.221) * (-1070.464) (-1064.212) (-1079.003) [-1063.225] -- 0:02:25
488000 -- (-1061.428) (-1064.759) (-1063.427) [-1055.367] * [-1061.905] (-1060.321) (-1067.221) (-1062.377) -- 0:02:24
488500 -- [-1071.312] (-1071.194) (-1061.743) (-1062.646) * [-1064.674] (-1064.741) (-1062.966) (-1069.304) -- 0:02:24
489000 -- (-1056.871) [-1062.132] (-1068.655) (-1068.825) * (-1071.399) [-1059.856] (-1062.163) (-1061.851) -- 0:02:24
489500 -- (-1066.776) [-1064.379] (-1062.974) (-1066.074) * (-1067.298) [-1066.677] (-1058.586) (-1061.124) -- 0:02:23
490000 -- [-1067.317] (-1066.283) (-1061.943) (-1062.040) * (-1065.156) (-1063.068) (-1063.064) [-1063.243] -- 0:02:23
Average standard deviation of split frequencies: 0.010229
490500 -- [-1057.431] (-1062.852) (-1061.066) (-1064.153) * [-1066.693] (-1063.369) (-1066.824) (-1069.103) -- 0:02:23
491000 -- [-1057.004] (-1069.943) (-1065.672) (-1066.888) * (-1066.643) (-1071.837) [-1060.273] (-1058.857) -- 0:02:24
491500 -- [-1064.706] (-1062.078) (-1065.237) (-1060.921) * (-1077.081) (-1066.620) (-1065.130) [-1059.675] -- 0:02:23
492000 -- (-1071.810) (-1060.218) (-1066.063) [-1061.769] * [-1065.528] (-1063.127) (-1077.542) (-1067.027) -- 0:02:23
492500 -- [-1073.994] (-1065.218) (-1068.353) (-1062.948) * (-1058.547) (-1065.159) [-1060.866] (-1074.749) -- 0:02:23
493000 -- (-1068.165) (-1062.247) [-1067.580] (-1065.619) * (-1059.501) [-1063.742] (-1063.048) (-1072.607) -- 0:02:22
493500 -- (-1065.992) [-1057.608] (-1070.591) (-1074.456) * (-1065.337) (-1061.660) (-1076.169) [-1065.858] -- 0:02:22
494000 -- (-1077.136) (-1070.398) (-1073.105) [-1065.073] * [-1066.216] (-1066.038) (-1061.288) (-1066.042) -- 0:02:22
494500 -- (-1071.762) (-1070.043) [-1062.245] (-1064.183) * (-1072.322) (-1067.665) (-1072.172) [-1056.787] -- 0:02:23
495000 -- [-1061.104] (-1074.997) (-1066.974) (-1076.302) * (-1069.739) (-1064.297) (-1066.404) [-1060.467] -- 0:02:22
Average standard deviation of split frequencies: 0.009895
495500 -- [-1062.498] (-1063.070) (-1064.507) (-1068.213) * (-1074.286) (-1063.373) (-1068.572) [-1057.938] -- 0:02:22
496000 -- (-1061.149) (-1059.201) [-1068.892] (-1065.765) * (-1069.454) (-1059.142) [-1070.365] (-1072.359) -- 0:02:22
496500 -- (-1057.189) (-1068.707) (-1076.729) [-1064.459] * (-1069.535) [-1054.444] (-1066.298) (-1058.707) -- 0:02:21
497000 -- (-1066.859) [-1064.944] (-1059.848) (-1061.346) * [-1066.823] (-1067.501) (-1063.073) (-1072.410) -- 0:02:21
497500 -- (-1071.963) (-1078.839) [-1064.124] (-1067.395) * (-1063.709) [-1058.845] (-1066.417) (-1077.060) -- 0:02:21
498000 -- (-1061.651) [-1069.318] (-1064.589) (-1066.477) * [-1063.562] (-1061.467) (-1064.642) (-1064.444) -- 0:02:22
498500 -- [-1063.230] (-1065.785) (-1063.929) (-1070.841) * (-1068.556) (-1066.103) (-1061.050) [-1060.524] -- 0:02:21
499000 -- [-1064.088] (-1058.751) (-1076.030) (-1073.605) * [-1060.167] (-1078.036) (-1070.039) (-1066.528) -- 0:02:21
499500 -- [-1067.724] (-1061.570) (-1058.613) (-1062.253) * [-1056.640] (-1065.648) (-1059.196) (-1065.171) -- 0:02:21
500000 -- [-1062.107] (-1071.750) (-1063.974) (-1079.326) * [-1054.308] (-1056.862) (-1071.704) (-1070.620) -- 0:02:21
Average standard deviation of split frequencies: 0.009526
500500 -- (-1064.496) (-1068.739) [-1069.546] (-1065.681) * (-1066.610) [-1061.387] (-1060.943) (-1083.919) -- 0:02:20
501000 -- (-1071.110) [-1071.032] (-1061.973) (-1065.042) * [-1061.712] (-1072.094) (-1066.138) (-1070.844) -- 0:02:20
501500 -- (-1065.139) (-1074.434) [-1059.213] (-1065.175) * [-1061.295] (-1072.641) (-1065.564) (-1067.386) -- 0:02:21
502000 -- (-1060.155) (-1065.520) (-1061.369) [-1055.198] * (-1065.629) [-1060.780] (-1070.278) (-1064.305) -- 0:02:20
502500 -- (-1076.898) (-1066.793) [-1055.939] (-1058.162) * (-1066.853) (-1057.414) (-1067.528) [-1058.367] -- 0:02:20
503000 -- [-1058.791] (-1063.058) (-1058.233) (-1067.607) * (-1067.835) [-1061.370] (-1064.075) (-1070.316) -- 0:02:20
503500 -- [-1064.453] (-1062.498) (-1067.933) (-1065.363) * (-1083.727) [-1059.553] (-1063.315) (-1061.817) -- 0:02:20
504000 -- [-1058.808] (-1068.411) (-1069.411) (-1070.775) * (-1073.013) [-1069.032] (-1066.050) (-1060.863) -- 0:02:19
504500 -- [-1055.213] (-1059.473) (-1069.849) (-1063.352) * (-1078.197) (-1075.428) (-1070.294) [-1070.215] -- 0:02:19
505000 -- (-1056.656) (-1067.500) (-1071.083) [-1061.751] * (-1065.047) [-1067.280] (-1061.160) (-1071.778) -- 0:02:20
Average standard deviation of split frequencies: 0.009371
505500 -- (-1076.188) [-1064.335] (-1067.725) (-1073.913) * (-1066.117) [-1063.182] (-1066.155) (-1063.671) -- 0:02:19
506000 -- (-1065.608) [-1070.771] (-1066.679) (-1072.665) * (-1070.265) [-1066.612] (-1073.827) (-1082.702) -- 0:02:19
506500 -- (-1067.452) (-1069.628) (-1071.494) [-1061.018] * (-1066.112) [-1070.441] (-1068.484) (-1067.496) -- 0:02:19
507000 -- (-1064.656) [-1067.390] (-1063.750) (-1060.678) * (-1061.215) [-1058.908] (-1068.379) (-1068.036) -- 0:02:19
507500 -- (-1068.452) (-1073.367) (-1067.719) [-1061.115] * [-1062.269] (-1057.674) (-1069.957) (-1076.488) -- 0:02:18
508000 -- [-1061.911] (-1063.448) (-1065.169) (-1063.548) * (-1072.653) [-1059.610] (-1068.955) (-1061.993) -- 0:02:18
508500 -- (-1070.797) (-1062.673) [-1066.351] (-1062.864) * (-1059.691) [-1057.345] (-1073.769) (-1077.673) -- 0:02:19
509000 -- [-1053.887] (-1057.678) (-1065.519) (-1064.826) * [-1063.980] (-1058.582) (-1068.242) (-1069.200) -- 0:02:18
509500 -- (-1060.831) (-1068.525) [-1056.696] (-1067.302) * (-1067.105) [-1066.892] (-1061.894) (-1066.191) -- 0:02:18
510000 -- [-1070.672] (-1060.250) (-1060.716) (-1066.081) * (-1059.471) (-1071.782) [-1064.423] (-1055.139) -- 0:02:18
Average standard deviation of split frequencies: 0.009503
510500 -- (-1062.168) [-1065.112] (-1058.158) (-1076.183) * (-1061.876) [-1065.754] (-1069.188) (-1063.413) -- 0:02:18
511000 -- (-1073.402) (-1060.887) [-1059.701] (-1073.124) * [-1064.871] (-1068.422) (-1068.089) (-1060.155) -- 0:02:17
511500 -- [-1063.260] (-1072.924) (-1063.136) (-1060.792) * (-1063.217) [-1064.786] (-1067.137) (-1070.445) -- 0:02:17
512000 -- (-1067.597) [-1063.322] (-1066.328) (-1072.797) * (-1068.453) (-1060.122) (-1075.874) [-1073.421] -- 0:02:18
512500 -- (-1062.950) [-1061.173] (-1063.362) (-1059.296) * [-1062.467] (-1077.307) (-1075.317) (-1063.274) -- 0:02:17
513000 -- [-1064.284] (-1070.715) (-1070.422) (-1070.014) * (-1066.517) [-1065.154] (-1068.487) (-1072.012) -- 0:02:17
513500 -- [-1061.195] (-1058.710) (-1064.083) (-1070.768) * [-1062.970] (-1064.616) (-1064.946) (-1071.358) -- 0:02:17
514000 -- [-1060.588] (-1075.561) (-1078.837) (-1070.400) * (-1072.302) [-1062.203] (-1065.934) (-1076.503) -- 0:02:17
514500 -- (-1065.855) (-1063.723) (-1067.335) [-1070.694] * [-1059.112] (-1071.404) (-1058.413) (-1069.057) -- 0:02:16
515000 -- [-1061.470] (-1073.681) (-1071.470) (-1066.554) * [-1069.196] (-1060.081) (-1070.009) (-1065.770) -- 0:02:16
Average standard deviation of split frequencies: 0.009404
515500 -- [-1064.028] (-1063.166) (-1076.250) (-1065.624) * (-1064.656) (-1062.113) (-1061.502) [-1062.878] -- 0:02:16
516000 -- (-1057.722) [-1062.551] (-1084.574) (-1060.888) * (-1061.759) (-1074.065) (-1060.453) [-1064.751] -- 0:02:16
516500 -- [-1062.693] (-1072.962) (-1065.789) (-1058.721) * (-1061.954) [-1056.274] (-1061.464) (-1076.069) -- 0:02:16
517000 -- (-1064.588) (-1066.789) (-1070.451) [-1065.081] * (-1066.994) (-1058.623) [-1062.287] (-1067.013) -- 0:02:16
517500 -- (-1067.373) (-1064.023) [-1062.506] (-1071.735) * [-1061.764] (-1067.977) (-1061.699) (-1075.853) -- 0:02:16
518000 -- (-1059.695) [-1071.261] (-1072.885) (-1073.431) * (-1066.567) (-1067.163) [-1058.650] (-1064.685) -- 0:02:15
518500 -- (-1060.177) (-1080.510) [-1059.958] (-1077.554) * (-1058.329) (-1059.826) [-1066.207] (-1072.990) -- 0:02:15
519000 -- [-1064.009] (-1066.526) (-1068.002) (-1077.044) * [-1066.106] (-1064.206) (-1061.935) (-1072.063) -- 0:02:16
519500 -- (-1067.014) (-1067.910) (-1064.137) [-1064.072] * [-1064.749] (-1067.466) (-1068.569) (-1076.767) -- 0:02:15
520000 -- [-1064.699] (-1066.826) (-1066.715) (-1063.516) * (-1068.582) (-1067.136) [-1061.076] (-1070.322) -- 0:02:15
Average standard deviation of split frequencies: 0.009533
520500 -- (-1069.843) (-1061.256) [-1064.775] (-1062.924) * (-1065.734) (-1063.066) (-1063.364) [-1058.445] -- 0:02:15
521000 -- (-1060.602) (-1076.320) [-1069.294] (-1067.668) * [-1063.444] (-1066.451) (-1064.563) (-1061.057) -- 0:02:15
521500 -- [-1066.603] (-1068.963) (-1071.522) (-1061.766) * (-1069.367) [-1058.116] (-1066.109) (-1080.276) -- 0:02:14
522000 -- (-1061.549) (-1071.033) [-1059.830] (-1075.835) * (-1065.572) [-1057.598] (-1069.479) (-1070.533) -- 0:02:14
522500 -- [-1059.808] (-1073.326) (-1072.348) (-1063.941) * (-1064.193) (-1060.682) [-1065.998] (-1071.636) -- 0:02:15
523000 -- (-1063.182) (-1078.856) (-1064.984) [-1062.171] * (-1073.599) (-1071.845) [-1064.362] (-1068.459) -- 0:02:14
523500 -- (-1065.739) [-1068.339] (-1059.511) (-1062.961) * [-1063.046] (-1067.578) (-1070.407) (-1072.990) -- 0:02:14
524000 -- (-1066.513) (-1072.729) (-1065.582) [-1073.191] * [-1056.288] (-1066.007) (-1066.780) (-1068.223) -- 0:02:14
524500 -- [-1068.668] (-1068.426) (-1064.918) (-1059.193) * (-1069.625) (-1064.294) (-1074.570) [-1061.815] -- 0:02:14
525000 -- (-1069.954) (-1066.167) [-1066.188] (-1063.359) * (-1073.465) (-1067.543) (-1069.900) [-1064.703] -- 0:02:13
Average standard deviation of split frequencies: 0.009858
525500 -- (-1065.829) [-1071.210] (-1064.230) (-1068.575) * (-1062.461) (-1067.811) [-1064.916] (-1061.766) -- 0:02:13
526000 -- (-1066.388) (-1066.773) [-1062.485] (-1065.522) * [-1061.223] (-1062.420) (-1070.369) (-1066.086) -- 0:02:14
526500 -- (-1059.312) (-1076.191) [-1061.840] (-1064.790) * (-1080.054) [-1064.080] (-1065.992) (-1077.727) -- 0:02:14
527000 -- (-1064.549) [-1066.356] (-1065.087) (-1067.085) * (-1065.188) [-1070.037] (-1083.848) (-1065.675) -- 0:02:13
527500 -- [-1068.038] (-1068.690) (-1057.856) (-1064.110) * [-1064.565] (-1068.785) (-1070.059) (-1067.655) -- 0:02:13
528000 -- (-1070.022) [-1068.988] (-1065.608) (-1067.717) * (-1071.066) (-1060.355) (-1077.659) [-1062.169] -- 0:02:13
528500 -- (-1057.715) (-1063.742) (-1067.013) [-1056.623] * [-1058.116] (-1070.972) (-1063.670) (-1066.179) -- 0:02:12
529000 -- (-1068.970) (-1063.317) (-1072.844) [-1067.813] * [-1069.135] (-1070.193) (-1067.382) (-1065.180) -- 0:02:12
529500 -- (-1077.723) (-1070.794) (-1063.299) [-1064.314] * [-1064.319] (-1070.959) (-1067.152) (-1059.393) -- 0:02:13
530000 -- [-1071.534] (-1067.425) (-1064.623) (-1066.214) * (-1077.225) (-1069.492) (-1066.921) [-1060.158] -- 0:02:13
Average standard deviation of split frequencies: 0.009615
530500 -- (-1068.333) (-1063.173) [-1068.134] (-1063.953) * [-1069.389] (-1059.986) (-1066.728) (-1058.850) -- 0:02:12
531000 -- (-1061.467) [-1064.233] (-1061.196) (-1068.369) * (-1059.618) (-1063.623) (-1064.051) [-1055.239] -- 0:02:12
531500 -- [-1067.796] (-1072.066) (-1066.401) (-1058.587) * (-1069.419) [-1058.643] (-1058.974) (-1060.633) -- 0:02:12
532000 -- (-1075.473) (-1068.041) (-1064.870) [-1069.225] * (-1066.559) (-1068.071) [-1062.235] (-1069.117) -- 0:02:11
532500 -- (-1062.484) (-1066.156) [-1066.379] (-1070.265) * [-1069.875] (-1082.135) (-1067.467) (-1067.769) -- 0:02:11
533000 -- (-1063.444) [-1060.331] (-1062.544) (-1060.485) * [-1065.867] (-1069.167) (-1060.112) (-1064.489) -- 0:02:11
533500 -- (-1069.909) (-1079.744) [-1055.304] (-1074.094) * (-1067.844) [-1057.691] (-1071.537) (-1073.439) -- 0:02:12
534000 -- [-1062.242] (-1065.370) (-1066.603) (-1071.506) * [-1062.203] (-1075.848) (-1062.283) (-1065.115) -- 0:02:11
534500 -- (-1064.407) [-1063.113] (-1072.089) (-1074.507) * (-1069.241) (-1068.002) [-1060.712] (-1076.400) -- 0:02:11
535000 -- [-1059.978] (-1061.542) (-1058.293) (-1078.388) * (-1067.959) (-1066.481) [-1060.196] (-1069.870) -- 0:02:11
Average standard deviation of split frequencies: 0.009778
535500 -- (-1069.933) [-1062.929] (-1062.880) (-1066.576) * [-1061.802] (-1066.452) (-1066.043) (-1072.706) -- 0:02:10
536000 -- [-1062.584] (-1061.617) (-1069.525) (-1064.052) * (-1062.099) (-1073.272) (-1065.419) [-1069.003] -- 0:02:10
536500 -- (-1059.949) (-1065.725) (-1072.619) [-1067.789] * (-1063.444) (-1062.660) [-1057.786] (-1071.667) -- 0:02:10
537000 -- (-1067.935) (-1071.728) [-1058.618] (-1070.546) * (-1061.980) (-1070.361) [-1056.792] (-1064.163) -- 0:02:11
537500 -- [-1067.648] (-1070.584) (-1065.995) (-1072.967) * (-1065.640) (-1068.688) [-1060.823] (-1064.705) -- 0:02:10
538000 -- (-1067.770) (-1089.678) [-1059.812] (-1070.889) * (-1068.009) (-1070.615) (-1060.140) [-1061.697] -- 0:02:10
538500 -- (-1066.299) [-1063.588] (-1073.268) (-1071.684) * (-1070.696) (-1062.963) (-1067.940) [-1064.262] -- 0:02:10
539000 -- [-1061.568] (-1067.650) (-1067.166) (-1065.120) * (-1063.496) [-1058.266] (-1064.872) (-1058.804) -- 0:02:10
539500 -- (-1063.702) (-1076.992) [-1064.115] (-1072.371) * (-1061.603) [-1065.752] (-1067.164) (-1073.244) -- 0:02:09
540000 -- [-1060.717] (-1063.204) (-1070.837) (-1068.050) * (-1072.054) [-1057.659] (-1063.545) (-1070.904) -- 0:02:09
Average standard deviation of split frequencies: 0.009642
540500 -- (-1068.100) [-1059.574] (-1066.267) (-1073.286) * [-1066.003] (-1058.463) (-1066.961) (-1071.637) -- 0:02:10
541000 -- [-1064.792] (-1070.080) (-1069.487) (-1072.996) * (-1077.834) (-1061.038) [-1065.356] (-1071.017) -- 0:02:09
541500 -- [-1070.827] (-1071.238) (-1063.473) (-1066.524) * (-1065.055) [-1066.268] (-1068.375) (-1078.866) -- 0:02:09
542000 -- (-1067.030) (-1068.748) [-1061.762] (-1066.138) * (-1065.997) (-1068.576) [-1060.486] (-1072.120) -- 0:02:09
542500 -- (-1067.225) [-1072.410] (-1067.971) (-1064.121) * (-1070.841) (-1068.163) [-1054.822] (-1064.854) -- 0:02:09
543000 -- [-1070.030] (-1071.196) (-1066.007) (-1066.330) * (-1075.280) (-1073.035) (-1063.856) [-1065.095] -- 0:02:08
543500 -- [-1059.217] (-1063.196) (-1058.625) (-1067.496) * (-1066.160) (-1078.212) [-1057.628] (-1072.639) -- 0:02:08
544000 -- (-1082.247) (-1069.458) (-1071.037) [-1069.275] * (-1072.420) (-1057.595) [-1062.381] (-1081.479) -- 0:02:09
544500 -- (-1059.742) (-1064.710) (-1057.860) [-1060.891] * [-1061.307] (-1059.893) (-1069.042) (-1075.586) -- 0:02:08
545000 -- (-1069.384) (-1069.663) (-1062.624) [-1065.750] * (-1063.820) [-1058.183] (-1058.644) (-1076.626) -- 0:02:08
Average standard deviation of split frequencies: 0.009192
545500 -- (-1060.287) (-1064.702) (-1065.274) [-1067.734] * (-1063.959) (-1064.826) [-1058.742] (-1067.345) -- 0:02:08
546000 -- (-1069.040) [-1065.574] (-1076.826) (-1066.075) * [-1060.092] (-1061.468) (-1074.203) (-1064.254) -- 0:02:08
546500 -- (-1073.265) [-1062.441] (-1061.480) (-1064.128) * (-1061.716) [-1059.120] (-1068.239) (-1069.764) -- 0:02:07
547000 -- (-1069.105) (-1064.828) [-1055.089] (-1076.573) * (-1065.295) [-1059.815] (-1079.074) (-1059.606) -- 0:02:07
547500 -- [-1059.199] (-1074.409) (-1070.076) (-1062.717) * [-1057.288] (-1062.495) (-1059.308) (-1061.968) -- 0:02:08
548000 -- [-1069.993] (-1060.489) (-1063.801) (-1067.237) * (-1066.559) [-1059.867] (-1061.789) (-1062.146) -- 0:02:07
548500 -- (-1061.702) (-1066.000) (-1070.753) [-1065.934] * [-1065.483] (-1060.189) (-1073.860) (-1069.936) -- 0:02:07
549000 -- (-1078.812) [-1063.068] (-1060.258) (-1065.715) * (-1064.638) [-1063.308] (-1064.643) (-1076.403) -- 0:02:07
549500 -- (-1080.338) (-1066.328) [-1061.785] (-1067.574) * (-1069.802) [-1065.921] (-1070.006) (-1070.108) -- 0:02:07
550000 -- [-1059.255] (-1059.055) (-1062.936) (-1065.342) * [-1065.773] (-1064.127) (-1065.449) (-1065.475) -- 0:02:06
Average standard deviation of split frequencies: 0.008661
550500 -- (-1066.924) (-1063.756) [-1063.690] (-1053.850) * [-1063.331] (-1068.758) (-1068.941) (-1066.115) -- 0:02:06
551000 -- (-1068.188) (-1065.764) [-1064.953] (-1065.564) * (-1071.850) [-1065.540] (-1066.433) (-1065.570) -- 0:02:07
551500 -- (-1068.003) (-1065.636) [-1055.344] (-1061.367) * (-1060.862) [-1064.666] (-1059.675) (-1061.834) -- 0:02:06
552000 -- (-1069.807) (-1062.025) (-1064.417) [-1066.078] * (-1064.561) (-1069.219) (-1063.999) [-1066.503] -- 0:02:06
552500 -- (-1068.764) [-1062.736] (-1064.586) (-1060.968) * [-1057.415] (-1066.585) (-1065.867) (-1067.704) -- 0:02:06
553000 -- [-1066.993] (-1063.371) (-1065.626) (-1070.695) * (-1072.826) (-1070.488) (-1062.099) [-1060.231] -- 0:02:06
553500 -- (-1063.274) [-1068.272] (-1068.150) (-1071.805) * (-1065.695) (-1075.371) (-1070.021) [-1068.937] -- 0:02:05
554000 -- (-1064.957) (-1075.007) (-1074.388) [-1069.275] * [-1066.589] (-1065.139) (-1067.556) (-1055.753) -- 0:02:05
554500 -- (-1075.820) (-1069.118) (-1070.582) [-1061.747] * (-1063.696) (-1067.362) (-1065.313) [-1067.669] -- 0:02:06
555000 -- [-1064.678] (-1065.842) (-1065.332) (-1063.331) * [-1061.944] (-1064.910) (-1067.958) (-1066.293) -- 0:02:05
Average standard deviation of split frequencies: 0.009675
555500 -- (-1062.410) (-1063.547) (-1066.244) [-1061.497] * (-1060.494) [-1054.820] (-1065.437) (-1078.748) -- 0:02:05
556000 -- (-1063.781) [-1062.561] (-1068.609) (-1062.818) * (-1061.843) [-1069.685] (-1062.096) (-1064.269) -- 0:02:05
556500 -- (-1065.798) (-1064.500) [-1062.677] (-1066.628) * [-1058.936] (-1068.251) (-1064.655) (-1063.700) -- 0:02:05
557000 -- (-1064.033) (-1064.927) [-1065.784] (-1070.081) * (-1070.280) (-1058.173) [-1058.256] (-1074.728) -- 0:02:04
557500 -- (-1068.919) [-1067.111] (-1073.756) (-1062.091) * (-1066.521) (-1072.664) [-1075.386] (-1062.336) -- 0:02:04
558000 -- (-1072.841) [-1068.839] (-1073.062) (-1059.779) * [-1056.384] (-1070.103) (-1066.754) (-1072.147) -- 0:02:05
558500 -- (-1074.611) (-1073.263) [-1074.084] (-1060.556) * (-1057.700) (-1067.432) (-1072.695) [-1069.313] -- 0:02:04
559000 -- (-1078.008) [-1062.706] (-1066.651) (-1062.337) * (-1064.379) [-1060.903] (-1074.307) (-1074.660) -- 0:02:04
559500 -- (-1065.964) [-1059.082] (-1063.055) (-1071.885) * [-1064.198] (-1063.788) (-1059.782) (-1076.410) -- 0:02:04
560000 -- (-1065.795) [-1062.002] (-1062.198) (-1066.573) * (-1061.987) [-1061.946] (-1064.792) (-1083.387) -- 0:02:04
Average standard deviation of split frequencies: 0.009892
560500 -- (-1063.969) (-1068.015) [-1062.156] (-1070.379) * (-1066.553) (-1061.406) [-1067.245] (-1077.392) -- 0:02:03
561000 -- (-1062.344) (-1069.000) [-1061.643] (-1071.115) * (-1062.317) (-1062.362) (-1070.103) [-1077.589] -- 0:02:03
561500 -- (-1062.457) [-1064.228] (-1064.039) (-1080.808) * (-1068.938) (-1065.163) (-1065.390) [-1062.691] -- 0:02:04
562000 -- [-1069.136] (-1064.810) (-1071.464) (-1070.336) * (-1064.480) (-1065.441) [-1062.772] (-1072.630) -- 0:02:03
562500 -- (-1067.802) (-1065.085) [-1064.963] (-1071.613) * (-1067.444) [-1057.466] (-1056.379) (-1059.720) -- 0:02:03
563000 -- [-1067.007] (-1066.313) (-1070.456) (-1061.067) * (-1057.595) (-1070.240) [-1065.000] (-1072.892) -- 0:02:03
563500 -- (-1068.853) (-1065.347) (-1067.323) [-1057.959] * (-1061.008) (-1068.610) (-1061.489) [-1065.036] -- 0:02:03
564000 -- (-1070.050) [-1059.678] (-1068.414) (-1066.413) * (-1075.061) (-1070.175) (-1066.369) [-1075.018] -- 0:02:02
564500 -- (-1071.322) (-1061.030) [-1061.730] (-1065.207) * [-1061.289] (-1065.037) (-1074.790) (-1069.054) -- 0:02:02
565000 -- (-1069.217) (-1060.832) (-1067.603) [-1062.002] * (-1069.319) [-1061.594] (-1068.417) (-1068.611) -- 0:02:03
Average standard deviation of split frequencies: 0.009554
565500 -- [-1059.895] (-1069.197) (-1062.564) (-1066.852) * (-1066.868) [-1060.596] (-1068.782) (-1070.966) -- 0:02:02
566000 -- [-1060.326] (-1066.068) (-1064.490) (-1072.976) * (-1069.880) (-1059.201) (-1076.045) [-1064.629] -- 0:02:02
566500 -- (-1073.604) (-1063.540) [-1065.684] (-1065.136) * (-1064.377) (-1067.460) [-1055.592] (-1076.032) -- 0:02:02
567000 -- (-1060.443) (-1066.263) [-1061.564] (-1062.628) * (-1072.041) (-1062.556) (-1066.491) [-1065.714] -- 0:02:02
567500 -- (-1072.718) [-1063.893] (-1065.433) (-1062.747) * (-1059.932) (-1066.314) (-1060.706) [-1060.094] -- 0:02:01
568000 -- (-1067.590) (-1066.156) [-1059.626] (-1062.958) * (-1059.995) (-1083.711) [-1063.564] (-1061.338) -- 0:02:01
568500 -- (-1064.469) [-1065.559] (-1063.304) (-1061.182) * (-1063.769) (-1061.783) (-1062.420) [-1057.614] -- 0:02:02
569000 -- [-1063.589] (-1065.302) (-1069.599) (-1064.008) * (-1064.568) (-1061.036) [-1057.988] (-1069.010) -- 0:02:01
569500 -- (-1063.289) (-1069.906) (-1063.968) [-1061.630] * (-1065.871) (-1069.258) [-1060.421] (-1066.287) -- 0:02:01
570000 -- [-1060.780] (-1060.539) (-1064.188) (-1061.449) * (-1074.661) (-1064.244) [-1060.690] (-1061.325) -- 0:02:01
Average standard deviation of split frequencies: 0.009961
570500 -- (-1074.483) [-1067.061] (-1061.132) (-1065.851) * (-1071.785) (-1068.029) (-1060.415) [-1060.715] -- 0:02:01
571000 -- (-1060.331) (-1074.695) (-1061.149) [-1062.394] * (-1072.812) (-1060.191) [-1061.328] (-1062.011) -- 0:02:00
571500 -- (-1065.128) (-1068.434) [-1070.569] (-1063.360) * (-1065.619) [-1065.329] (-1066.607) (-1067.652) -- 0:02:00
572000 -- (-1065.610) (-1073.544) [-1066.967] (-1063.338) * [-1067.099] (-1066.081) (-1067.773) (-1072.385) -- 0:02:01
572500 -- (-1063.114) (-1071.367) [-1061.378] (-1067.382) * (-1081.476) [-1065.917] (-1068.133) (-1070.639) -- 0:02:00
573000 -- [-1068.619] (-1075.149) (-1065.249) (-1064.482) * (-1060.762) (-1068.952) [-1063.688] (-1061.827) -- 0:02:00
573500 -- (-1075.106) (-1065.512) [-1070.445] (-1070.042) * (-1064.837) (-1062.405) [-1067.732] (-1064.459) -- 0:02:00
574000 -- [-1067.844] (-1068.423) (-1069.136) (-1072.772) * (-1059.291) [-1058.937] (-1063.646) (-1069.324) -- 0:02:00
574500 -- [-1064.887] (-1072.815) (-1064.720) (-1056.665) * (-1065.435) (-1080.357) (-1068.233) [-1066.857] -- 0:01:59
575000 -- (-1069.473) [-1070.269] (-1075.171) (-1064.195) * (-1059.716) (-1077.179) [-1071.696] (-1067.786) -- 0:01:59
Average standard deviation of split frequencies: 0.009628
575500 -- (-1063.821) [-1063.676] (-1074.132) (-1065.441) * [-1062.827] (-1074.817) (-1071.782) (-1069.508) -- 0:02:00
576000 -- (-1068.365) [-1062.530] (-1061.009) (-1070.007) * [-1061.643] (-1058.722) (-1064.380) (-1063.633) -- 0:01:59
576500 -- (-1060.967) (-1071.905) [-1060.674] (-1068.630) * [-1057.119] (-1074.303) (-1066.087) (-1073.580) -- 0:01:59
577000 -- [-1056.849] (-1068.891) (-1079.551) (-1068.784) * (-1058.341) (-1075.323) [-1060.335] (-1074.406) -- 0:01:59
577500 -- (-1055.712) (-1064.143) [-1060.159] (-1058.518) * [-1064.942] (-1068.605) (-1065.150) (-1071.060) -- 0:01:59
578000 -- (-1068.816) [-1059.482] (-1061.114) (-1064.079) * (-1064.394) (-1064.153) [-1057.214] (-1071.147) -- 0:01:59
578500 -- [-1064.569] (-1066.213) (-1062.366) (-1073.370) * (-1067.988) [-1065.661] (-1066.410) (-1075.253) -- 0:01:58
579000 -- (-1071.433) (-1058.444) (-1063.444) [-1058.727] * [-1062.548] (-1063.725) (-1067.902) (-1071.365) -- 0:01:58
579500 -- (-1069.757) (-1060.577) (-1063.079) [-1062.097] * (-1064.626) (-1059.528) [-1063.719] (-1070.846) -- 0:01:59
580000 -- (-1067.550) (-1063.029) [-1062.620] (-1068.797) * (-1062.772) (-1065.185) [-1062.143] (-1065.692) -- 0:01:58
Average standard deviation of split frequencies: 0.009694
580500 -- (-1071.712) (-1070.616) (-1071.550) [-1063.620] * [-1059.453] (-1061.393) (-1054.726) (-1074.652) -- 0:01:58
581000 -- [-1060.473] (-1069.105) (-1073.071) (-1061.157) * [-1057.083] (-1062.537) (-1058.918) (-1071.085) -- 0:01:58
581500 -- (-1065.880) (-1060.095) (-1066.332) [-1063.925] * [-1060.724] (-1064.430) (-1061.466) (-1071.053) -- 0:01:58
582000 -- (-1065.961) (-1079.134) (-1065.497) [-1060.493] * [-1057.554] (-1072.261) (-1068.744) (-1076.005) -- 0:01:57
582500 -- (-1061.505) [-1062.570] (-1070.170) (-1060.803) * [-1064.402] (-1081.518) (-1062.408) (-1066.187) -- 0:01:57
583000 -- [-1060.395] (-1060.545) (-1075.210) (-1060.530) * (-1073.040) [-1072.463] (-1055.631) (-1060.285) -- 0:01:58
583500 -- (-1066.826) [-1060.758] (-1064.123) (-1057.316) * (-1071.688) [-1059.426] (-1059.718) (-1069.164) -- 0:01:57
584000 -- (-1062.356) (-1058.420) (-1067.591) [-1059.782] * (-1064.668) [-1064.390] (-1063.793) (-1067.300) -- 0:01:57
584500 -- [-1057.694] (-1075.870) (-1064.721) (-1073.974) * (-1071.194) (-1060.703) (-1066.360) [-1066.545] -- 0:01:57
585000 -- (-1060.091) [-1057.053] (-1073.651) (-1062.982) * (-1071.851) (-1073.056) [-1064.186] (-1057.961) -- 0:01:57
Average standard deviation of split frequencies: 0.009795
585500 -- (-1065.624) [-1070.068] (-1068.791) (-1070.793) * [-1060.846] (-1067.719) (-1060.183) (-1072.281) -- 0:01:56
586000 -- [-1062.273] (-1064.844) (-1073.351) (-1069.068) * (-1073.268) [-1058.699] (-1065.437) (-1068.687) -- 0:01:56
586500 -- (-1069.784) (-1077.546) (-1067.057) [-1068.975] * (-1073.908) (-1071.896) (-1080.370) [-1068.578] -- 0:01:57
587000 -- [-1064.108] (-1075.186) (-1076.831) (-1070.694) * (-1065.527) [-1063.498] (-1080.667) (-1078.364) -- 0:01:56
587500 -- (-1065.425) (-1066.566) [-1063.905] (-1067.325) * (-1075.879) [-1059.133] (-1069.589) (-1067.507) -- 0:01:56
588000 -- (-1071.304) (-1067.465) [-1071.782] (-1065.367) * (-1071.934) (-1066.433) (-1075.709) [-1062.630] -- 0:01:56
588500 -- (-1078.780) [-1066.428] (-1072.592) (-1065.453) * (-1067.463) [-1057.146] (-1070.569) (-1067.721) -- 0:01:56
589000 -- [-1061.329] (-1063.905) (-1060.549) (-1062.757) * (-1066.243) (-1077.934) (-1068.470) [-1066.505] -- 0:01:55
589500 -- (-1073.854) (-1075.473) [-1066.967] (-1067.121) * [-1058.052] (-1063.219) (-1065.643) (-1070.974) -- 0:01:55
590000 -- [-1062.182] (-1076.477) (-1070.498) (-1063.848) * (-1068.576) [-1061.534] (-1059.993) (-1066.815) -- 0:01:56
Average standard deviation of split frequencies: 0.010187
590500 -- (-1061.550) (-1082.544) (-1065.877) [-1063.710] * (-1070.054) (-1070.009) (-1071.432) [-1060.243] -- 0:01:55
591000 -- [-1059.402] (-1067.399) (-1074.364) (-1062.415) * (-1074.982) (-1063.042) [-1060.484] (-1068.302) -- 0:01:55
591500 -- (-1065.053) (-1074.552) (-1080.443) [-1061.339] * (-1060.500) (-1065.302) [-1069.888] (-1061.548) -- 0:01:55
592000 -- (-1060.822) (-1060.595) (-1071.700) [-1057.466] * (-1062.007) (-1056.918) [-1057.264] (-1065.188) -- 0:01:55
592500 -- [-1056.609] (-1061.044) (-1059.365) (-1071.600) * (-1069.489) (-1065.079) [-1065.734] (-1064.247) -- 0:01:54
593000 -- (-1076.512) (-1069.115) (-1075.422) [-1059.949] * (-1070.787) [-1061.715] (-1068.292) (-1064.026) -- 0:01:54
593500 -- (-1074.893) [-1071.776] (-1065.436) (-1058.710) * (-1070.439) (-1061.202) [-1066.406] (-1065.633) -- 0:01:55
594000 -- [-1073.549] (-1064.883) (-1061.351) (-1072.109) * [-1062.429] (-1068.125) (-1061.357) (-1068.631) -- 0:01:54
594500 -- [-1060.418] (-1072.340) (-1073.338) (-1062.937) * (-1079.124) (-1072.124) (-1075.221) [-1067.077] -- 0:01:54
595000 -- (-1064.722) (-1066.396) (-1076.087) [-1061.802] * [-1058.446] (-1066.137) (-1057.220) (-1068.257) -- 0:01:54
Average standard deviation of split frequencies: 0.009445
595500 -- [-1053.560] (-1066.040) (-1067.151) (-1066.945) * (-1062.037) [-1062.649] (-1062.075) (-1071.033) -- 0:01:54
596000 -- (-1062.633) (-1064.127) (-1075.786) [-1058.616] * (-1062.060) [-1064.440] (-1073.815) (-1074.804) -- 0:01:53
596500 -- [-1055.075] (-1067.028) (-1064.313) (-1060.929) * [-1065.691] (-1059.386) (-1065.159) (-1072.357) -- 0:01:53
597000 -- (-1059.484) (-1064.860) [-1064.465] (-1070.339) * (-1067.836) [-1070.555] (-1061.933) (-1073.722) -- 0:01:54
597500 -- (-1060.255) [-1059.224] (-1061.775) (-1063.685) * [-1060.105] (-1061.818) (-1065.304) (-1069.305) -- 0:01:53
598000 -- (-1062.446) (-1061.832) [-1061.744] (-1071.778) * (-1059.053) (-1065.236) (-1072.652) [-1060.444] -- 0:01:53
598500 -- [-1068.049] (-1061.376) (-1068.375) (-1064.836) * (-1070.529) [-1055.905] (-1066.030) (-1067.616) -- 0:01:53
599000 -- (-1062.845) [-1066.787] (-1072.747) (-1061.883) * (-1066.764) (-1063.861) (-1076.431) [-1071.577] -- 0:01:53
599500 -- [-1065.804] (-1070.916) (-1073.281) (-1070.682) * (-1070.745) [-1066.331] (-1065.818) (-1068.437) -- 0:01:52
600000 -- [-1059.861] (-1077.132) (-1068.264) (-1068.656) * (-1074.506) (-1063.516) (-1076.770) [-1061.709] -- 0:01:52
Average standard deviation of split frequencies: 0.009141
600500 -- (-1067.531) (-1071.278) [-1060.446] (-1069.554) * (-1063.472) (-1063.634) (-1066.160) [-1059.799] -- 0:01:53
601000 -- [-1069.507] (-1057.226) (-1058.042) (-1062.283) * (-1068.658) (-1059.112) [-1067.165] (-1064.659) -- 0:01:52
601500 -- (-1061.028) (-1063.488) [-1061.570] (-1066.507) * (-1074.766) [-1053.500] (-1072.038) (-1062.599) -- 0:01:52
602000 -- (-1061.705) (-1069.509) [-1065.384] (-1066.609) * (-1070.789) (-1070.617) [-1055.993] (-1066.978) -- 0:01:52
602500 -- (-1059.064) (-1067.547) [-1070.630] (-1074.996) * (-1061.956) [-1064.015] (-1072.311) (-1074.371) -- 0:01:52
603000 -- (-1057.607) [-1061.211] (-1059.496) (-1072.426) * (-1076.710) [-1056.048] (-1060.255) (-1057.579) -- 0:01:51
603500 -- (-1067.455) [-1070.245] (-1070.605) (-1062.484) * [-1056.630] (-1063.797) (-1065.600) (-1063.690) -- 0:01:51
604000 -- (-1072.168) [-1056.428] (-1076.364) (-1059.938) * (-1072.919) (-1068.191) (-1072.140) [-1060.330] -- 0:01:52
604500 -- (-1065.330) (-1062.275) (-1075.811) [-1067.079] * (-1062.824) (-1065.547) (-1064.768) [-1057.209] -- 0:01:51
605000 -- [-1063.143] (-1058.228) (-1058.520) (-1066.030) * (-1069.904) (-1064.319) [-1058.385] (-1060.106) -- 0:01:51
Average standard deviation of split frequencies: 0.009426
605500 -- [-1059.612] (-1065.253) (-1065.215) (-1072.741) * (-1067.457) (-1065.202) (-1074.170) [-1055.336] -- 0:01:51
606000 -- (-1058.330) (-1074.626) (-1071.272) [-1059.382] * [-1059.248] (-1067.472) (-1061.237) (-1069.556) -- 0:01:51
606500 -- [-1058.360] (-1060.876) (-1066.587) (-1072.056) * (-1062.789) (-1073.802) (-1064.244) [-1072.555] -- 0:01:50
607000 -- (-1069.864) [-1057.812] (-1067.887) (-1075.289) * (-1064.480) (-1065.420) [-1059.181] (-1076.574) -- 0:01:50
607500 -- [-1059.753] (-1069.687) (-1059.038) (-1083.312) * (-1067.608) [-1067.026] (-1065.134) (-1064.801) -- 0:01:51
608000 -- (-1061.442) (-1069.579) [-1063.798] (-1062.885) * (-1062.317) [-1062.422] (-1067.222) (-1065.813) -- 0:01:50
608500 -- (-1066.549) (-1064.313) (-1064.275) [-1063.670] * [-1059.570] (-1063.226) (-1078.011) (-1065.461) -- 0:01:50
609000 -- (-1073.471) [-1064.280] (-1068.734) (-1058.885) * (-1067.897) (-1069.052) [-1057.866] (-1065.317) -- 0:01:50
609500 -- (-1071.747) [-1061.384] (-1062.597) (-1063.901) * [-1059.952] (-1063.637) (-1063.424) (-1072.467) -- 0:01:50
610000 -- (-1063.404) (-1061.922) [-1064.593] (-1064.167) * (-1065.605) [-1059.490] (-1067.005) (-1066.382) -- 0:01:49
Average standard deviation of split frequencies: 0.009263
610500 -- (-1064.813) (-1073.516) (-1061.930) [-1061.211] * (-1069.147) [-1057.079] (-1060.510) (-1065.199) -- 0:01:49
611000 -- [-1060.788] (-1062.022) (-1057.116) (-1072.278) * [-1059.311] (-1060.884) (-1064.420) (-1069.384) -- 0:01:50
611500 -- [-1061.359] (-1073.456) (-1065.536) (-1068.344) * (-1061.251) [-1065.089] (-1064.224) (-1062.906) -- 0:01:49
612000 -- [-1067.226] (-1069.870) (-1066.903) (-1066.689) * (-1066.496) (-1060.211) (-1070.463) [-1061.594] -- 0:01:49
612500 -- [-1061.040] (-1063.077) (-1069.454) (-1067.714) * [-1062.432] (-1066.172) (-1067.946) (-1067.383) -- 0:01:49
613000 -- (-1074.549) (-1061.976) (-1060.649) [-1063.636] * (-1063.160) (-1068.531) (-1081.140) [-1060.261] -- 0:01:49
613500 -- (-1069.725) (-1065.341) [-1060.932] (-1067.826) * (-1069.813) (-1061.569) (-1071.247) [-1069.080] -- 0:01:48
614000 -- [-1063.979] (-1070.220) (-1064.708) (-1071.331) * [-1061.228] (-1067.012) (-1072.680) (-1068.788) -- 0:01:48
614500 -- [-1069.165] (-1068.025) (-1063.457) (-1067.236) * (-1069.080) [-1058.295] (-1067.257) (-1064.514) -- 0:01:49
615000 -- (-1058.943) (-1081.960) [-1061.997] (-1070.325) * [-1061.778] (-1069.974) (-1065.856) (-1073.996) -- 0:01:48
Average standard deviation of split frequencies: 0.008823
615500 -- (-1061.552) (-1066.806) (-1065.356) [-1063.822] * (-1063.387) (-1059.830) (-1070.315) [-1062.428] -- 0:01:48
616000 -- (-1071.499) (-1067.487) [-1069.026] (-1072.369) * (-1060.883) [-1058.575] (-1067.781) (-1066.852) -- 0:01:48
616500 -- (-1074.675) (-1066.043) [-1066.321] (-1066.513) * (-1076.486) [-1058.230] (-1069.712) (-1065.579) -- 0:01:48
617000 -- (-1070.103) [-1065.024] (-1071.535) (-1061.105) * [-1073.312] (-1059.738) (-1067.656) (-1073.898) -- 0:01:48
617500 -- (-1063.907) (-1069.488) (-1068.600) [-1062.072] * (-1083.609) (-1057.544) (-1065.860) [-1052.783] -- 0:01:47
618000 -- (-1064.295) [-1063.739] (-1067.430) (-1059.067) * [-1067.398] (-1068.261) (-1066.989) (-1058.730) -- 0:01:47
618500 -- (-1071.100) [-1070.378] (-1067.728) (-1072.585) * (-1061.989) (-1068.453) [-1071.264] (-1062.750) -- 0:01:47
619000 -- (-1073.185) [-1062.755] (-1070.591) (-1064.009) * (-1067.875) (-1063.807) (-1063.677) [-1071.494] -- 0:01:47
619500 -- [-1073.096] (-1071.246) (-1060.263) (-1066.965) * (-1075.418) [-1068.362] (-1062.692) (-1067.974) -- 0:01:47
620000 -- (-1063.133) (-1064.921) [-1061.181] (-1072.055) * (-1060.159) (-1070.060) [-1066.397] (-1064.233) -- 0:01:47
Average standard deviation of split frequencies: 0.008355
620500 -- (-1062.775) (-1065.033) (-1074.880) [-1061.623] * (-1069.317) (-1063.934) (-1064.048) [-1063.879] -- 0:01:47
621000 -- (-1064.834) (-1056.608) [-1060.116] (-1067.292) * (-1065.029) (-1066.915) [-1061.282] (-1062.458) -- 0:01:46
621500 -- (-1064.108) (-1064.355) [-1059.210] (-1064.396) * (-1062.831) [-1063.646] (-1066.540) (-1064.491) -- 0:01:46
622000 -- (-1060.851) [-1058.521] (-1071.461) (-1064.451) * (-1067.605) [-1067.787] (-1068.543) (-1062.128) -- 0:01:46
622500 -- [-1065.861] (-1066.076) (-1075.111) (-1068.228) * (-1068.342) (-1074.385) (-1062.242) [-1058.825] -- 0:01:46
623000 -- [-1064.533] (-1064.939) (-1081.606) (-1066.759) * [-1061.144] (-1081.402) (-1066.479) (-1063.486) -- 0:01:46
623500 -- (-1075.225) [-1064.330] (-1076.292) (-1069.411) * (-1059.113) (-1079.932) (-1076.102) [-1067.657] -- 0:01:46
624000 -- (-1072.866) (-1075.597) (-1074.072) [-1064.692] * (-1060.248) (-1071.273) (-1077.418) [-1063.667] -- 0:01:46
624500 -- (-1060.089) [-1067.027] (-1063.943) (-1075.175) * (-1073.126) [-1069.814] (-1079.646) (-1066.437) -- 0:01:45
625000 -- (-1068.994) (-1072.645) (-1076.710) [-1061.024] * (-1062.288) [-1061.994] (-1069.926) (-1060.117) -- 0:01:45
Average standard deviation of split frequencies: 0.008505
625500 -- [-1057.619] (-1070.583) (-1071.346) (-1065.248) * [-1065.254] (-1063.540) (-1080.017) (-1065.339) -- 0:01:45
626000 -- [-1057.227] (-1063.354) (-1067.398) (-1056.047) * (-1065.453) (-1066.730) (-1070.345) [-1062.196] -- 0:01:45
626500 -- [-1061.579] (-1061.265) (-1064.413) (-1073.767) * (-1065.260) (-1057.547) [-1061.764] (-1072.645) -- 0:01:45
627000 -- (-1068.527) (-1073.603) (-1074.088) [-1060.357] * [-1069.661] (-1064.836) (-1065.575) (-1063.661) -- 0:01:45
627500 -- (-1068.219) [-1059.249] (-1062.023) (-1061.025) * (-1070.475) [-1059.382] (-1072.034) (-1062.989) -- 0:01:45
628000 -- (-1060.348) (-1076.363) (-1073.715) [-1059.394] * (-1076.477) (-1073.059) (-1061.871) [-1061.191] -- 0:01:44
628500 -- (-1057.752) (-1065.587) [-1066.732] (-1063.636) * (-1073.085) (-1059.713) [-1062.994] (-1062.447) -- 0:01:44
629000 -- [-1069.306] (-1067.994) (-1061.864) (-1077.269) * [-1068.569] (-1063.837) (-1066.605) (-1068.409) -- 0:01:44
629500 -- (-1063.802) (-1085.413) (-1065.266) [-1065.994] * (-1063.702) (-1065.048) [-1062.477] (-1066.583) -- 0:01:44
630000 -- (-1074.176) [-1061.344] (-1063.361) (-1074.589) * (-1074.345) [-1063.468] (-1061.076) (-1066.242) -- 0:01:44
Average standard deviation of split frequencies: 0.008926
630500 -- (-1064.566) (-1065.672) (-1060.929) [-1067.858] * (-1065.816) (-1069.201) (-1064.999) [-1063.535] -- 0:01:44
631000 -- (-1069.572) (-1061.887) (-1067.221) [-1067.486] * (-1072.328) (-1076.188) [-1062.279] (-1073.074) -- 0:01:44
631500 -- (-1078.015) [-1061.716] (-1062.764) (-1073.388) * [-1064.608] (-1073.641) (-1057.798) (-1065.291) -- 0:01:43
632000 -- [-1064.807] (-1070.598) (-1071.945) (-1068.849) * (-1065.809) (-1062.632) (-1062.979) [-1063.975] -- 0:01:43
632500 -- (-1063.246) [-1061.569] (-1064.074) (-1067.926) * (-1069.549) (-1075.990) [-1066.414] (-1063.041) -- 0:01:44
633000 -- [-1062.084] (-1062.088) (-1062.846) (-1063.901) * (-1073.599) (-1066.467) (-1071.378) [-1061.703] -- 0:01:43
633500 -- (-1059.590) [-1063.810] (-1077.399) (-1061.636) * (-1065.515) [-1066.663] (-1065.492) (-1060.164) -- 0:01:43
634000 -- [-1063.399] (-1064.783) (-1065.267) (-1066.584) * (-1066.267) [-1056.582] (-1066.806) (-1062.694) -- 0:01:43
634500 -- [-1058.844] (-1068.535) (-1064.937) (-1064.229) * (-1081.189) (-1065.953) [-1060.448] (-1059.578) -- 0:01:43
635000 -- (-1063.726) (-1061.104) (-1070.289) [-1064.040] * (-1067.750) (-1075.272) (-1063.355) [-1064.772] -- 0:01:42
Average standard deviation of split frequencies: 0.008851
635500 -- (-1056.036) [-1063.264] (-1070.643) (-1070.914) * (-1064.047) (-1067.458) (-1064.401) [-1060.747] -- 0:01:42
636000 -- [-1065.887] (-1060.560) (-1064.693) (-1074.165) * (-1064.223) [-1067.062] (-1063.614) (-1065.533) -- 0:01:43
636500 -- [-1057.580] (-1069.059) (-1058.565) (-1077.969) * (-1065.033) [-1062.863] (-1061.251) (-1071.152) -- 0:01:42
637000 -- (-1072.646) (-1066.247) [-1061.556] (-1066.543) * (-1073.614) (-1062.367) [-1063.516] (-1059.992) -- 0:01:42
637500 -- (-1065.980) (-1071.885) (-1084.020) [-1066.050] * (-1063.066) (-1067.148) [-1059.481] (-1068.444) -- 0:01:42
638000 -- [-1055.709] (-1066.862) (-1061.749) (-1069.568) * [-1065.007] (-1074.855) (-1065.086) (-1068.703) -- 0:01:42
638500 -- (-1067.875) (-1066.895) [-1057.827] (-1075.488) * (-1066.978) (-1073.043) [-1061.995] (-1064.000) -- 0:01:41
639000 -- (-1060.166) [-1063.133] (-1071.528) (-1064.762) * (-1068.392) (-1065.137) [-1060.548] (-1061.782) -- 0:01:41
639500 -- [-1060.399] (-1071.681) (-1068.137) (-1064.025) * [-1065.451] (-1068.716) (-1069.786) (-1066.920) -- 0:01:42
640000 -- (-1059.982) (-1063.351) [-1070.897] (-1064.548) * [-1059.315] (-1065.668) (-1065.634) (-1070.313) -- 0:01:41
Average standard deviation of split frequencies: 0.008959
640500 -- [-1074.130] (-1069.718) (-1070.650) (-1067.198) * (-1057.885) (-1067.107) (-1065.337) [-1062.776] -- 0:01:41
641000 -- (-1061.142) (-1063.364) [-1067.007] (-1069.367) * (-1063.412) [-1061.631] (-1070.557) (-1060.477) -- 0:01:41
641500 -- (-1063.274) (-1063.135) (-1066.270) [-1067.029] * (-1058.976) [-1069.064] (-1068.254) (-1057.186) -- 0:01:41
642000 -- (-1057.411) (-1061.243) [-1069.338] (-1079.550) * (-1059.689) [-1071.745] (-1062.332) (-1064.153) -- 0:01:40
642500 -- [-1067.275] (-1067.655) (-1077.032) (-1070.033) * (-1065.326) (-1060.766) (-1065.716) [-1066.500] -- 0:01:40
643000 -- (-1069.233) (-1068.952) (-1066.960) [-1062.984] * (-1063.880) (-1063.998) [-1061.332] (-1066.481) -- 0:01:40
643500 -- (-1071.225) [-1060.248] (-1067.420) (-1059.752) * (-1064.094) [-1066.571] (-1073.122) (-1060.081) -- 0:01:40
644000 -- (-1075.583) (-1072.211) (-1065.772) [-1066.685] * (-1069.093) (-1060.036) (-1068.217) [-1060.880] -- 0:01:40
644500 -- (-1063.747) [-1062.118] (-1063.550) (-1064.426) * (-1073.734) (-1065.579) (-1065.181) [-1060.058] -- 0:01:40
645000 -- (-1065.132) (-1061.618) (-1063.059) [-1061.595] * (-1065.009) (-1060.396) (-1065.999) [-1060.771] -- 0:01:40
Average standard deviation of split frequencies: 0.008585
645500 -- (-1072.237) (-1063.935) (-1061.666) [-1056.536] * [-1060.953] (-1067.393) (-1063.252) (-1066.636) -- 0:01:39
646000 -- [-1055.443] (-1064.873) (-1065.284) (-1067.653) * [-1060.248] (-1062.899) (-1062.762) (-1066.339) -- 0:01:39
646500 -- (-1063.982) (-1070.129) (-1066.567) [-1060.165] * [-1067.010] (-1064.034) (-1066.569) (-1066.929) -- 0:01:39
647000 -- (-1062.385) (-1066.772) [-1065.987] (-1068.215) * (-1063.859) (-1063.781) [-1059.318] (-1063.752) -- 0:01:39
647500 -- (-1068.403) (-1068.262) (-1066.915) [-1058.268] * [-1061.891] (-1067.862) (-1065.815) (-1071.585) -- 0:01:39
648000 -- (-1068.501) [-1064.350] (-1066.815) (-1071.188) * (-1064.923) [-1065.353] (-1070.265) (-1072.365) -- 0:01:39
648500 -- (-1073.761) (-1078.968) (-1065.362) [-1059.867] * [-1068.535] (-1058.723) (-1070.523) (-1060.729) -- 0:01:39
649000 -- (-1063.079) (-1067.710) (-1071.905) [-1061.109] * (-1060.382) (-1066.692) (-1073.202) [-1065.542] -- 0:01:38
649500 -- (-1063.539) (-1070.798) (-1070.210) [-1061.487] * (-1057.566) [-1060.861] (-1096.657) (-1060.189) -- 0:01:38
650000 -- [-1063.522] (-1066.257) (-1073.054) (-1058.859) * (-1063.684) (-1062.851) [-1077.970] (-1068.060) -- 0:01:38
Average standard deviation of split frequencies: 0.008140
650500 -- (-1075.468) (-1072.742) (-1072.242) [-1061.831] * (-1060.396) [-1063.099] (-1070.273) (-1070.258) -- 0:01:38
651000 -- [-1060.203] (-1062.833) (-1065.250) (-1062.519) * (-1080.737) [-1069.834] (-1068.816) (-1068.841) -- 0:01:38
651500 -- [-1061.601] (-1059.975) (-1071.211) (-1062.408) * [-1060.920] (-1068.366) (-1061.913) (-1064.330) -- 0:01:38
652000 -- (-1061.725) (-1063.900) [-1063.223] (-1065.789) * [-1068.989] (-1066.949) (-1064.874) (-1068.590) -- 0:01:38
652500 -- (-1061.179) [-1067.368] (-1058.754) (-1068.103) * [-1063.760] (-1066.786) (-1070.698) (-1072.682) -- 0:01:37
653000 -- (-1061.632) [-1064.467] (-1067.841) (-1055.305) * (-1059.284) (-1063.285) (-1054.667) [-1062.061] -- 0:01:37
653500 -- (-1070.027) (-1061.670) (-1061.463) [-1060.522] * (-1071.444) [-1054.697] (-1067.524) (-1058.078) -- 0:01:37
654000 -- (-1062.955) (-1060.755) (-1068.954) [-1059.984] * (-1068.246) [-1064.394] (-1073.642) (-1059.922) -- 0:01:37
654500 -- (-1070.278) [-1064.052] (-1066.013) (-1068.988) * (-1064.218) [-1058.279] (-1069.596) (-1063.748) -- 0:01:37
655000 -- (-1060.952) (-1071.153) (-1073.582) [-1060.715] * (-1068.939) [-1068.096] (-1069.076) (-1065.047) -- 0:01:37
Average standard deviation of split frequencies: 0.007905
655500 -- [-1062.490] (-1071.746) (-1064.044) (-1070.035) * [-1068.296] (-1072.775) (-1066.177) (-1067.435) -- 0:01:37
656000 -- [-1057.196] (-1066.117) (-1063.596) (-1064.126) * [-1076.182] (-1071.838) (-1060.817) (-1070.849) -- 0:01:37
656500 -- (-1077.957) (-1062.398) [-1064.429] (-1058.711) * [-1071.018] (-1065.555) (-1064.473) (-1069.372) -- 0:01:36
657000 -- (-1067.130) (-1068.149) [-1059.602] (-1064.082) * (-1068.037) (-1062.994) [-1059.316] (-1064.390) -- 0:01:36
657500 -- [-1061.510] (-1064.525) (-1068.290) (-1054.995) * (-1067.332) (-1060.432) [-1057.737] (-1069.255) -- 0:01:36
658000 -- (-1065.073) (-1063.625) (-1069.503) [-1061.044] * [-1063.871] (-1070.394) (-1064.640) (-1061.800) -- 0:01:36
658500 -- (-1070.698) (-1066.391) (-1065.452) [-1060.079] * (-1074.858) [-1063.320] (-1057.616) (-1060.919) -- 0:01:36
659000 -- (-1066.319) (-1060.580) (-1063.453) [-1061.845] * (-1069.817) (-1056.283) [-1057.576] (-1088.036) -- 0:01:36
659500 -- (-1061.769) (-1066.452) [-1055.072] (-1060.519) * (-1066.882) (-1063.637) [-1062.908] (-1073.872) -- 0:01:36
660000 -- (-1065.338) [-1062.714] (-1067.811) (-1070.725) * [-1063.762] (-1060.867) (-1066.506) (-1065.770) -- 0:01:35
Average standard deviation of split frequencies: 0.007933
660500 -- (-1074.067) (-1077.056) (-1060.319) [-1066.575] * (-1069.861) [-1067.776] (-1058.689) (-1066.679) -- 0:01:35
661000 -- (-1073.521) (-1072.143) (-1061.711) [-1061.101] * (-1072.539) [-1070.348] (-1063.352) (-1062.820) -- 0:01:35
661500 -- (-1078.986) (-1063.992) (-1063.573) [-1062.176] * (-1067.297) [-1057.370] (-1066.484) (-1067.594) -- 0:01:35
662000 -- [-1066.788] (-1064.926) (-1073.303) (-1065.241) * (-1068.277) [-1060.877] (-1064.677) (-1063.297) -- 0:01:35
662500 -- (-1058.568) (-1062.887) [-1063.256] (-1061.956) * (-1063.845) (-1062.742) [-1066.956] (-1055.067) -- 0:01:35
663000 -- [-1063.457] (-1062.880) (-1078.784) (-1065.903) * (-1067.925) (-1066.079) (-1068.886) [-1059.956] -- 0:01:35
663500 -- (-1064.467) [-1066.221] (-1069.879) (-1073.274) * [-1065.210] (-1075.213) (-1068.912) (-1071.287) -- 0:01:34
664000 -- (-1066.538) (-1075.040) [-1068.505] (-1066.027) * (-1065.364) (-1075.277) (-1065.713) [-1067.619] -- 0:01:34
664500 -- (-1057.899) [-1069.343] (-1064.457) (-1071.170) * [-1062.006] (-1061.262) (-1065.418) (-1067.542) -- 0:01:34
665000 -- (-1065.917) (-1065.671) [-1071.334] (-1064.258) * (-1061.196) [-1064.842] (-1069.819) (-1069.259) -- 0:01:34
Average standard deviation of split frequencies: 0.007828
665500 -- (-1074.001) (-1059.553) [-1063.750] (-1066.202) * (-1073.129) [-1059.792] (-1061.397) (-1064.800) -- 0:01:34
666000 -- (-1071.556) (-1067.167) (-1071.503) [-1062.015] * [-1064.803] (-1070.870) (-1072.267) (-1067.519) -- 0:01:34
666500 -- (-1064.067) (-1065.164) (-1071.599) [-1063.888] * (-1065.017) (-1058.835) [-1065.182] (-1069.131) -- 0:01:34
667000 -- [-1060.427] (-1063.878) (-1068.303) (-1074.383) * [-1055.326] (-1062.139) (-1065.375) (-1069.606) -- 0:01:33
667500 -- (-1070.415) [-1063.623] (-1072.218) (-1070.263) * (-1063.640) [-1061.353] (-1074.062) (-1065.983) -- 0:01:33
668000 -- [-1060.368] (-1061.629) (-1070.532) (-1073.593) * (-1067.257) (-1062.135) (-1068.933) [-1060.200] -- 0:01:33
668500 -- [-1061.849] (-1063.845) (-1065.373) (-1072.806) * (-1072.246) [-1061.767] (-1067.694) (-1065.398) -- 0:01:33
669000 -- (-1069.002) (-1064.854) [-1058.169] (-1080.829) * (-1064.466) (-1060.469) [-1068.808] (-1075.341) -- 0:01:33
669500 -- (-1062.502) [-1060.160] (-1064.637) (-1066.116) * (-1069.019) [-1065.291] (-1068.075) (-1080.857) -- 0:01:33
670000 -- (-1068.346) (-1063.432) [-1060.416] (-1069.977) * (-1066.426) [-1064.468] (-1063.914) (-1069.163) -- 0:01:33
Average standard deviation of split frequencies: 0.007939
670500 -- [-1062.667] (-1072.660) (-1066.932) (-1068.544) * (-1072.491) (-1061.907) [-1065.518] (-1070.618) -- 0:01:32
671000 -- (-1066.921) (-1078.521) [-1066.533] (-1066.445) * (-1065.283) (-1064.740) [-1061.380] (-1070.146) -- 0:01:32
671500 -- (-1061.014) (-1069.806) [-1069.540] (-1066.815) * (-1073.274) [-1070.554] (-1066.402) (-1069.617) -- 0:01:32
672000 -- (-1069.364) (-1069.781) [-1061.719] (-1073.556) * [-1066.071] (-1086.604) (-1066.608) (-1066.556) -- 0:01:32
672500 -- (-1066.433) (-1075.280) [-1063.743] (-1057.940) * (-1065.339) (-1081.681) [-1065.248] (-1072.908) -- 0:01:32
673000 -- (-1075.572) (-1079.077) [-1069.054] (-1060.266) * (-1071.106) (-1059.793) (-1065.094) [-1070.214] -- 0:01:32
673500 -- (-1063.195) (-1069.069) (-1066.710) [-1061.380] * (-1064.813) (-1064.067) [-1055.392] (-1066.464) -- 0:01:32
674000 -- (-1076.183) (-1065.258) [-1064.677] (-1063.185) * (-1067.879) (-1071.774) [-1058.344] (-1064.813) -- 0:01:31
674500 -- [-1071.548] (-1067.663) (-1066.175) (-1064.154) * (-1064.731) [-1064.421] (-1063.293) (-1065.677) -- 0:01:31
675000 -- (-1072.987) [-1062.729] (-1061.315) (-1064.842) * [-1066.807] (-1060.472) (-1063.223) (-1070.267) -- 0:01:31
Average standard deviation of split frequencies: 0.007384
675500 -- (-1063.272) (-1059.534) (-1067.734) [-1066.022] * (-1078.105) [-1063.202] (-1060.845) (-1072.454) -- 0:01:31
676000 -- (-1068.975) [-1060.391] (-1069.999) (-1074.772) * (-1075.887) (-1070.784) (-1069.540) [-1065.453] -- 0:01:31
676500 -- [-1062.928] (-1067.641) (-1064.572) (-1063.014) * (-1064.383) (-1069.842) [-1063.844] (-1061.628) -- 0:01:31
677000 -- (-1065.159) [-1062.538] (-1075.763) (-1072.921) * (-1071.664) [-1064.975] (-1071.993) (-1073.545) -- 0:01:31
677500 -- (-1069.176) (-1071.368) (-1060.666) [-1057.574] * (-1075.863) (-1061.616) [-1058.907] (-1061.919) -- 0:01:30
678000 -- (-1068.571) (-1064.872) (-1065.528) [-1064.069] * (-1067.266) (-1064.050) (-1065.413) [-1062.467] -- 0:01:30
678500 -- (-1060.362) (-1068.704) [-1058.825] (-1064.371) * [-1062.691] (-1062.525) (-1067.195) (-1062.368) -- 0:01:30
679000 -- [-1071.993] (-1065.446) (-1067.460) (-1064.492) * [-1059.438] (-1073.256) (-1068.696) (-1058.573) -- 0:01:30
679500 -- [-1055.667] (-1065.011) (-1077.518) (-1064.798) * (-1065.867) [-1062.689] (-1066.135) (-1068.072) -- 0:01:30
680000 -- (-1064.104) (-1063.714) (-1070.956) [-1057.253] * (-1068.579) (-1073.527) (-1067.906) [-1067.925] -- 0:01:30
Average standard deviation of split frequencies: 0.007455
680500 -- (-1072.611) [-1058.912] (-1060.207) (-1078.438) * (-1066.116) (-1068.962) [-1059.101] (-1060.485) -- 0:01:30
681000 -- (-1064.556) (-1057.660) [-1062.257] (-1068.914) * (-1066.731) [-1069.215] (-1064.672) (-1066.253) -- 0:01:29
681500 -- (-1067.721) [-1065.746] (-1064.288) (-1072.306) * (-1067.407) (-1063.969) (-1064.626) [-1060.485] -- 0:01:29
682000 -- (-1064.435) (-1064.070) [-1066.688] (-1068.470) * (-1058.948) [-1059.463] (-1057.621) (-1060.546) -- 0:01:29
682500 -- (-1065.000) [-1063.673] (-1063.611) (-1063.542) * [-1058.539] (-1061.161) (-1073.303) (-1066.500) -- 0:01:29
683000 -- (-1062.614) (-1058.735) (-1060.321) [-1073.235] * (-1074.451) [-1065.026] (-1070.847) (-1061.889) -- 0:01:29
683500 -- (-1061.879) [-1066.068] (-1060.358) (-1062.356) * [-1062.774] (-1068.623) (-1065.575) (-1068.509) -- 0:01:29
684000 -- (-1070.163) (-1071.646) (-1069.446) [-1059.432] * (-1068.906) (-1070.948) [-1070.611] (-1068.741) -- 0:01:29
684500 -- [-1064.338] (-1073.890) (-1061.914) (-1067.117) * (-1069.614) [-1064.698] (-1062.873) (-1064.015) -- 0:01:28
685000 -- (-1062.559) (-1066.944) (-1063.939) [-1061.142] * (-1065.199) (-1065.823) (-1066.356) [-1060.172] -- 0:01:28
Average standard deviation of split frequencies: 0.007680
685500 -- (-1058.653) (-1068.703) [-1065.165] (-1065.654) * (-1078.942) (-1068.652) [-1059.641] (-1062.173) -- 0:01:29
686000 -- (-1063.292) (-1061.252) (-1067.847) [-1062.398] * (-1073.469) (-1066.800) [-1063.358] (-1076.560) -- 0:01:28
686500 -- (-1070.569) (-1065.873) [-1064.005] (-1069.169) * (-1070.685) (-1062.312) [-1066.864] (-1067.516) -- 0:01:28
687000 -- (-1063.588) [-1062.534] (-1066.189) (-1064.201) * [-1059.522] (-1082.748) (-1058.333) (-1077.867) -- 0:01:28
687500 -- (-1070.327) [-1060.416] (-1067.045) (-1063.204) * [-1061.020] (-1078.070) (-1066.895) (-1059.885) -- 0:01:28
688000 -- (-1069.876) [-1063.727] (-1072.532) (-1064.662) * [-1063.769] (-1070.401) (-1065.336) (-1058.105) -- 0:01:27
688500 -- (-1066.296) (-1069.455) (-1060.740) [-1062.861] * (-1071.679) (-1059.798) (-1067.376) [-1062.158] -- 0:01:27
689000 -- (-1073.416) (-1062.067) [-1063.618] (-1064.093) * (-1068.956) (-1067.771) [-1058.845] (-1082.320) -- 0:01:28
689500 -- [-1066.286] (-1064.093) (-1073.620) (-1070.072) * (-1064.830) (-1053.799) (-1070.378) [-1063.641] -- 0:01:27
690000 -- (-1064.392) [-1070.323] (-1070.146) (-1071.223) * (-1064.903) (-1064.108) [-1065.248] (-1069.832) -- 0:01:27
Average standard deviation of split frequencies: 0.007789
690500 -- (-1069.468) (-1061.959) [-1060.348] (-1076.068) * (-1067.164) (-1063.217) [-1064.773] (-1068.771) -- 0:01:27
691000 -- (-1056.389) (-1073.148) (-1066.126) [-1057.112] * (-1069.096) (-1067.596) (-1063.900) [-1067.185] -- 0:01:27
691500 -- (-1066.599) [-1060.371] (-1065.722) (-1063.592) * (-1064.425) (-1080.051) (-1063.549) [-1065.039] -- 0:01:26
692000 -- (-1062.585) (-1064.772) [-1064.040] (-1062.753) * [-1070.382] (-1075.459) (-1071.005) (-1068.825) -- 0:01:26
692500 -- (-1070.816) (-1066.769) (-1068.427) [-1063.041] * (-1063.599) [-1074.359] (-1060.056) (-1066.929) -- 0:01:26
693000 -- (-1075.066) (-1064.936) [-1071.260] (-1064.869) * (-1062.437) (-1076.555) (-1063.027) [-1064.513] -- 0:01:26
693500 -- (-1073.560) (-1075.190) [-1062.715] (-1056.266) * (-1072.146) (-1067.761) (-1063.693) [-1064.741] -- 0:01:26
694000 -- (-1062.236) (-1068.612) (-1071.304) [-1055.843] * (-1069.673) (-1069.263) [-1061.447] (-1073.719) -- 0:01:26
694500 -- [-1061.841] (-1064.253) (-1065.375) (-1068.332) * [-1065.999] (-1070.129) (-1056.731) (-1061.441) -- 0:01:26
695000 -- (-1066.799) (-1073.700) [-1064.902] (-1065.971) * (-1074.209) (-1064.152) [-1062.300] (-1068.994) -- 0:01:26
Average standard deviation of split frequencies: 0.007928
695500 -- (-1060.942) [-1067.406] (-1065.356) (-1076.076) * (-1062.474) (-1064.231) (-1068.391) [-1064.554] -- 0:01:25
696000 -- (-1063.642) [-1068.315] (-1058.849) (-1064.716) * [-1068.371] (-1062.272) (-1069.156) (-1075.178) -- 0:01:26
696500 -- (-1059.430) (-1059.439) (-1058.830) [-1067.188] * (-1066.532) [-1065.955] (-1059.462) (-1071.232) -- 0:01:25
697000 -- (-1062.737) (-1076.430) (-1060.265) [-1057.764] * (-1061.198) (-1077.066) (-1067.341) [-1061.752] -- 0:01:25
697500 -- (-1073.731) [-1065.894] (-1064.192) (-1067.461) * (-1067.701) (-1064.315) [-1069.203] (-1063.397) -- 0:01:25
698000 -- (-1067.106) (-1068.384) (-1066.847) [-1060.519] * [-1061.920] (-1068.744) (-1077.336) (-1061.898) -- 0:01:25
698500 -- (-1076.240) (-1068.791) [-1058.477] (-1059.034) * [-1064.735] (-1065.396) (-1070.134) (-1061.275) -- 0:01:25
699000 -- (-1071.699) (-1073.664) [-1060.999] (-1065.288) * (-1065.867) [-1058.318] (-1073.921) (-1065.550) -- 0:01:24
699500 -- (-1073.681) (-1073.338) (-1061.808) [-1063.170] * [-1065.180] (-1072.654) (-1059.487) (-1065.009) -- 0:01:25
700000 -- (-1065.406) (-1078.440) [-1067.393] (-1060.816) * (-1067.540) (-1067.594) [-1058.578] (-1067.360) -- 0:01:24
Average standard deviation of split frequencies: 0.008469
700500 -- (-1062.774) (-1061.364) [-1061.469] (-1068.778) * (-1060.708) (-1062.158) (-1064.129) [-1062.718] -- 0:01:24
701000 -- (-1065.044) [-1065.768] (-1062.612) (-1074.223) * (-1062.696) (-1059.702) (-1063.042) [-1066.937] -- 0:01:24
701500 -- (-1060.340) (-1066.604) [-1064.507] (-1074.783) * [-1066.846] (-1068.633) (-1071.250) (-1065.470) -- 0:01:24
702000 -- [-1063.196] (-1066.153) (-1062.603) (-1072.452) * (-1077.156) [-1056.338] (-1069.089) (-1061.389) -- 0:01:24
702500 -- (-1066.379) (-1059.001) (-1060.324) [-1068.557] * (-1067.022) [-1068.932] (-1067.819) (-1062.367) -- 0:01:23
703000 -- (-1068.642) (-1064.657) (-1060.053) [-1072.868] * (-1071.701) (-1060.356) [-1061.650] (-1063.773) -- 0:01:23
703500 -- (-1070.077) [-1061.401] (-1066.161) (-1071.268) * (-1072.093) (-1064.687) [-1057.586] (-1069.671) -- 0:01:23
704000 -- (-1066.655) (-1068.989) (-1071.346) [-1065.181] * (-1062.753) [-1063.112] (-1066.699) (-1071.917) -- 0:01:23
704500 -- (-1057.082) (-1060.469) [-1063.451] (-1076.366) * [-1064.336] (-1070.742) (-1056.572) (-1061.414) -- 0:01:23
705000 -- (-1060.711) (-1063.553) [-1063.076] (-1064.363) * (-1064.237) (-1071.322) (-1067.691) [-1060.109] -- 0:01:23
Average standard deviation of split frequencies: 0.008562
705500 -- (-1061.024) (-1061.672) [-1058.591] (-1065.638) * (-1062.793) (-1065.305) (-1060.429) [-1064.513] -- 0:01:23
706000 -- (-1067.235) (-1058.768) (-1065.249) [-1063.431] * [-1057.131] (-1074.167) (-1062.427) (-1064.984) -- 0:01:22
706500 -- [-1061.073] (-1061.342) (-1062.055) (-1065.945) * (-1066.051) [-1064.128] (-1064.850) (-1073.684) -- 0:01:22
707000 -- (-1069.925) (-1060.375) (-1059.043) [-1071.175] * [-1056.457] (-1066.713) (-1064.953) (-1064.912) -- 0:01:22
707500 -- (-1078.514) (-1063.732) (-1070.475) [-1064.870] * [-1058.797] (-1057.095) (-1061.229) (-1081.232) -- 0:01:22
708000 -- (-1068.008) [-1057.630] (-1071.827) (-1066.530) * (-1061.227) (-1059.700) [-1060.488] (-1060.108) -- 0:01:22
708500 -- (-1062.335) (-1062.890) (-1071.149) [-1066.541] * (-1056.869) (-1071.590) [-1066.902] (-1066.489) -- 0:01:22
709000 -- (-1063.459) (-1056.774) [-1060.034] (-1080.605) * [-1059.590] (-1074.064) (-1063.903) (-1076.557) -- 0:01:22
709500 -- [-1069.276] (-1061.997) (-1073.603) (-1069.028) * [-1065.476] (-1069.505) (-1069.698) (-1074.303) -- 0:01:21
710000 -- (-1061.825) [-1057.842] (-1069.778) (-1071.738) * (-1068.904) (-1076.273) [-1065.511] (-1070.021) -- 0:01:21
Average standard deviation of split frequencies: 0.008389
710500 -- [-1056.140] (-1070.434) (-1066.737) (-1074.899) * (-1068.650) (-1074.733) (-1066.727) [-1063.274] -- 0:01:21
711000 -- [-1057.122] (-1060.639) (-1064.348) (-1064.221) * (-1069.313) (-1072.150) (-1067.503) [-1058.619] -- 0:01:21
711500 -- (-1063.482) (-1062.294) [-1062.516] (-1066.041) * (-1067.904) [-1065.578] (-1068.000) (-1067.093) -- 0:01:21
712000 -- (-1072.149) (-1056.176) [-1056.616] (-1067.049) * (-1065.311) [-1056.139] (-1066.319) (-1062.743) -- 0:01:21
712500 -- (-1070.280) [-1057.916] (-1070.346) (-1066.525) * [-1068.109] (-1070.387) (-1069.936) (-1059.274) -- 0:01:21
713000 -- (-1074.002) (-1074.820) (-1056.747) [-1059.894] * [-1070.945] (-1068.056) (-1067.375) (-1067.642) -- 0:01:20
713500 -- [-1064.057] (-1058.647) (-1066.915) (-1076.116) * (-1068.749) [-1060.757] (-1065.021) (-1072.700) -- 0:01:20
714000 -- (-1060.053) (-1067.394) (-1061.838) [-1067.026] * (-1071.756) (-1073.485) (-1068.542) [-1065.764] -- 0:01:20
714500 -- (-1079.480) (-1062.574) (-1062.815) [-1060.786] * (-1062.699) (-1066.223) [-1067.040] (-1067.272) -- 0:01:20
715000 -- (-1067.917) [-1059.980] (-1069.267) (-1069.842) * [-1077.492] (-1063.730) (-1065.356) (-1063.065) -- 0:01:20
Average standard deviation of split frequencies: 0.008636
715500 -- (-1063.235) (-1069.004) (-1061.602) [-1061.136] * (-1067.300) [-1059.986] (-1070.912) (-1068.831) -- 0:01:20
716000 -- (-1069.731) [-1059.384] (-1067.603) (-1066.262) * [-1063.497] (-1067.789) (-1068.388) (-1063.411) -- 0:01:20
716500 -- [-1063.457] (-1061.718) (-1087.171) (-1074.472) * (-1072.641) (-1066.826) [-1065.101] (-1061.722) -- 0:01:19
717000 -- (-1063.904) [-1063.130] (-1071.970) (-1072.182) * (-1061.619) (-1066.026) [-1060.469] (-1074.718) -- 0:01:19
717500 -- (-1083.597) [-1065.079] (-1073.422) (-1070.893) * (-1062.091) (-1064.663) [-1059.300] (-1075.977) -- 0:01:19
718000 -- (-1064.451) [-1070.560] (-1065.531) (-1068.355) * (-1068.955) [-1061.035] (-1059.009) (-1071.487) -- 0:01:19
718500 -- (-1063.214) (-1073.780) (-1066.005) [-1068.492] * (-1068.249) (-1064.715) [-1065.684] (-1076.621) -- 0:01:19
719000 -- (-1074.233) [-1064.170] (-1073.357) (-1062.938) * [-1059.290] (-1072.079) (-1066.666) (-1076.868) -- 0:01:19
719500 -- (-1072.864) (-1060.058) [-1056.398] (-1068.241) * (-1064.860) (-1055.953) (-1082.207) [-1062.924] -- 0:01:19
720000 -- (-1060.654) (-1065.093) (-1059.995) [-1061.636] * (-1068.982) (-1075.810) [-1064.486] (-1060.237) -- 0:01:18
Average standard deviation of split frequencies: 0.008965
720500 -- (-1060.154) (-1063.586) [-1066.114] (-1068.722) * (-1063.743) [-1061.333] (-1066.144) (-1081.589) -- 0:01:18
721000 -- (-1060.885) [-1068.200] (-1063.247) (-1060.654) * (-1064.505) [-1059.786] (-1062.128) (-1065.264) -- 0:01:18
721500 -- (-1070.566) (-1064.917) [-1061.325] (-1063.132) * [-1057.075] (-1069.036) (-1069.886) (-1068.121) -- 0:01:18
722000 -- (-1071.831) [-1073.755] (-1064.314) (-1064.137) * [-1064.766] (-1067.951) (-1072.575) (-1072.189) -- 0:01:18
722500 -- (-1067.232) (-1060.576) (-1062.231) [-1061.013] * [-1060.955] (-1061.489) (-1066.562) (-1073.458) -- 0:01:18
723000 -- (-1068.120) (-1067.939) (-1067.082) [-1064.722] * [-1058.565] (-1056.904) (-1074.124) (-1078.854) -- 0:01:18
723500 -- (-1061.932) (-1068.816) [-1063.910] (-1072.252) * (-1068.002) [-1064.591] (-1066.520) (-1062.243) -- 0:01:17
724000 -- (-1079.050) (-1063.124) [-1062.002] (-1064.822) * (-1074.416) [-1060.327] (-1066.928) (-1062.961) -- 0:01:17
724500 -- (-1070.634) [-1067.904] (-1073.426) (-1067.332) * [-1067.159] (-1062.859) (-1067.907) (-1066.973) -- 0:01:17
725000 -- (-1072.597) [-1065.045] (-1079.632) (-1065.784) * (-1071.409) (-1066.927) (-1067.885) [-1063.601] -- 0:01:17
Average standard deviation of split frequencies: 0.009129
725500 -- (-1061.744) (-1059.780) (-1076.626) [-1064.742] * (-1057.163) (-1067.644) (-1078.488) [-1062.019] -- 0:01:17
726000 -- (-1068.013) (-1068.367) (-1066.493) [-1054.896] * (-1068.981) (-1064.253) [-1059.651] (-1065.571) -- 0:01:17
726500 -- (-1062.942) (-1061.861) [-1061.136] (-1067.778) * (-1068.800) (-1064.412) (-1069.605) [-1068.483] -- 0:01:17
727000 -- [-1059.575] (-1062.650) (-1062.065) (-1068.784) * [-1057.641] (-1072.006) (-1069.562) (-1071.358) -- 0:01:16
727500 -- [-1059.920] (-1066.616) (-1061.519) (-1071.064) * [-1061.259] (-1058.626) (-1075.665) (-1074.680) -- 0:01:16
728000 -- [-1066.524] (-1064.563) (-1063.102) (-1064.886) * [-1056.068] (-1063.610) (-1070.570) (-1070.537) -- 0:01:16
728500 -- (-1061.477) (-1060.067) [-1059.685] (-1068.178) * [-1052.274] (-1066.606) (-1057.518) (-1064.690) -- 0:01:16
729000 -- (-1064.558) [-1062.421] (-1072.102) (-1057.794) * (-1062.033) [-1060.036] (-1057.501) (-1067.197) -- 0:01:16
729500 -- [-1059.474] (-1068.167) (-1057.411) (-1063.769) * (-1067.566) (-1063.689) [-1057.704] (-1071.909) -- 0:01:16
730000 -- (-1069.002) (-1066.285) (-1061.036) [-1072.044] * [-1061.305] (-1070.763) (-1067.548) (-1070.848) -- 0:01:16
Average standard deviation of split frequencies: 0.009032
730500 -- (-1062.059) [-1071.830] (-1070.339) (-1072.632) * (-1060.166) (-1071.190) (-1064.785) [-1058.684] -- 0:01:15
731000 -- (-1066.972) [-1061.555] (-1067.559) (-1071.675) * [-1066.039] (-1063.127) (-1074.383) (-1066.883) -- 0:01:15
731500 -- (-1070.495) (-1066.977) (-1064.754) [-1065.837] * (-1064.185) [-1058.467] (-1063.055) (-1062.114) -- 0:01:15
732000 -- [-1060.434] (-1062.270) (-1075.217) (-1073.075) * (-1062.774) (-1069.874) [-1065.746] (-1073.775) -- 0:01:15
732500 -- [-1060.574] (-1074.239) (-1067.990) (-1067.598) * (-1054.518) [-1057.655] (-1065.936) (-1071.811) -- 0:01:15
733000 -- [-1061.724] (-1067.144) (-1072.280) (-1061.769) * (-1066.500) (-1062.979) [-1060.280] (-1067.386) -- 0:01:15
733500 -- [-1058.284] (-1069.042) (-1064.020) (-1068.978) * (-1071.271) (-1061.228) [-1063.530] (-1070.147) -- 0:01:15
734000 -- (-1071.417) (-1064.831) [-1064.721] (-1078.042) * (-1073.574) (-1063.195) [-1061.895] (-1060.931) -- 0:01:15
734500 -- [-1079.194] (-1076.527) (-1069.984) (-1063.046) * (-1068.774) (-1069.743) (-1063.690) [-1063.114] -- 0:01:14
735000 -- (-1062.910) (-1076.172) [-1057.570] (-1075.496) * (-1057.768) (-1068.993) (-1078.625) [-1063.155] -- 0:01:14
Average standard deviation of split frequencies: 0.008628
735500 -- (-1062.408) (-1072.474) [-1053.028] (-1060.999) * (-1056.489) [-1070.880] (-1069.352) (-1067.381) -- 0:01:14
736000 -- (-1058.960) [-1062.605] (-1066.258) (-1077.043) * (-1062.419) (-1069.778) (-1065.990) [-1060.310] -- 0:01:14
736500 -- (-1068.508) (-1057.859) [-1062.954] (-1072.082) * (-1061.437) (-1067.764) (-1076.289) [-1068.113] -- 0:01:14
737000 -- [-1058.390] (-1066.940) (-1058.327) (-1057.008) * (-1064.284) (-1069.077) (-1078.226) [-1063.975] -- 0:01:14
737500 -- (-1071.346) (-1069.907) [-1059.421] (-1068.183) * (-1060.686) (-1070.569) (-1062.204) [-1074.416] -- 0:01:14
738000 -- (-1069.205) (-1065.257) (-1065.987) [-1064.497] * (-1062.151) (-1064.840) [-1073.245] (-1066.769) -- 0:01:13
738500 -- (-1066.512) [-1062.214] (-1076.190) (-1059.510) * (-1060.569) (-1064.896) [-1060.368] (-1074.152) -- 0:01:13
739000 -- [-1056.686] (-1074.743) (-1069.094) (-1064.450) * [-1061.132] (-1064.601) (-1064.716) (-1069.747) -- 0:01:13
739500 -- (-1071.802) (-1064.478) [-1057.792] (-1061.291) * (-1059.865) [-1060.711] (-1064.781) (-1069.322) -- 0:01:13
740000 -- (-1075.469) (-1062.333) (-1068.103) [-1060.201] * (-1061.645) [-1065.510] (-1063.886) (-1070.326) -- 0:01:13
Average standard deviation of split frequencies: 0.009023
740500 -- (-1066.686) (-1057.957) (-1062.662) [-1068.287] * (-1056.164) [-1062.284] (-1072.872) (-1075.646) -- 0:01:13
741000 -- [-1065.369] (-1066.473) (-1065.345) (-1070.684) * (-1062.511) [-1060.679] (-1069.751) (-1063.526) -- 0:01:13
741500 -- [-1065.164] (-1063.678) (-1065.436) (-1061.826) * (-1063.410) [-1061.566] (-1073.057) (-1072.555) -- 0:01:12
742000 -- (-1068.020) [-1070.318] (-1064.160) (-1065.096) * (-1065.728) (-1066.635) (-1073.272) [-1071.357] -- 0:01:12
742500 -- (-1064.650) (-1078.243) [-1060.411] (-1070.604) * (-1064.915) [-1063.941] (-1070.816) (-1064.729) -- 0:01:12
743000 -- (-1065.775) (-1074.864) [-1067.564] (-1068.870) * (-1067.575) [-1065.120] (-1062.586) (-1074.782) -- 0:01:12
743500 -- (-1062.181) (-1065.559) (-1064.432) [-1064.497] * (-1073.174) [-1060.407] (-1061.018) (-1064.262) -- 0:01:12
744000 -- (-1062.703) (-1060.475) (-1076.749) [-1057.675] * (-1066.077) [-1061.470] (-1074.636) (-1063.457) -- 0:01:12
744500 -- (-1060.970) [-1058.194] (-1075.479) (-1068.139) * (-1076.930) [-1062.304] (-1071.571) (-1071.791) -- 0:01:12
745000 -- (-1059.013) [-1062.280] (-1074.694) (-1069.371) * (-1070.066) (-1061.640) (-1069.640) [-1057.817] -- 0:01:11
Average standard deviation of split frequencies: 0.008810
745500 -- (-1067.908) (-1068.629) [-1063.137] (-1058.764) * (-1065.059) (-1062.018) [-1062.556] (-1070.188) -- 0:01:11
746000 -- (-1061.258) [-1062.368] (-1068.215) (-1065.191) * (-1062.599) [-1063.641] (-1066.648) (-1068.361) -- 0:01:11
746500 -- (-1068.110) [-1065.101] (-1062.278) (-1070.949) * (-1065.546) [-1064.366] (-1072.983) (-1063.804) -- 0:01:11
747000 -- (-1059.203) [-1070.846] (-1070.920) (-1069.489) * [-1064.204] (-1068.158) (-1060.722) (-1068.175) -- 0:01:11
747500 -- [-1065.790] (-1062.984) (-1072.366) (-1062.523) * (-1074.072) [-1060.912] (-1069.478) (-1069.114) -- 0:01:11
748000 -- (-1070.117) [-1060.581] (-1060.564) (-1071.522) * (-1067.185) (-1062.785) (-1067.719) [-1067.925] -- 0:01:11
748500 -- (-1066.310) (-1078.187) [-1061.460] (-1067.319) * (-1059.167) [-1064.844] (-1065.642) (-1071.521) -- 0:01:10
749000 -- [-1061.860] (-1066.838) (-1059.312) (-1064.683) * (-1057.509) (-1077.908) (-1080.852) [-1055.384] -- 0:01:10
749500 -- (-1069.212) [-1054.324] (-1064.226) (-1067.277) * [-1063.082] (-1060.801) (-1071.422) (-1063.844) -- 0:01:10
750000 -- (-1065.564) (-1063.494) (-1069.017) [-1066.306] * (-1064.410) [-1063.234] (-1066.105) (-1065.577) -- 0:01:10
Average standard deviation of split frequencies: 0.008903
750500 -- (-1068.115) [-1066.153] (-1064.598) (-1067.023) * (-1064.277) (-1067.346) (-1067.413) [-1061.260] -- 0:01:10
751000 -- (-1061.795) [-1062.414] (-1062.339) (-1067.928) * [-1061.104] (-1060.308) (-1066.086) (-1068.293) -- 0:01:10
751500 -- (-1076.184) (-1069.131) [-1060.960] (-1066.683) * (-1065.290) (-1071.466) (-1059.812) [-1059.816] -- 0:01:10
752000 -- (-1069.981) (-1065.661) (-1069.041) [-1063.242] * [-1063.046] (-1062.519) (-1063.302) (-1059.368) -- 0:01:09
752500 -- [-1064.656] (-1065.472) (-1068.874) (-1067.066) * (-1057.329) (-1068.701) (-1062.669) [-1062.080] -- 0:01:09
753000 -- (-1074.099) (-1065.400) [-1070.513] (-1071.462) * [-1063.571] (-1073.221) (-1065.904) (-1058.422) -- 0:01:09
753500 -- (-1070.001) (-1062.391) (-1063.455) [-1064.938] * [-1068.969] (-1072.973) (-1058.432) (-1072.107) -- 0:01:09
754000 -- (-1069.229) (-1065.208) (-1061.538) [-1058.476] * (-1077.175) (-1062.642) [-1061.934] (-1067.295) -- 0:01:09
754500 -- [-1068.940] (-1064.873) (-1078.396) (-1059.558) * (-1067.940) (-1068.140) (-1064.055) [-1063.462] -- 0:01:09
755000 -- (-1066.945) (-1064.899) [-1058.801] (-1072.309) * [-1061.560] (-1069.776) (-1068.343) (-1061.490) -- 0:01:09
Average standard deviation of split frequencies: 0.008180
755500 -- (-1064.773) [-1070.568] (-1064.317) (-1066.074) * (-1074.444) [-1065.986] (-1071.384) (-1065.610) -- 0:01:08
756000 -- (-1070.782) [-1064.235] (-1057.778) (-1067.409) * (-1067.465) (-1066.849) (-1063.182) [-1066.657] -- 0:01:08
756500 -- [-1064.020] (-1061.312) (-1070.099) (-1057.859) * [-1063.620] (-1065.910) (-1063.616) (-1059.383) -- 0:01:08
757000 -- (-1067.030) (-1077.920) [-1064.782] (-1081.272) * (-1060.237) (-1072.656) (-1062.279) [-1063.313] -- 0:01:08
757500 -- (-1057.364) (-1067.853) [-1061.058] (-1065.951) * [-1067.950] (-1070.426) (-1065.535) (-1066.571) -- 0:01:08
758000 -- (-1058.557) [-1062.820] (-1068.233) (-1066.886) * (-1069.474) (-1057.294) [-1058.772] (-1067.438) -- 0:01:08
758500 -- [-1058.063] (-1071.328) (-1064.451) (-1061.899) * (-1073.875) (-1067.429) [-1061.322] (-1067.887) -- 0:01:08
759000 -- [-1057.562] (-1065.790) (-1063.839) (-1067.505) * (-1062.306) (-1063.594) (-1064.576) [-1064.589] -- 0:01:07
759500 -- (-1056.093) (-1061.929) [-1069.488] (-1076.073) * (-1060.339) [-1064.542] (-1062.367) (-1063.722) -- 0:01:07
760000 -- (-1064.415) [-1059.531] (-1069.380) (-1065.048) * [-1060.525] (-1075.329) (-1068.109) (-1067.384) -- 0:01:07
Average standard deviation of split frequencies: 0.008056
760500 -- (-1074.397) (-1067.426) [-1061.408] (-1067.232) * (-1062.242) (-1059.375) [-1062.437] (-1071.301) -- 0:01:07
761000 -- (-1063.075) (-1062.690) [-1059.603] (-1078.609) * (-1067.742) [-1063.193] (-1063.073) (-1071.566) -- 0:01:07
761500 -- [-1065.375] (-1066.083) (-1069.030) (-1061.764) * (-1070.470) (-1058.945) [-1058.488] (-1058.762) -- 0:01:07
762000 -- (-1054.037) (-1073.506) [-1061.933] (-1064.706) * (-1070.041) [-1065.020] (-1066.651) (-1060.940) -- 0:01:07
762500 -- (-1071.076) [-1062.545] (-1064.407) (-1059.924) * [-1064.541] (-1077.475) (-1058.526) (-1064.131) -- 0:01:06
763000 -- (-1065.908) (-1061.626) (-1069.535) [-1060.917] * (-1067.995) [-1063.993] (-1070.456) (-1072.855) -- 0:01:06
763500 -- (-1071.621) (-1069.461) (-1059.502) [-1065.372] * (-1069.703) [-1060.963] (-1062.453) (-1067.904) -- 0:01:06
764000 -- (-1059.763) (-1072.909) [-1061.053] (-1074.027) * (-1067.863) (-1060.692) (-1068.402) [-1063.572] -- 0:01:06
764500 -- [-1064.462] (-1071.437) (-1066.386) (-1070.404) * (-1063.693) [-1061.763] (-1064.122) (-1063.851) -- 0:01:06
765000 -- (-1068.017) (-1079.235) [-1060.431] (-1064.073) * (-1069.872) (-1059.911) [-1061.436] (-1063.387) -- 0:01:06
Average standard deviation of split frequencies: 0.008362
765500 -- [-1071.768] (-1060.505) (-1066.641) (-1067.333) * (-1065.453) (-1071.647) [-1055.686] (-1076.550) -- 0:01:06
766000 -- [-1073.922] (-1065.188) (-1063.434) (-1065.108) * (-1061.143) [-1069.726] (-1070.394) (-1066.589) -- 0:01:05
766500 -- (-1073.406) [-1060.467] (-1066.738) (-1070.020) * (-1075.019) [-1067.239] (-1065.562) (-1066.133) -- 0:01:05
767000 -- (-1066.513) (-1063.004) (-1073.356) [-1062.835] * [-1070.356] (-1069.475) (-1067.548) (-1060.918) -- 0:01:05
767500 -- (-1065.867) [-1063.535] (-1068.768) (-1065.366) * (-1067.712) (-1066.316) (-1074.491) [-1063.437] -- 0:01:05
768000 -- (-1070.647) (-1061.906) (-1069.269) [-1061.977] * (-1063.795) [-1060.182] (-1071.149) (-1062.252) -- 0:01:05
768500 -- (-1063.482) (-1071.260) [-1061.188] (-1060.957) * (-1067.220) [-1066.973] (-1060.494) (-1059.398) -- 0:01:05
769000 -- (-1065.307) (-1073.774) (-1065.897) [-1062.735] * (-1065.307) [-1062.309] (-1065.967) (-1068.576) -- 0:01:05
769500 -- (-1065.485) [-1057.064] (-1062.493) (-1065.406) * (-1057.304) (-1061.664) (-1071.005) [-1060.376] -- 0:01:05
770000 -- (-1070.298) (-1059.880) (-1070.237) [-1060.922] * [-1059.716] (-1064.247) (-1063.276) (-1062.185) -- 0:01:04
Average standard deviation of split frequencies: 0.008240
770500 -- (-1060.881) (-1062.896) [-1061.979] (-1069.860) * [-1058.852] (-1077.194) (-1061.060) (-1065.437) -- 0:01:04
771000 -- (-1074.149) (-1067.654) [-1063.031] (-1064.484) * (-1062.674) (-1071.241) [-1057.618] (-1074.860) -- 0:01:04
771500 -- (-1066.492) (-1063.149) (-1065.275) [-1066.628] * (-1064.647) (-1071.833) [-1061.488] (-1067.306) -- 0:01:04
772000 -- (-1063.053) (-1068.123) [-1065.822] (-1059.571) * [-1066.138] (-1063.086) (-1062.691) (-1064.519) -- 0:01:04
772500 -- (-1067.399) (-1071.845) (-1074.719) [-1063.147] * [-1068.462] (-1070.776) (-1061.214) (-1067.791) -- 0:01:04
773000 -- (-1068.381) (-1061.500) (-1070.953) [-1059.550] * [-1066.766] (-1064.971) (-1068.533) (-1067.479) -- 0:01:04
773500 -- (-1068.967) (-1063.818) (-1076.984) [-1063.498] * (-1059.878) (-1066.075) (-1065.685) [-1061.608] -- 0:01:03
774000 -- (-1059.999) (-1072.839) (-1064.049) [-1062.694] * (-1061.978) [-1056.793] (-1072.994) (-1062.709) -- 0:01:03
774500 -- (-1064.359) (-1068.772) (-1072.186) [-1066.508] * [-1059.609] (-1063.543) (-1073.127) (-1065.161) -- 0:01:03
775000 -- [-1078.067] (-1072.436) (-1062.251) (-1073.673) * [-1061.715] (-1064.905) (-1060.256) (-1061.555) -- 0:01:03
Average standard deviation of split frequencies: 0.008040
775500 -- [-1063.274] (-1060.880) (-1060.392) (-1070.624) * (-1068.769) (-1060.765) [-1065.939] (-1061.565) -- 0:01:03
776000 -- [-1066.368] (-1067.723) (-1074.311) (-1079.068) * [-1062.052] (-1070.400) (-1070.905) (-1064.383) -- 0:01:03
776500 -- [-1064.648] (-1072.884) (-1067.611) (-1077.619) * (-1077.600) (-1060.105) [-1062.711] (-1069.931) -- 0:01:03
777000 -- (-1076.282) [-1065.669] (-1060.298) (-1076.188) * (-1069.226) (-1071.689) [-1061.601] (-1066.113) -- 0:01:02
777500 -- (-1059.374) (-1066.793) [-1062.239] (-1071.631) * (-1066.478) [-1062.948] (-1059.179) (-1062.714) -- 0:01:02
778000 -- (-1062.682) (-1066.138) (-1072.381) [-1069.757] * (-1072.334) [-1064.918] (-1060.804) (-1069.811) -- 0:01:02
778500 -- (-1066.919) [-1059.353] (-1073.528) (-1073.461) * [-1062.352] (-1061.987) (-1066.431) (-1057.402) -- 0:01:02
779000 -- (-1070.994) (-1069.445) [-1069.721] (-1082.489) * [-1060.558] (-1062.761) (-1073.658) (-1059.663) -- 0:01:02
779500 -- (-1062.373) [-1061.095] (-1065.402) (-1070.017) * (-1077.486) [-1065.343] (-1061.219) (-1066.720) -- 0:01:02
780000 -- (-1075.514) [-1062.622] (-1071.452) (-1069.557) * (-1071.540) (-1063.243) (-1068.015) [-1064.667] -- 0:01:02
Average standard deviation of split frequencies: 0.007992
780500 -- (-1062.405) [-1057.046] (-1073.489) (-1070.466) * [-1071.189] (-1058.925) (-1065.281) (-1072.202) -- 0:01:01
781000 -- (-1061.714) [-1062.057] (-1067.578) (-1072.306) * (-1072.165) (-1064.598) [-1062.430] (-1070.911) -- 0:01:01
781500 -- (-1061.971) (-1066.726) [-1069.690] (-1062.680) * (-1071.219) (-1063.988) (-1066.370) [-1065.853] -- 0:01:01
782000 -- (-1067.523) (-1067.963) [-1065.151] (-1067.951) * [-1071.584] (-1076.525) (-1065.065) (-1062.710) -- 0:01:01
782500 -- (-1066.642) (-1064.556) [-1066.669] (-1065.753) * (-1059.796) (-1062.750) [-1060.966] (-1063.996) -- 0:01:01
783000 -- (-1059.623) (-1066.991) [-1056.520] (-1061.612) * [-1062.587] (-1062.840) (-1060.250) (-1055.878) -- 0:01:01
783500 -- (-1060.640) (-1061.360) (-1072.992) [-1062.855] * [-1063.678] (-1064.841) (-1059.984) (-1062.311) -- 0:01:01
784000 -- (-1066.817) (-1063.922) [-1063.663] (-1063.460) * (-1062.497) [-1062.644] (-1064.674) (-1060.878) -- 0:01:00
784500 -- (-1071.692) (-1065.691) [-1059.089] (-1063.136) * (-1071.918) (-1061.507) [-1066.947] (-1073.294) -- 0:01:00
785000 -- (-1060.470) (-1064.073) (-1068.433) [-1059.243] * [-1056.964] (-1061.760) (-1062.654) (-1068.364) -- 0:01:00
Average standard deviation of split frequencies: 0.008044
785500 -- (-1078.686) (-1063.937) [-1059.873] (-1065.152) * (-1066.561) (-1066.334) [-1067.718] (-1075.740) -- 0:01:00
786000 -- (-1069.983) (-1066.968) [-1064.772] (-1076.707) * (-1069.382) (-1072.523) (-1066.049) [-1063.129] -- 0:01:00
786500 -- (-1069.309) (-1062.318) (-1059.786) [-1066.936] * (-1072.581) (-1075.090) [-1058.719] (-1064.560) -- 0:01:00
787000 -- (-1077.663) (-1063.227) (-1061.525) [-1059.273] * (-1073.793) [-1067.966] (-1062.337) (-1069.559) -- 0:01:00
787500 -- [-1060.689] (-1064.521) (-1073.123) (-1061.677) * (-1063.339) (-1079.776) [-1062.803] (-1073.427) -- 0:00:59
788000 -- [-1070.267] (-1063.666) (-1064.114) (-1062.807) * (-1063.788) (-1071.308) (-1066.463) [-1061.289] -- 0:00:59
788500 -- [-1063.080] (-1067.562) (-1065.031) (-1083.027) * (-1070.170) (-1069.071) (-1067.000) [-1061.385] -- 0:00:59
789000 -- (-1072.092) [-1058.130] (-1063.555) (-1066.404) * (-1068.405) (-1064.295) (-1072.071) [-1060.745] -- 0:00:59
789500 -- (-1070.294) [-1065.069] (-1075.968) (-1068.079) * (-1068.241) (-1064.325) [-1059.005] (-1059.316) -- 0:00:59
790000 -- (-1071.656) [-1063.573] (-1078.295) (-1069.937) * (-1064.449) [-1058.980] (-1066.191) (-1062.063) -- 0:00:59
Average standard deviation of split frequencies: 0.007575
790500 -- (-1069.948) (-1067.441) (-1065.997) [-1063.688] * (-1055.813) [-1063.118] (-1074.763) (-1061.040) -- 0:00:59
791000 -- (-1076.653) (-1071.623) [-1066.557] (-1059.676) * (-1071.192) (-1059.792) (-1063.457) [-1059.075] -- 0:00:58
791500 -- (-1064.286) [-1057.495] (-1069.554) (-1064.933) * (-1076.798) (-1065.994) (-1078.294) [-1063.589] -- 0:00:58
792000 -- [-1064.220] (-1059.779) (-1060.463) (-1063.457) * (-1069.641) [-1061.903] (-1067.189) (-1064.087) -- 0:00:58
792500 -- (-1060.557) (-1068.525) (-1069.891) [-1066.735] * (-1072.843) [-1062.749] (-1065.786) (-1063.868) -- 0:00:58
793000 -- (-1065.591) (-1070.630) [-1063.564] (-1065.553) * (-1081.023) (-1066.144) (-1059.465) [-1061.516] -- 0:00:58
793500 -- (-1063.039) [-1065.343] (-1059.863) (-1074.894) * (-1068.688) (-1063.707) [-1060.254] (-1063.391) -- 0:00:58
794000 -- (-1067.421) (-1067.706) [-1064.533] (-1069.327) * (-1066.670) (-1060.398) [-1058.225] (-1067.904) -- 0:00:58
794500 -- [-1059.615] (-1075.206) (-1063.120) (-1070.059) * (-1063.733) (-1070.762) [-1059.005] (-1070.572) -- 0:00:57
795000 -- (-1063.269) (-1073.116) [-1061.785] (-1064.221) * (-1067.065) (-1068.916) [-1067.856] (-1081.803) -- 0:00:57
Average standard deviation of split frequencies: 0.006863
795500 -- [-1062.365] (-1072.499) (-1064.668) (-1067.493) * (-1065.999) [-1061.953] (-1063.335) (-1074.498) -- 0:00:57
796000 -- (-1065.103) (-1073.226) [-1058.983] (-1067.979) * (-1060.580) [-1062.083] (-1070.820) (-1072.379) -- 0:00:57
796500 -- (-1066.811) (-1073.249) [-1069.738] (-1068.477) * (-1063.314) (-1071.687) (-1075.905) [-1065.265] -- 0:00:57
797000 -- (-1069.263) (-1076.177) (-1072.282) [-1065.696] * (-1058.619) (-1064.166) (-1064.633) [-1060.596] -- 0:00:57
797500 -- (-1067.397) (-1075.040) (-1073.812) [-1067.180] * (-1062.223) [-1062.995] (-1056.238) (-1059.876) -- 0:00:57
798000 -- (-1071.670) (-1062.497) [-1063.716] (-1065.439) * (-1070.940) (-1056.919) (-1069.591) [-1069.104] -- 0:00:56
798500 -- (-1063.655) (-1067.896) (-1074.544) [-1060.254] * (-1061.925) (-1066.794) [-1059.135] (-1063.777) -- 0:00:56
799000 -- [-1058.440] (-1069.205) (-1070.158) (-1074.491) * (-1065.294) (-1061.050) (-1066.463) [-1058.181] -- 0:00:56
799500 -- (-1062.352) (-1065.256) [-1060.123] (-1070.070) * (-1070.432) (-1072.332) (-1065.937) [-1067.624] -- 0:00:56
800000 -- (-1072.159) (-1056.553) (-1058.893) [-1064.936] * (-1059.465) (-1065.099) [-1057.730] (-1069.335) -- 0:00:56
Average standard deviation of split frequencies: 0.006546
800500 -- (-1065.559) (-1061.352) [-1062.435] (-1066.359) * (-1064.063) (-1080.071) [-1059.113] (-1073.224) -- 0:00:56
801000 -- (-1067.318) [-1055.457] (-1069.633) (-1067.959) * (-1068.610) (-1061.456) (-1069.459) [-1064.926] -- 0:00:56
801500 -- (-1073.369) [-1054.112] (-1067.709) (-1065.025) * [-1066.109] (-1064.303) (-1071.729) (-1073.702) -- 0:00:55
802000 -- (-1071.412) [-1057.980] (-1070.169) (-1062.035) * (-1067.226) (-1072.025) (-1071.752) [-1068.501] -- 0:00:55
802500 -- (-1070.891) [-1069.433] (-1061.094) (-1061.777) * (-1060.640) (-1074.764) [-1060.856] (-1061.897) -- 0:00:55
803000 -- (-1060.481) (-1069.773) [-1060.221] (-1065.819) * (-1069.091) (-1065.615) (-1064.201) [-1060.292] -- 0:00:55
803500 -- (-1064.998) (-1066.435) (-1066.374) [-1057.089] * [-1057.946] (-1070.676) (-1070.826) (-1064.185) -- 0:00:55
804000 -- (-1070.738) [-1059.511] (-1059.013) (-1068.198) * (-1062.552) (-1073.761) [-1059.344] (-1072.448) -- 0:00:55
804500 -- (-1070.698) [-1062.570] (-1068.576) (-1058.654) * (-1060.700) (-1070.854) (-1062.938) [-1060.333] -- 0:00:55
805000 -- [-1066.547] (-1067.468) (-1067.126) (-1058.283) * (-1062.578) (-1063.320) (-1071.206) [-1067.933] -- 0:00:54
Average standard deviation of split frequencies: 0.006468
805500 -- (-1070.150) (-1056.203) (-1059.936) [-1058.403] * [-1069.485] (-1058.282) (-1069.326) (-1060.544) -- 0:00:54
806000 -- (-1065.005) [-1061.219] (-1064.748) (-1073.556) * [-1063.098] (-1063.437) (-1065.523) (-1065.337) -- 0:00:54
806500 -- (-1065.107) [-1058.667] (-1062.075) (-1072.234) * (-1071.410) [-1065.799] (-1067.950) (-1066.996) -- 0:00:54
807000 -- (-1079.912) [-1060.800] (-1068.629) (-1061.572) * [-1058.090] (-1057.668) (-1068.862) (-1064.630) -- 0:00:54
807500 -- (-1062.022) (-1063.743) [-1068.944] (-1073.581) * [-1064.190] (-1068.208) (-1063.776) (-1065.848) -- 0:00:54
808000 -- (-1072.238) (-1068.827) [-1068.366] (-1073.029) * (-1073.263) (-1060.223) (-1067.617) [-1059.976] -- 0:00:54
808500 -- (-1076.678) [-1063.146] (-1072.664) (-1071.687) * (-1062.497) [-1062.002] (-1067.869) (-1065.534) -- 0:00:54
809000 -- (-1065.271) (-1059.537) (-1071.972) [-1063.586] * (-1066.091) (-1072.441) [-1072.285] (-1063.487) -- 0:00:53
809500 -- (-1070.170) (-1064.434) (-1071.058) [-1058.967] * (-1068.608) [-1066.757] (-1072.646) (-1073.477) -- 0:00:53
810000 -- (-1069.285) (-1075.074) [-1061.174] (-1078.273) * (-1072.311) (-1064.332) [-1058.569] (-1069.933) -- 0:00:53
Average standard deviation of split frequencies: 0.007046
810500 -- [-1066.501] (-1072.263) (-1065.762) (-1073.416) * (-1065.979) [-1065.970] (-1067.613) (-1065.358) -- 0:00:53
811000 -- [-1065.361] (-1069.088) (-1069.215) (-1063.965) * (-1071.741) [-1061.450] (-1067.509) (-1062.585) -- 0:00:53
811500 -- (-1067.554) (-1063.294) (-1069.510) [-1058.800] * [-1060.682] (-1061.061) (-1069.760) (-1064.671) -- 0:00:53
812000 -- [-1062.457] (-1071.881) (-1067.374) (-1065.554) * [-1061.388] (-1066.500) (-1078.698) (-1061.573) -- 0:00:53
812500 -- (-1060.227) [-1060.716] (-1071.959) (-1066.295) * [-1064.911] (-1070.075) (-1075.378) (-1071.507) -- 0:00:52
813000 -- (-1071.681) (-1066.256) (-1068.902) [-1062.377] * (-1068.585) (-1067.794) [-1064.465] (-1067.381) -- 0:00:52
813500 -- (-1064.741) [-1070.738] (-1061.700) (-1070.141) * [-1059.733] (-1067.660) (-1062.741) (-1067.360) -- 0:00:52
814000 -- (-1062.765) (-1069.655) [-1062.489] (-1066.503) * [-1062.613] (-1070.406) (-1061.898) (-1069.135) -- 0:00:52
814500 -- (-1062.536) (-1062.819) (-1068.386) [-1063.211] * (-1062.899) [-1064.415] (-1069.278) (-1063.235) -- 0:00:52
815000 -- (-1069.461) (-1074.353) (-1071.300) [-1062.527] * (-1063.457) (-1060.522) [-1069.733] (-1070.238) -- 0:00:52
Average standard deviation of split frequencies: 0.007340
815500 -- (-1063.276) [-1067.744] (-1072.026) (-1060.279) * (-1071.635) (-1070.797) (-1077.998) [-1056.518] -- 0:00:52
816000 -- [-1056.525] (-1065.472) (-1066.440) (-1072.761) * (-1071.558) (-1067.066) (-1079.052) [-1057.525] -- 0:00:51
816500 -- [-1057.243] (-1071.297) (-1061.393) (-1069.063) * (-1065.806) [-1065.066] (-1076.794) (-1061.135) -- 0:00:51
817000 -- (-1064.698) (-1063.231) [-1064.502] (-1074.152) * (-1060.306) (-1061.157) (-1070.940) [-1059.413] -- 0:00:51
817500 -- (-1063.163) (-1063.637) (-1060.586) [-1063.548] * (-1064.556) [-1061.654] (-1076.282) (-1061.507) -- 0:00:51
818000 -- (-1060.801) [-1056.464] (-1065.535) (-1062.118) * [-1059.582] (-1062.572) (-1075.606) (-1070.891) -- 0:00:51
818500 -- (-1063.290) (-1058.845) [-1062.766] (-1059.578) * [-1057.015] (-1057.565) (-1071.405) (-1073.321) -- 0:00:51
819000 -- (-1069.028) (-1070.314) [-1061.309] (-1057.278) * (-1066.487) [-1067.237] (-1063.038) (-1055.755) -- 0:00:51
819500 -- (-1068.482) (-1073.748) [-1071.453] (-1059.215) * (-1062.288) (-1057.062) [-1071.894] (-1068.386) -- 0:00:50
820000 -- (-1063.193) (-1061.836) (-1067.798) [-1062.656] * (-1065.436) [-1053.981] (-1063.498) (-1070.280) -- 0:00:50
Average standard deviation of split frequencies: 0.006994
820500 -- (-1071.442) (-1061.009) (-1070.302) [-1067.458] * (-1072.523) (-1060.363) [-1061.235] (-1062.218) -- 0:00:50
821000 -- (-1061.654) (-1060.081) (-1077.470) [-1053.337] * (-1068.176) [-1063.189] (-1062.515) (-1074.194) -- 0:00:50
821500 -- [-1060.718] (-1061.722) (-1065.660) (-1065.926) * (-1065.673) (-1068.388) [-1065.685] (-1064.688) -- 0:00:50
822000 -- [-1069.263] (-1063.943) (-1060.475) (-1060.988) * (-1068.667) [-1070.679] (-1063.663) (-1079.250) -- 0:00:50
822500 -- (-1071.827) (-1059.668) [-1060.570] (-1067.719) * (-1065.248) (-1071.703) (-1062.737) [-1063.053] -- 0:00:50
823000 -- (-1062.862) (-1066.757) [-1067.728] (-1064.342) * (-1068.272) [-1060.965] (-1072.827) (-1074.429) -- 0:00:49
823500 -- (-1069.820) (-1062.652) (-1073.890) [-1058.647] * (-1077.657) (-1060.164) (-1071.972) [-1060.167] -- 0:00:49
824000 -- (-1064.896) (-1064.712) (-1068.213) [-1062.546] * (-1073.376) (-1060.832) [-1067.489] (-1068.930) -- 0:00:49
824500 -- (-1064.607) (-1080.292) [-1059.864] (-1064.873) * (-1063.267) (-1059.638) (-1075.301) [-1067.284] -- 0:00:49
825000 -- [-1056.682] (-1068.068) (-1072.146) (-1060.363) * (-1073.244) (-1065.350) (-1061.879) [-1075.530] -- 0:00:49
Average standard deviation of split frequencies: 0.006848
825500 -- (-1076.337) [-1059.020] (-1066.256) (-1060.715) * (-1076.972) (-1066.265) (-1083.259) [-1063.452] -- 0:00:49
826000 -- (-1066.661) (-1074.876) (-1066.665) [-1058.569] * [-1063.661] (-1067.273) (-1067.310) (-1064.611) -- 0:00:49
826500 -- [-1059.942] (-1064.669) (-1073.480) (-1069.131) * (-1065.638) (-1059.116) [-1061.881] (-1072.592) -- 0:00:48
827000 -- (-1064.918) (-1072.429) (-1073.048) [-1059.707] * (-1061.142) (-1065.250) [-1058.714] (-1065.414) -- 0:00:48
827500 -- [-1064.777] (-1062.985) (-1078.216) (-1062.037) * (-1070.440) (-1066.615) (-1064.368) [-1060.475] -- 0:00:48
828000 -- [-1068.711] (-1067.665) (-1070.706) (-1072.884) * (-1074.123) (-1061.396) (-1063.997) [-1066.094] -- 0:00:48
828500 -- (-1066.681) (-1071.271) [-1060.826] (-1065.714) * (-1066.522) (-1068.751) (-1067.061) [-1066.217] -- 0:00:48
829000 -- (-1068.215) (-1061.043) [-1062.545] (-1065.128) * (-1061.923) (-1066.266) [-1069.701] (-1068.877) -- 0:00:48
829500 -- (-1069.974) [-1064.330] (-1059.306) (-1061.770) * (-1061.855) (-1065.783) (-1070.226) [-1068.094] -- 0:00:48
830000 -- (-1065.428) (-1076.540) [-1067.340] (-1067.047) * [-1060.850] (-1068.989) (-1057.115) (-1067.061) -- 0:00:47
Average standard deviation of split frequencies: 0.007044
830500 -- (-1064.726) (-1070.163) (-1083.765) [-1060.320] * (-1063.648) [-1067.358] (-1058.868) (-1073.578) -- 0:00:47
831000 -- (-1054.963) (-1071.155) (-1062.605) [-1060.639] * (-1073.615) (-1063.495) (-1062.559) [-1066.414] -- 0:00:47
831500 -- (-1071.147) (-1067.800) (-1066.847) [-1059.921] * [-1065.989] (-1062.717) (-1071.280) (-1071.354) -- 0:00:47
832000 -- [-1063.288] (-1062.113) (-1071.865) (-1060.235) * (-1071.647) [-1062.776] (-1061.718) (-1077.044) -- 0:00:47
832500 -- (-1066.855) [-1057.663] (-1069.472) (-1070.236) * (-1077.003) (-1072.775) (-1070.747) [-1061.517] -- 0:00:47
833000 -- (-1071.496) [-1065.917] (-1071.489) (-1061.014) * (-1063.204) (-1064.966) [-1060.979] (-1063.990) -- 0:00:47
833500 -- (-1070.078) (-1065.019) (-1066.659) [-1054.601] * [-1064.804] (-1067.976) (-1073.056) (-1066.502) -- 0:00:46
834000 -- (-1072.029) [-1066.283] (-1065.345) (-1062.875) * [-1062.935] (-1068.196) (-1069.693) (-1068.761) -- 0:00:46
834500 -- [-1067.128] (-1068.861) (-1061.175) (-1061.726) * (-1065.377) (-1057.331) [-1064.663] (-1066.985) -- 0:00:46
835000 -- (-1069.535) (-1074.982) (-1063.116) [-1065.058] * (-1072.258) [-1061.276] (-1065.135) (-1054.192) -- 0:00:46
Average standard deviation of split frequencies: 0.007231
835500 -- (-1070.282) (-1065.621) [-1067.638] (-1055.335) * [-1063.074] (-1077.968) (-1064.563) (-1061.186) -- 0:00:46
836000 -- [-1063.952] (-1066.498) (-1066.623) (-1058.236) * (-1077.100) [-1062.137] (-1085.040) (-1073.890) -- 0:00:46
836500 -- (-1065.867) (-1072.674) [-1058.330] (-1062.639) * (-1069.318) (-1071.178) [-1072.679] (-1064.354) -- 0:00:46
837000 -- (-1062.363) [-1061.559] (-1057.917) (-1068.141) * (-1072.973) [-1062.482] (-1066.754) (-1065.266) -- 0:00:45
837500 -- [-1058.382] (-1067.972) (-1070.655) (-1069.933) * (-1072.906) [-1056.234] (-1066.508) (-1062.549) -- 0:00:45
838000 -- (-1058.975) (-1058.950) (-1062.660) [-1057.902] * (-1063.315) [-1063.832] (-1062.833) (-1064.279) -- 0:00:45
838500 -- [-1056.406] (-1057.778) (-1060.503) (-1074.788) * (-1063.118) [-1067.007] (-1068.538) (-1064.520) -- 0:00:45
839000 -- (-1066.130) (-1069.709) [-1064.097] (-1062.209) * (-1064.344) (-1069.585) [-1058.608] (-1067.792) -- 0:00:45
839500 -- (-1066.176) [-1059.393] (-1066.363) (-1060.861) * [-1058.127] (-1070.041) (-1076.417) (-1067.546) -- 0:00:45
840000 -- (-1064.538) (-1069.475) [-1066.109] (-1076.517) * (-1068.737) [-1064.943] (-1070.203) (-1064.786) -- 0:00:45
Average standard deviation of split frequencies: 0.007125
840500 -- (-1067.380) (-1065.243) (-1064.916) [-1062.949] * [-1061.406] (-1072.359) (-1066.604) (-1060.565) -- 0:00:44
841000 -- (-1070.434) (-1066.708) (-1058.664) [-1064.168] * (-1072.416) (-1071.552) (-1066.449) [-1060.083] -- 0:00:44
841500 -- (-1068.185) [-1063.093] (-1062.971) (-1072.903) * (-1066.248) (-1066.744) [-1056.640] (-1060.724) -- 0:00:44
842000 -- (-1068.637) (-1070.026) [-1060.778] (-1077.802) * (-1060.609) (-1072.795) (-1063.323) [-1057.098] -- 0:00:44
842500 -- (-1071.552) (-1063.163) (-1066.344) [-1065.904] * (-1056.933) (-1057.316) (-1061.621) [-1059.459] -- 0:00:44
843000 -- [-1066.543] (-1064.449) (-1071.897) (-1059.418) * (-1061.113) (-1079.056) (-1067.691) [-1058.181] -- 0:00:44
843500 -- (-1060.346) (-1068.791) [-1059.792] (-1065.737) * (-1060.880) (-1067.431) (-1062.986) [-1072.643] -- 0:00:44
844000 -- (-1067.284) (-1060.035) [-1060.785] (-1064.047) * (-1061.305) (-1068.932) (-1064.641) [-1062.920] -- 0:00:43
844500 -- (-1071.306) (-1059.259) [-1070.255] (-1058.540) * (-1071.350) (-1059.838) [-1063.508] (-1071.836) -- 0:00:43
845000 -- (-1067.196) (-1056.075) (-1063.311) [-1073.831] * (-1072.009) [-1069.478] (-1072.024) (-1065.137) -- 0:00:43
Average standard deviation of split frequencies: 0.007178
845500 -- [-1068.974] (-1071.171) (-1064.295) (-1070.926) * (-1066.523) (-1062.654) (-1061.673) [-1068.164] -- 0:00:43
846000 -- (-1060.382) [-1059.897] (-1068.500) (-1070.795) * (-1064.544) (-1071.234) (-1060.427) [-1067.372] -- 0:00:43
846500 -- [-1060.803] (-1067.626) (-1068.433) (-1072.009) * [-1061.947] (-1065.990) (-1059.559) (-1062.987) -- 0:00:43
847000 -- [-1069.056] (-1070.133) (-1061.029) (-1063.516) * (-1065.346) [-1060.006] (-1069.591) (-1069.209) -- 0:00:43
847500 -- [-1063.055] (-1065.122) (-1060.879) (-1080.255) * (-1065.858) (-1068.247) (-1062.055) [-1068.827] -- 0:00:43
848000 -- (-1066.588) (-1062.334) (-1064.410) [-1064.910] * (-1074.510) [-1063.057] (-1066.828) (-1063.776) -- 0:00:42
848500 -- (-1084.532) [-1060.403] (-1060.262) (-1065.185) * (-1067.278) [-1060.693] (-1066.893) (-1069.491) -- 0:00:42
849000 -- [-1059.020] (-1069.839) (-1060.187) (-1076.687) * (-1066.652) (-1064.112) [-1057.540] (-1060.188) -- 0:00:42
849500 -- (-1058.886) (-1068.458) [-1063.627] (-1069.153) * [-1058.430] (-1068.443) (-1068.635) (-1065.258) -- 0:00:42
850000 -- (-1066.401) (-1057.188) [-1060.632] (-1060.664) * (-1070.700) (-1066.403) [-1055.436] (-1058.391) -- 0:00:42
Average standard deviation of split frequencies: 0.006617
850500 -- (-1059.742) (-1065.128) (-1066.657) [-1062.640] * (-1073.057) (-1055.238) [-1062.103] (-1061.981) -- 0:00:42
851000 -- [-1066.420] (-1069.294) (-1062.355) (-1076.362) * (-1069.746) (-1056.864) (-1070.320) [-1062.281] -- 0:00:42
851500 -- (-1066.805) (-1079.777) (-1070.211) [-1071.762] * (-1066.582) (-1061.596) (-1070.234) [-1062.042] -- 0:00:41
852000 -- (-1063.630) (-1070.210) [-1060.794] (-1063.986) * [-1055.504] (-1061.255) (-1066.081) (-1066.001) -- 0:00:41
852500 -- [-1067.044] (-1067.715) (-1074.656) (-1068.428) * (-1071.873) [-1058.712] (-1063.200) (-1071.592) -- 0:00:41
853000 -- [-1064.765] (-1068.592) (-1063.624) (-1060.200) * (-1070.178) [-1062.057] (-1065.908) (-1059.646) -- 0:00:41
853500 -- (-1065.654) [-1064.362] (-1065.601) (-1069.726) * (-1062.299) (-1061.555) (-1072.185) [-1064.223] -- 0:00:41
854000 -- (-1067.690) (-1068.138) (-1068.628) [-1070.595] * (-1062.572) [-1061.431] (-1081.253) (-1075.762) -- 0:00:41
854500 -- (-1069.229) (-1068.478) (-1065.176) [-1065.654] * [-1058.838] (-1070.639) (-1075.301) (-1070.621) -- 0:00:41
855000 -- (-1070.468) (-1066.061) (-1059.849) [-1059.805] * (-1061.742) (-1070.322) (-1065.444) [-1054.705] -- 0:00:40
Average standard deviation of split frequencies: 0.006447
855500 -- (-1064.060) (-1061.330) (-1066.076) [-1067.665] * (-1063.836) [-1061.384] (-1065.123) (-1061.531) -- 0:00:40
856000 -- (-1073.535) (-1065.723) (-1067.701) [-1059.663] * (-1068.011) [-1060.537] (-1063.266) (-1065.906) -- 0:00:40
856500 -- (-1059.434) [-1062.410] (-1066.381) (-1061.809) * [-1062.594] (-1056.201) (-1062.916) (-1066.580) -- 0:00:40
857000 -- [-1060.022] (-1060.375) (-1061.286) (-1072.576) * [-1066.313] (-1063.065) (-1064.623) (-1074.321) -- 0:00:40
857500 -- (-1056.951) (-1065.301) [-1058.761] (-1064.185) * (-1067.210) [-1066.449] (-1071.617) (-1060.981) -- 0:00:40
858000 -- [-1067.056] (-1062.590) (-1060.267) (-1063.770) * [-1060.186] (-1074.941) (-1067.008) (-1060.409) -- 0:00:40
858500 -- (-1066.577) (-1066.666) (-1059.150) [-1062.101] * (-1056.624) [-1066.538] (-1068.535) (-1062.068) -- 0:00:39
859000 -- (-1062.050) (-1063.454) (-1075.280) [-1061.645] * (-1056.915) (-1065.593) (-1071.608) [-1064.321] -- 0:00:39
859500 -- (-1067.595) [-1062.311] (-1067.342) (-1061.665) * [-1063.473] (-1069.497) (-1069.013) (-1071.323) -- 0:00:39
860000 -- (-1069.016) [-1061.108] (-1063.678) (-1062.046) * (-1063.653) (-1068.312) [-1063.428] (-1063.529) -- 0:00:39
Average standard deviation of split frequencies: 0.006089
860500 -- (-1063.356) [-1063.201] (-1065.770) (-1063.489) * (-1067.391) (-1061.097) (-1062.682) [-1067.010] -- 0:00:39
861000 -- [-1060.694] (-1072.541) (-1073.581) (-1073.373) * (-1062.068) [-1065.310] (-1064.029) (-1066.502) -- 0:00:39
861500 -- (-1064.465) (-1070.017) [-1060.033] (-1060.991) * [-1063.612] (-1074.371) (-1059.703) (-1064.549) -- 0:00:39
862000 -- (-1058.555) (-1077.343) [-1062.849] (-1061.108) * [-1065.208] (-1061.415) (-1076.426) (-1066.313) -- 0:00:38
862500 -- (-1062.273) (-1069.624) [-1062.768] (-1057.573) * [-1057.579] (-1066.732) (-1074.036) (-1073.138) -- 0:00:38
863000 -- [-1068.767] (-1060.212) (-1063.072) (-1058.481) * (-1068.816) [-1066.499] (-1069.393) (-1063.124) -- 0:00:38
863500 -- (-1071.898) [-1064.509] (-1069.211) (-1062.188) * (-1071.621) [-1062.028] (-1062.933) (-1070.489) -- 0:00:38
864000 -- [-1061.604] (-1065.690) (-1065.389) (-1068.258) * (-1063.789) (-1061.745) [-1064.236] (-1067.598) -- 0:00:38
864500 -- (-1067.686) [-1063.087] (-1072.239) (-1071.409) * (-1067.582) (-1061.712) (-1069.866) [-1063.679] -- 0:00:38
865000 -- (-1067.634) (-1069.658) [-1064.072] (-1064.582) * (-1056.580) (-1061.345) (-1066.248) [-1060.910] -- 0:00:38
Average standard deviation of split frequencies: 0.006276
865500 -- (-1059.512) (-1071.922) [-1062.913] (-1062.947) * (-1066.317) [-1064.459] (-1065.456) (-1059.514) -- 0:00:37
866000 -- (-1068.868) (-1072.785) (-1059.484) [-1060.948] * [-1064.614] (-1069.731) (-1068.830) (-1069.573) -- 0:00:37
866500 -- (-1068.993) (-1065.879) [-1061.158] (-1063.083) * [-1064.434] (-1062.447) (-1067.543) (-1057.921) -- 0:00:37
867000 -- (-1072.464) [-1065.616] (-1063.773) (-1072.196) * [-1057.570] (-1070.935) (-1065.301) (-1064.463) -- 0:00:37
867500 -- (-1063.885) (-1059.711) (-1069.901) [-1059.074] * (-1063.000) (-1062.971) [-1062.701] (-1069.453) -- 0:00:37
868000 -- (-1063.515) [-1066.400] (-1078.792) (-1059.799) * (-1062.991) (-1059.845) (-1068.937) [-1057.111] -- 0:00:37
868500 -- (-1069.943) (-1056.764) [-1074.298] (-1067.655) * [-1066.920] (-1064.967) (-1074.070) (-1061.917) -- 0:00:37
869000 -- (-1081.822) [-1066.483] (-1062.930) (-1069.720) * (-1060.749) [-1056.234] (-1064.889) (-1062.325) -- 0:00:36
869500 -- (-1065.634) (-1059.511) (-1064.287) [-1068.295] * (-1064.567) (-1062.684) (-1068.662) [-1061.980] -- 0:00:36
870000 -- (-1066.527) [-1065.256] (-1062.243) (-1070.633) * [-1059.161] (-1063.959) (-1062.834) (-1059.677) -- 0:00:36
Average standard deviation of split frequencies: 0.006784
870500 -- (-1067.978) (-1064.600) [-1067.809] (-1066.262) * (-1056.809) (-1067.382) [-1061.547] (-1057.650) -- 0:00:36
871000 -- (-1062.591) [-1064.633] (-1060.744) (-1065.141) * [-1055.736] (-1067.301) (-1075.330) (-1067.227) -- 0:00:36
871500 -- (-1067.581) (-1066.799) (-1060.883) [-1065.164] * [-1063.491] (-1070.252) (-1071.618) (-1068.937) -- 0:00:36
872000 -- (-1065.569) (-1062.340) (-1055.327) [-1067.696] * [-1061.355] (-1073.284) (-1060.142) (-1068.677) -- 0:00:36
872500 -- (-1075.750) [-1061.020] (-1058.382) (-1079.081) * (-1065.875) (-1066.086) [-1065.169] (-1066.388) -- 0:00:35
873000 -- (-1060.246) [-1061.663] (-1069.526) (-1061.113) * (-1066.499) (-1071.268) [-1067.935] (-1069.126) -- 0:00:35
873500 -- (-1068.294) (-1064.176) [-1058.509] (-1065.613) * (-1073.554) (-1069.000) (-1058.544) [-1066.660] -- 0:00:35
874000 -- [-1055.218] (-1059.121) (-1073.743) (-1065.755) * (-1074.552) [-1064.299] (-1064.272) (-1063.599) -- 0:00:35
874500 -- [-1057.830] (-1065.154) (-1072.787) (-1070.051) * (-1066.441) (-1069.015) (-1062.450) [-1062.306] -- 0:00:35
875000 -- [-1056.571] (-1060.260) (-1063.282) (-1072.955) * (-1080.349) (-1058.715) (-1065.777) [-1061.633] -- 0:00:35
Average standard deviation of split frequencies: 0.006204
875500 -- (-1071.475) (-1068.131) (-1074.800) [-1067.572] * (-1070.219) [-1064.166] (-1064.105) (-1078.286) -- 0:00:35
876000 -- (-1061.885) (-1066.470) [-1067.614] (-1059.744) * [-1073.553] (-1066.116) (-1067.934) (-1082.758) -- 0:00:34
876500 -- (-1060.889) (-1065.064) [-1063.379] (-1069.790) * [-1066.609] (-1062.930) (-1061.230) (-1063.699) -- 0:00:34
877000 -- (-1060.318) [-1060.954] (-1062.425) (-1064.098) * (-1062.764) (-1063.669) (-1063.162) [-1061.282] -- 0:00:34
877500 -- (-1062.765) (-1059.467) (-1067.440) [-1064.373] * (-1069.127) (-1063.944) (-1068.384) [-1060.909] -- 0:00:34
878000 -- [-1067.582] (-1059.478) (-1057.201) (-1070.116) * (-1061.742) [-1067.969] (-1068.484) (-1063.532) -- 0:00:34
878500 -- (-1069.945) [-1067.017] (-1068.327) (-1062.633) * [-1065.382] (-1063.445) (-1063.321) (-1060.997) -- 0:00:34
879000 -- (-1063.699) (-1089.951) [-1061.570] (-1061.536) * (-1066.362) (-1068.246) (-1058.856) [-1057.233] -- 0:00:34
879500 -- (-1074.262) [-1057.974] (-1069.944) (-1073.268) * (-1075.505) [-1066.213] (-1068.663) (-1060.805) -- 0:00:33
880000 -- (-1065.509) (-1064.124) (-1070.454) [-1066.720] * (-1058.233) (-1063.720) [-1057.334] (-1059.020) -- 0:00:33
Average standard deviation of split frequencies: 0.006360
880500 -- (-1063.981) [-1063.141] (-1063.516) (-1071.978) * (-1063.277) (-1074.270) [-1062.748] (-1059.954) -- 0:00:33
881000 -- (-1069.400) (-1072.374) (-1074.341) [-1063.917] * (-1068.815) (-1060.958) (-1067.486) [-1065.049] -- 0:00:33
881500 -- (-1073.424) (-1056.698) (-1059.592) [-1070.751] * (-1063.372) (-1063.375) [-1062.935] (-1063.345) -- 0:00:33
882000 -- [-1064.796] (-1075.890) (-1070.925) (-1064.288) * (-1066.926) (-1066.501) [-1073.157] (-1065.265) -- 0:00:33
882500 -- [-1077.140] (-1070.687) (-1077.877) (-1061.608) * (-1064.120) (-1066.322) [-1065.718] (-1074.409) -- 0:00:33
883000 -- (-1065.228) (-1068.243) (-1069.362) [-1062.910] * (-1062.876) [-1064.799] (-1073.666) (-1074.487) -- 0:00:32
883500 -- (-1074.479) [-1062.375] (-1059.533) (-1060.975) * (-1062.298) (-1067.521) [-1066.137] (-1073.916) -- 0:00:32
884000 -- (-1068.783) (-1064.435) (-1066.447) [-1063.609] * [-1059.165] (-1069.394) (-1064.818) (-1065.879) -- 0:00:32
884500 -- (-1066.251) [-1062.735] (-1075.612) (-1065.085) * (-1074.378) [-1065.343] (-1061.054) (-1064.735) -- 0:00:32
885000 -- (-1056.621) (-1069.618) (-1066.799) [-1064.494] * [-1069.419] (-1061.283) (-1064.610) (-1064.009) -- 0:00:32
Average standard deviation of split frequencies: 0.006197
885500 -- [-1058.126] (-1075.029) (-1060.263) (-1064.781) * (-1075.852) [-1057.738] (-1067.427) (-1070.962) -- 0:00:32
886000 -- (-1064.203) (-1061.160) (-1060.315) [-1061.281] * (-1064.905) (-1069.337) [-1066.745] (-1073.058) -- 0:00:32
886500 -- [-1061.973] (-1055.366) (-1060.499) (-1057.139) * (-1059.183) (-1068.701) (-1073.274) [-1065.084] -- 0:00:32
887000 -- (-1063.360) [-1059.023] (-1062.599) (-1064.971) * (-1062.389) (-1069.732) [-1074.793] (-1075.831) -- 0:00:31
887500 -- [-1061.267] (-1064.063) (-1064.277) (-1068.105) * [-1060.129] (-1057.391) (-1070.379) (-1067.267) -- 0:00:31
888000 -- (-1058.650) (-1068.172) [-1067.981] (-1074.839) * (-1066.344) [-1065.489] (-1069.155) (-1068.407) -- 0:00:31
888500 -- (-1062.586) (-1069.384) [-1060.402] (-1063.203) * (-1069.829) (-1076.508) [-1060.751] (-1064.492) -- 0:00:31
889000 -- [-1069.897] (-1055.416) (-1056.160) (-1071.255) * [-1059.599] (-1067.627) (-1057.936) (-1079.294) -- 0:00:31
889500 -- [-1059.871] (-1065.428) (-1068.573) (-1075.778) * (-1064.449) (-1065.541) [-1064.301] (-1077.209) -- 0:00:31
890000 -- [-1060.612] (-1065.104) (-1059.454) (-1068.835) * (-1074.496) (-1068.139) [-1058.347] (-1064.847) -- 0:00:31
Average standard deviation of split frequencies: 0.006196
890500 -- (-1064.663) [-1065.732] (-1067.845) (-1065.211) * [-1060.890] (-1069.126) (-1071.027) (-1065.930) -- 0:00:30
891000 -- [-1060.278] (-1062.494) (-1066.367) (-1070.008) * (-1064.488) (-1078.070) [-1063.071] (-1071.828) -- 0:00:30
891500 -- [-1056.354] (-1069.309) (-1070.841) (-1071.181) * (-1059.659) (-1073.609) [-1066.268] (-1075.198) -- 0:00:30
892000 -- (-1057.850) (-1057.924) [-1069.327] (-1070.789) * (-1070.200) [-1062.244] (-1063.167) (-1068.323) -- 0:00:30
892500 -- (-1073.413) (-1061.157) (-1061.200) [-1062.526] * (-1060.748) (-1065.499) [-1058.513] (-1068.475) -- 0:00:30
893000 -- [-1063.654] (-1061.298) (-1064.677) (-1063.759) * (-1068.711) (-1066.068) [-1057.738] (-1072.580) -- 0:00:30
893500 -- (-1066.739) (-1060.333) [-1067.872] (-1071.791) * [-1067.209] (-1074.996) (-1061.296) (-1077.805) -- 0:00:30
894000 -- (-1061.657) (-1063.698) [-1059.354] (-1070.063) * (-1066.139) (-1072.035) [-1061.176] (-1063.178) -- 0:00:29
894500 -- (-1067.712) (-1062.317) [-1059.678] (-1061.130) * [-1068.081] (-1077.820) (-1060.828) (-1059.419) -- 0:00:29
895000 -- (-1066.399) (-1062.197) [-1062.096] (-1062.427) * (-1062.405) (-1062.091) [-1062.403] (-1059.516) -- 0:00:29
Average standard deviation of split frequencies: 0.006344
895500 -- (-1071.409) (-1069.256) [-1059.339] (-1060.434) * (-1061.026) (-1070.122) (-1062.661) [-1060.150] -- 0:00:29
896000 -- (-1075.633) (-1064.469) (-1062.138) [-1061.073] * [-1073.299] (-1073.709) (-1057.793) (-1059.908) -- 0:00:29
896500 -- (-1073.415) (-1067.258) (-1066.461) [-1068.347] * (-1074.926) (-1064.709) (-1068.758) [-1059.772] -- 0:00:29
897000 -- (-1077.418) (-1065.015) (-1074.746) [-1059.577] * (-1064.889) [-1060.631] (-1062.960) (-1063.415) -- 0:00:29
897500 -- (-1070.507) (-1067.661) [-1056.446] (-1055.621) * (-1076.089) (-1063.540) [-1067.142] (-1074.126) -- 0:00:28
898000 -- (-1069.770) (-1072.744) [-1059.566] (-1067.485) * (-1070.595) (-1061.544) [-1057.968] (-1062.179) -- 0:00:28
898500 -- [-1066.947] (-1065.993) (-1062.322) (-1073.136) * (-1063.050) (-1071.019) (-1069.893) [-1069.904] -- 0:00:28
899000 -- (-1072.200) [-1063.949] (-1067.486) (-1070.745) * [-1065.605] (-1070.874) (-1058.012) (-1059.849) -- 0:00:28
899500 -- [-1059.693] (-1065.768) (-1074.774) (-1064.527) * (-1070.659) [-1060.464] (-1068.059) (-1073.808) -- 0:00:28
900000 -- (-1069.334) [-1070.017] (-1063.524) (-1065.711) * (-1066.117) [-1062.084] (-1072.818) (-1060.651) -- 0:00:28
Average standard deviation of split frequencies: 0.005911
900500 -- (-1069.025) (-1074.561) [-1054.454] (-1066.906) * (-1065.013) (-1058.708) [-1062.414] (-1069.273) -- 0:00:28
901000 -- [-1063.648] (-1071.358) (-1075.425) (-1066.977) * (-1068.866) (-1078.348) [-1061.960] (-1063.509) -- 0:00:27
901500 -- (-1070.850) (-1071.632) (-1060.427) [-1061.546] * [-1062.594] (-1070.124) (-1075.340) (-1067.951) -- 0:00:27
902000 -- (-1070.956) (-1069.663) (-1069.583) [-1060.488] * (-1063.816) (-1064.253) (-1062.744) [-1073.068] -- 0:00:27
902500 -- (-1067.419) [-1061.392] (-1075.830) (-1059.636) * (-1068.276) (-1065.711) (-1073.572) [-1064.314] -- 0:00:27
903000 -- (-1064.208) (-1065.190) [-1063.994] (-1062.992) * (-1072.286) (-1068.539) (-1059.870) [-1060.331] -- 0:00:27
903500 -- [-1065.118] (-1062.876) (-1075.371) (-1068.649) * (-1062.586) (-1064.785) [-1077.386] (-1064.808) -- 0:00:27
904000 -- (-1058.759) (-1071.334) [-1067.693] (-1070.233) * (-1060.649) (-1064.417) (-1069.846) [-1064.891] -- 0:00:27
904500 -- (-1064.268) [-1063.612] (-1064.162) (-1066.369) * [-1063.192] (-1061.878) (-1075.016) (-1073.646) -- 0:00:26
905000 -- (-1072.680) [-1059.901] (-1063.640) (-1069.061) * [-1063.612] (-1061.216) (-1068.816) (-1075.597) -- 0:00:26
Average standard deviation of split frequencies: 0.005907
905500 -- (-1074.078) (-1074.198) (-1061.984) [-1060.002] * (-1063.771) (-1061.815) [-1063.141] (-1068.295) -- 0:00:26
906000 -- [-1078.497] (-1066.443) (-1063.599) (-1064.369) * [-1067.328] (-1063.858) (-1059.999) (-1067.948) -- 0:00:26
906500 -- (-1071.440) (-1065.803) (-1071.301) [-1065.296] * [-1062.283] (-1067.287) (-1063.349) (-1073.612) -- 0:00:26
907000 -- (-1074.012) (-1068.398) [-1058.036] (-1065.180) * (-1077.393) (-1064.770) [-1061.074] (-1074.951) -- 0:00:26
907500 -- (-1072.639) (-1076.049) [-1058.438] (-1069.595) * (-1063.517) (-1069.419) [-1062.836] (-1070.929) -- 0:00:26
908000 -- (-1082.584) (-1063.951) (-1058.063) [-1064.457] * [-1060.001] (-1070.595) (-1064.849) (-1074.038) -- 0:00:25
908500 -- (-1072.111) (-1076.472) (-1060.745) [-1068.267] * (-1070.821) [-1063.163] (-1080.661) (-1066.400) -- 0:00:25
909000 -- (-1071.464) (-1074.441) [-1053.764] (-1061.254) * [-1067.808] (-1066.487) (-1060.279) (-1059.901) -- 0:00:25
909500 -- (-1066.757) (-1069.920) [-1066.702] (-1074.942) * (-1064.936) (-1060.392) [-1065.489] (-1070.446) -- 0:00:25
910000 -- [-1061.539] (-1065.765) (-1061.077) (-1062.256) * (-1066.134) (-1072.895) [-1065.753] (-1065.926) -- 0:00:25
Average standard deviation of split frequencies: 0.005664
910500 -- (-1064.980) [-1060.256] (-1060.923) (-1066.006) * (-1074.890) [-1064.285] (-1071.678) (-1062.246) -- 0:00:25
911000 -- (-1074.756) (-1066.952) [-1065.135] (-1058.536) * [-1059.113] (-1072.678) (-1060.567) (-1068.949) -- 0:00:25
911500 -- (-1063.788) (-1067.979) (-1054.533) [-1065.124] * (-1059.297) (-1084.455) [-1057.526] (-1062.768) -- 0:00:24
912000 -- (-1059.596) (-1065.537) (-1068.974) [-1062.076] * [-1063.248] (-1069.631) (-1062.591) (-1071.712) -- 0:00:24
912500 -- (-1060.854) [-1062.599] (-1062.841) (-1066.580) * [-1060.447] (-1061.777) (-1076.092) (-1066.763) -- 0:00:24
913000 -- (-1068.808) (-1061.984) (-1060.131) [-1062.372] * (-1062.121) (-1070.868) [-1066.502] (-1063.508) -- 0:00:24
913500 -- (-1066.647) (-1076.038) (-1070.574) [-1062.656] * (-1062.349) (-1065.036) (-1065.400) [-1054.768] -- 0:00:24
914000 -- (-1063.375) (-1076.611) [-1062.299] (-1064.024) * (-1059.056) (-1064.755) [-1058.060] (-1063.289) -- 0:00:24
914500 -- (-1054.870) (-1069.237) (-1055.273) [-1068.219] * (-1073.627) [-1070.392] (-1066.170) (-1062.540) -- 0:00:24
915000 -- [-1064.053] (-1070.669) (-1069.793) (-1067.714) * (-1062.970) (-1064.671) (-1075.693) [-1062.687] -- 0:00:23
Average standard deviation of split frequencies: 0.005358
915500 -- [-1063.784] (-1075.734) (-1070.641) (-1058.195) * (-1077.890) (-1064.568) (-1059.160) [-1060.186] -- 0:00:23
916000 -- [-1056.725] (-1080.632) (-1069.592) (-1063.716) * (-1074.617) (-1067.459) [-1061.434] (-1063.889) -- 0:00:23
916500 -- (-1064.760) (-1073.343) [-1064.542] (-1064.044) * (-1077.059) (-1066.366) [-1066.863] (-1056.094) -- 0:00:23
917000 -- (-1065.259) (-1066.788) [-1066.362] (-1062.716) * (-1070.850) (-1063.676) [-1060.189] (-1075.951) -- 0:00:23
917500 -- (-1063.453) [-1071.109] (-1064.789) (-1067.532) * [-1065.618] (-1074.682) (-1062.375) (-1058.790) -- 0:00:23
918000 -- (-1069.617) [-1063.986] (-1064.644) (-1069.179) * [-1066.101] (-1067.014) (-1061.833) (-1062.646) -- 0:00:23
918500 -- (-1072.814) (-1068.313) [-1059.112] (-1071.144) * [-1059.979] (-1059.935) (-1071.065) (-1069.060) -- 0:00:22
919000 -- (-1065.469) [-1059.136] (-1062.165) (-1073.762) * (-1062.816) (-1063.334) (-1067.441) [-1062.543] -- 0:00:22
919500 -- (-1063.058) (-1070.734) [-1063.360] (-1065.789) * (-1066.725) [-1065.368] (-1065.705) (-1069.841) -- 0:00:22
920000 -- (-1069.239) [-1066.228] (-1063.893) (-1064.710) * [-1066.114] (-1069.252) (-1067.455) (-1063.379) -- 0:00:22
Average standard deviation of split frequencies: 0.005602
920500 -- (-1059.618) [-1067.686] (-1061.281) (-1067.211) * (-1066.354) [-1066.790] (-1060.065) (-1071.802) -- 0:00:22
921000 -- (-1059.579) [-1065.310] (-1062.557) (-1069.369) * (-1058.156) (-1067.777) (-1064.070) [-1061.847] -- 0:00:22
921500 -- [-1062.331] (-1068.908) (-1058.520) (-1058.571) * [-1065.651] (-1062.066) (-1069.896) (-1062.285) -- 0:00:22
922000 -- (-1060.264) (-1073.896) [-1065.119] (-1062.689) * [-1062.928] (-1063.942) (-1080.185) (-1059.442) -- 0:00:21
922500 -- [-1062.502] (-1062.954) (-1057.825) (-1067.849) * [-1062.276] (-1066.708) (-1069.608) (-1071.433) -- 0:00:21
923000 -- (-1070.371) [-1067.606] (-1077.801) (-1066.341) * [-1065.034] (-1066.867) (-1057.838) (-1073.598) -- 0:00:21
923500 -- [-1059.708] (-1070.280) (-1064.392) (-1064.981) * (-1066.855) (-1060.780) (-1069.875) [-1063.159] -- 0:00:21
924000 -- [-1064.864] (-1075.599) (-1070.625) (-1067.483) * (-1069.778) [-1064.909] (-1063.732) (-1069.600) -- 0:00:21
924500 -- (-1073.345) [-1061.467] (-1075.190) (-1065.770) * (-1070.019) (-1063.736) (-1058.910) [-1059.372] -- 0:00:21
925000 -- [-1060.863] (-1062.180) (-1071.918) (-1066.757) * (-1070.859) (-1063.374) (-1065.974) [-1065.806] -- 0:00:21
Average standard deviation of split frequencies: 0.005450
925500 -- (-1073.343) (-1058.029) [-1065.272] (-1071.677) * (-1067.468) (-1065.448) (-1064.571) [-1060.596] -- 0:00:21
926000 -- [-1062.010] (-1068.041) (-1073.852) (-1071.446) * [-1064.599] (-1060.373) (-1064.888) (-1069.235) -- 0:00:20
926500 -- [-1056.633] (-1069.167) (-1069.683) (-1061.523) * (-1070.867) (-1063.944) (-1069.614) [-1064.887] -- 0:00:20
927000 -- (-1062.523) [-1068.901] (-1071.006) (-1068.461) * (-1065.390) [-1060.939] (-1058.756) (-1065.709) -- 0:00:20
927500 -- [-1056.107] (-1074.379) (-1064.290) (-1078.693) * (-1071.054) [-1063.735] (-1067.510) (-1075.917) -- 0:00:20
928000 -- [-1055.852] (-1070.345) (-1073.273) (-1064.734) * (-1064.234) (-1066.666) (-1060.586) [-1066.401] -- 0:00:20
928500 -- [-1059.288] (-1063.619) (-1081.207) (-1055.790) * [-1068.441] (-1072.795) (-1067.501) (-1067.533) -- 0:00:20
929000 -- (-1075.140) (-1065.755) (-1067.229) [-1060.723] * (-1068.815) (-1065.646) [-1060.089] (-1063.606) -- 0:00:20
929500 -- (-1075.573) (-1066.191) [-1071.261] (-1070.356) * (-1066.789) [-1059.441] (-1071.370) (-1062.755) -- 0:00:19
930000 -- (-1074.735) (-1067.486) [-1063.520] (-1061.506) * (-1062.969) (-1062.216) [-1066.420] (-1069.194) -- 0:00:19
Average standard deviation of split frequencies: 0.005333
930500 -- (-1061.432) (-1068.498) [-1062.032] (-1063.519) * (-1063.517) (-1072.300) [-1073.500] (-1064.427) -- 0:00:19
931000 -- (-1056.249) [-1068.332] (-1059.388) (-1067.154) * (-1062.798) (-1064.183) (-1068.303) [-1063.496] -- 0:00:19
931500 -- [-1056.652] (-1075.182) (-1060.936) (-1058.201) * (-1064.424) [-1060.435] (-1067.866) (-1065.690) -- 0:00:19
932000 -- (-1067.921) [-1062.459] (-1060.289) (-1062.136) * (-1067.290) [-1065.959] (-1080.171) (-1071.968) -- 0:00:19
932500 -- (-1076.475) [-1061.308] (-1063.315) (-1075.122) * (-1060.057) (-1062.673) (-1068.758) [-1062.710] -- 0:00:19
933000 -- (-1060.011) [-1067.785] (-1063.059) (-1061.402) * (-1061.240) (-1065.833) [-1070.508] (-1065.322) -- 0:00:18
933500 -- (-1067.620) (-1067.622) (-1070.315) [-1067.011] * (-1063.378) (-1080.025) [-1057.827] (-1056.663) -- 0:00:18
934000 -- (-1071.439) (-1072.419) [-1057.656] (-1065.401) * [-1065.455] (-1070.526) (-1074.024) (-1073.045) -- 0:00:18
934500 -- (-1067.758) (-1069.989) (-1073.298) [-1065.956] * (-1063.824) (-1063.712) (-1064.434) [-1062.513] -- 0:00:18
935000 -- (-1057.943) (-1066.083) [-1065.262] (-1065.670) * (-1058.524) (-1068.151) [-1058.560] (-1070.090) -- 0:00:18
Average standard deviation of split frequencies: 0.005244
935500 -- (-1066.901) [-1060.731] (-1067.379) (-1060.219) * (-1067.169) [-1063.638] (-1061.910) (-1062.372) -- 0:00:18
936000 -- (-1075.774) (-1066.417) [-1063.387] (-1068.674) * (-1075.641) [-1061.048] (-1064.504) (-1062.768) -- 0:00:18
936500 -- (-1069.967) [-1060.163] (-1064.286) (-1066.119) * (-1061.542) (-1062.896) (-1065.941) [-1064.887] -- 0:00:17
937000 -- [-1063.165] (-1061.384) (-1070.463) (-1064.139) * (-1065.714) [-1063.582] (-1070.409) (-1068.608) -- 0:00:17
937500 -- (-1068.294) (-1063.455) [-1057.475] (-1063.416) * [-1064.039] (-1063.931) (-1070.907) (-1070.007) -- 0:00:17
938000 -- (-1064.078) (-1060.483) [-1058.032] (-1063.976) * [-1061.530] (-1058.997) (-1064.452) (-1064.803) -- 0:00:17
938500 -- (-1065.677) (-1056.032) [-1060.481] (-1061.248) * (-1071.581) (-1069.676) (-1069.506) [-1062.747] -- 0:00:17
939000 -- (-1064.903) (-1063.634) (-1059.690) [-1071.579] * (-1068.523) (-1067.358) [-1061.171] (-1065.471) -- 0:00:17
939500 -- (-1070.277) [-1064.738] (-1060.827) (-1073.948) * (-1063.737) (-1068.540) [-1063.225] (-1068.142) -- 0:00:17
940000 -- (-1064.686) [-1061.508] (-1062.650) (-1075.960) * (-1066.638) (-1061.666) (-1063.482) [-1068.278] -- 0:00:16
Average standard deviation of split frequencies: 0.005218
940500 -- (-1068.868) (-1062.772) [-1061.893] (-1070.084) * (-1069.819) (-1065.954) [-1065.709] (-1061.709) -- 0:00:16
941000 -- (-1073.679) (-1067.185) [-1065.464] (-1068.022) * (-1070.076) (-1056.995) [-1063.137] (-1071.915) -- 0:00:16
941500 -- (-1068.709) [-1062.883] (-1082.503) (-1073.966) * (-1061.802) (-1073.255) [-1062.218] (-1062.845) -- 0:00:16
942000 -- (-1067.148) [-1062.931] (-1080.259) (-1071.051) * (-1073.254) [-1062.690] (-1066.224) (-1064.577) -- 0:00:16
942500 -- (-1072.497) [-1072.153] (-1062.640) (-1061.747) * (-1065.083) (-1079.113) (-1061.742) [-1066.140] -- 0:00:16
943000 -- [-1055.741] (-1064.336) (-1062.526) (-1065.711) * (-1065.689) (-1069.390) [-1059.055] (-1065.184) -- 0:00:16
943500 -- (-1064.885) [-1070.704] (-1065.066) (-1067.985) * (-1067.650) (-1072.973) (-1069.099) [-1068.342] -- 0:00:15
944000 -- [-1060.294] (-1070.400) (-1060.705) (-1074.368) * (-1074.830) (-1060.981) [-1071.775] (-1072.099) -- 0:00:15
944500 -- [-1061.733] (-1062.797) (-1068.573) (-1079.113) * (-1074.724) (-1068.051) [-1061.789] (-1067.502) -- 0:00:15
945000 -- (-1070.318) [-1059.630] (-1072.033) (-1072.293) * [-1062.314] (-1065.441) (-1070.581) (-1071.453) -- 0:00:15
Average standard deviation of split frequencies: 0.005364
945500 -- (-1061.068) (-1062.804) [-1065.781] (-1066.561) * (-1059.063) [-1062.758] (-1067.355) (-1074.892) -- 0:00:15
946000 -- [-1065.237] (-1064.297) (-1058.210) (-1073.226) * (-1063.174) (-1066.801) (-1063.250) [-1066.147] -- 0:00:15
946500 -- (-1074.193) (-1064.601) [-1062.002] (-1069.468) * (-1078.706) (-1068.879) [-1061.048] (-1072.001) -- 0:00:15
947000 -- [-1061.970] (-1058.272) (-1065.650) (-1062.172) * [-1065.714] (-1065.577) (-1065.127) (-1066.124) -- 0:00:14
947500 -- (-1069.182) (-1060.448) (-1065.931) [-1065.481] * [-1071.585] (-1068.354) (-1059.673) (-1069.530) -- 0:00:14
948000 -- (-1070.528) (-1073.577) [-1065.061] (-1068.072) * [-1057.413] (-1075.128) (-1067.895) (-1070.282) -- 0:00:14
948500 -- [-1060.996] (-1059.864) (-1075.737) (-1064.854) * (-1067.348) (-1063.585) [-1067.352] (-1064.830) -- 0:00:14
949000 -- (-1065.772) [-1062.726] (-1067.172) (-1063.096) * (-1067.396) (-1064.867) [-1068.791] (-1064.964) -- 0:00:14
949500 -- (-1068.895) (-1064.553) (-1067.998) [-1061.665] * [-1060.707] (-1064.807) (-1065.636) (-1066.848) -- 0:00:14
950000 -- (-1064.959) (-1064.677) (-1077.129) [-1062.733] * (-1064.181) (-1060.720) (-1071.990) [-1060.612] -- 0:00:14
Average standard deviation of split frequencies: 0.005513
950500 -- (-1065.620) (-1061.636) (-1073.427) [-1062.535] * [-1061.588] (-1067.568) (-1065.695) (-1061.201) -- 0:00:13
951000 -- [-1067.564] (-1062.884) (-1062.804) (-1061.768) * (-1060.124) (-1062.086) (-1066.940) [-1065.629] -- 0:00:13
951500 -- (-1069.478) (-1067.668) (-1066.391) [-1062.335] * (-1074.489) [-1056.760] (-1063.680) (-1067.625) -- 0:00:13
952000 -- [-1062.510] (-1064.463) (-1070.732) (-1066.376) * (-1080.456) (-1071.409) [-1060.695] (-1069.730) -- 0:00:13
952500 -- [-1067.058] (-1073.633) (-1072.987) (-1068.413) * (-1073.435) (-1068.502) [-1071.274] (-1062.718) -- 0:00:13
953000 -- (-1063.964) (-1068.775) [-1069.638] (-1072.403) * (-1065.499) [-1055.231] (-1064.568) (-1064.125) -- 0:00:13
953500 -- (-1079.233) (-1069.049) [-1062.602] (-1069.333) * (-1061.361) (-1064.144) [-1062.262] (-1069.658) -- 0:00:13
954000 -- [-1069.686] (-1065.533) (-1065.932) (-1070.198) * (-1065.977) (-1067.689) [-1060.964] (-1069.106) -- 0:00:12
954500 -- (-1065.952) [-1074.766] (-1060.405) (-1060.945) * (-1072.936) [-1061.701] (-1062.350) (-1063.333) -- 0:00:12
955000 -- [-1059.141] (-1067.980) (-1065.156) (-1063.833) * (-1070.794) (-1070.376) (-1069.452) [-1058.216] -- 0:00:12
Average standard deviation of split frequencies: 0.005743
955500 -- [-1058.666] (-1074.979) (-1063.277) (-1061.875) * (-1066.537) (-1063.146) (-1068.381) [-1065.409] -- 0:00:12
956000 -- (-1077.390) (-1068.764) [-1057.087] (-1064.334) * [-1066.723] (-1067.010) (-1070.341) (-1067.060) -- 0:00:12
956500 -- (-1061.968) (-1063.850) (-1067.146) [-1062.328] * [-1064.470] (-1070.318) (-1063.589) (-1063.454) -- 0:00:12
957000 -- (-1061.392) (-1064.291) (-1066.548) [-1060.414] * (-1070.010) (-1067.751) [-1067.763] (-1062.033) -- 0:00:12
957500 -- (-1063.112) (-1067.562) (-1074.078) [-1069.022] * (-1074.302) (-1078.907) [-1056.328] (-1067.727) -- 0:00:11
958000 -- (-1061.803) (-1070.972) [-1066.768] (-1062.367) * (-1072.258) [-1072.914] (-1064.364) (-1067.963) -- 0:00:11
958500 -- (-1061.675) (-1063.536) (-1065.866) [-1062.009] * [-1065.741] (-1067.375) (-1067.232) (-1069.018) -- 0:00:11
959000 -- [-1064.776] (-1074.268) (-1063.654) (-1068.071) * [-1069.731] (-1075.534) (-1068.031) (-1061.151) -- 0:00:11
959500 -- [-1060.773] (-1069.554) (-1063.602) (-1058.424) * (-1062.161) (-1067.697) [-1056.350] (-1069.083) -- 0:00:11
960000 -- (-1064.389) [-1067.712] (-1063.329) (-1068.788) * [-1079.581] (-1064.330) (-1068.611) (-1064.092) -- 0:00:11
Average standard deviation of split frequencies: 0.005282
960500 -- (-1064.193) (-1066.142) [-1058.680] (-1062.395) * (-1079.646) [-1059.692] (-1066.492) (-1060.600) -- 0:00:11
961000 -- (-1080.325) (-1068.534) (-1053.255) [-1063.050] * [-1065.967] (-1075.167) (-1068.319) (-1066.412) -- 0:00:10
961500 -- (-1082.968) (-1066.980) [-1061.395] (-1071.115) * (-1066.314) [-1061.613] (-1068.365) (-1074.937) -- 0:00:10
962000 -- (-1070.976) (-1083.981) [-1057.335] (-1066.879) * (-1064.789) (-1080.730) [-1063.068] (-1074.400) -- 0:00:10
962500 -- (-1068.268) [-1064.660] (-1083.908) (-1069.972) * (-1066.880) (-1064.995) (-1072.838) [-1062.954] -- 0:00:10
963000 -- [-1062.386] (-1066.510) (-1064.204) (-1067.772) * [-1060.599] (-1065.955) (-1064.904) (-1060.345) -- 0:00:10
963500 -- (-1076.977) (-1060.831) [-1061.185] (-1064.886) * (-1069.072) (-1068.763) [-1057.890] (-1068.583) -- 0:00:10
964000 -- (-1074.358) [-1064.907] (-1063.061) (-1056.825) * (-1064.159) (-1059.681) [-1070.268] (-1059.517) -- 0:00:10
964500 -- (-1068.115) (-1062.644) [-1063.878] (-1055.914) * (-1074.011) (-1071.818) [-1058.242] (-1055.640) -- 0:00:10
965000 -- (-1067.522) [-1066.540] (-1066.502) (-1063.787) * (-1065.928) [-1064.115] (-1067.227) (-1057.258) -- 0:00:09
Average standard deviation of split frequencies: 0.004966
965500 -- [-1059.055] (-1064.725) (-1059.705) (-1068.670) * (-1067.748) [-1064.359] (-1061.150) (-1068.090) -- 0:00:09
966000 -- (-1065.828) (-1069.294) [-1060.821] (-1069.225) * (-1074.309) (-1065.850) (-1073.962) [-1056.702] -- 0:00:09
966500 -- (-1067.733) [-1060.929] (-1060.337) (-1064.805) * [-1074.241] (-1068.230) (-1061.564) (-1069.259) -- 0:00:09
967000 -- (-1070.134) [-1067.921] (-1062.531) (-1076.253) * [-1066.841] (-1072.696) (-1060.027) (-1068.264) -- 0:00:09
967500 -- (-1063.449) (-1059.055) (-1065.374) [-1067.989] * [-1062.749] (-1074.241) (-1066.267) (-1063.867) -- 0:00:09
968000 -- (-1073.128) (-1064.949) (-1070.425) [-1066.401] * [-1061.728] (-1066.219) (-1059.853) (-1059.378) -- 0:00:09
968500 -- (-1077.401) (-1065.114) (-1063.506) [-1064.475] * (-1067.305) (-1064.052) (-1065.760) [-1062.916] -- 0:00:08
969000 -- (-1056.989) (-1061.285) (-1065.379) [-1061.224] * (-1064.000) (-1067.264) [-1067.486] (-1061.580) -- 0:00:08
969500 -- (-1064.536) [-1071.222] (-1068.177) (-1068.696) * (-1068.621) (-1070.324) (-1067.338) [-1063.251] -- 0:00:08
970000 -- [-1062.638] (-1069.777) (-1067.355) (-1065.149) * (-1065.671) (-1063.963) [-1062.466] (-1058.337) -- 0:00:08
Average standard deviation of split frequencies: 0.005228
970500 -- (-1057.360) [-1067.658] (-1060.058) (-1069.373) * (-1073.429) [-1065.761] (-1072.834) (-1059.755) -- 0:00:08
971000 -- [-1060.924] (-1067.258) (-1068.259) (-1073.810) * (-1060.636) (-1064.692) (-1063.154) [-1064.614] -- 0:00:08
971500 -- (-1063.026) (-1062.928) (-1062.974) [-1062.845] * [-1063.443] (-1078.123) (-1072.300) (-1064.353) -- 0:00:08
972000 -- (-1063.387) (-1065.360) [-1067.438] (-1068.344) * (-1071.286) (-1068.312) [-1063.514] (-1064.535) -- 0:00:07
972500 -- [-1068.448] (-1065.810) (-1067.280) (-1072.549) * (-1074.369) (-1073.862) (-1065.002) [-1058.388] -- 0:00:07
973000 -- (-1070.047) (-1067.978) [-1059.406] (-1073.598) * [-1065.302] (-1069.740) (-1069.574) (-1073.731) -- 0:00:07
973500 -- [-1057.798] (-1067.387) (-1068.067) (-1071.830) * (-1066.131) (-1079.819) (-1060.077) [-1061.502] -- 0:00:07
974000 -- [-1065.382] (-1063.039) (-1067.029) (-1068.618) * (-1064.652) (-1090.756) (-1065.977) [-1062.685] -- 0:00:07
974500 -- [-1058.274] (-1058.622) (-1063.445) (-1069.502) * (-1077.024) (-1076.436) (-1065.685) [-1065.986] -- 0:00:07
975000 -- (-1063.173) (-1061.166) [-1067.687] (-1072.970) * (-1064.955) (-1065.889) [-1057.278] (-1073.398) -- 0:00:07
Average standard deviation of split frequencies: 0.004972
975500 -- (-1059.331) (-1057.914) (-1064.007) [-1068.579] * [-1059.857] (-1069.022) (-1065.942) (-1071.568) -- 0:00:06
976000 -- (-1061.739) (-1063.381) (-1059.961) [-1065.143] * [-1061.409] (-1064.566) (-1062.188) (-1059.278) -- 0:00:06
976500 -- (-1069.620) (-1064.298) [-1056.708] (-1066.966) * (-1063.913) (-1065.107) [-1063.043] (-1065.165) -- 0:00:06
977000 -- [-1064.710] (-1062.748) (-1070.668) (-1064.257) * (-1064.811) (-1071.511) [-1057.911] (-1062.163) -- 0:00:06
977500 -- (-1069.807) [-1060.823] (-1068.398) (-1074.980) * (-1076.501) (-1059.304) [-1060.710] (-1072.655) -- 0:00:06
978000 -- [-1066.126] (-1069.579) (-1073.319) (-1069.190) * [-1062.185] (-1063.277) (-1063.604) (-1070.866) -- 0:00:06
978500 -- (-1073.369) (-1064.884) (-1074.874) [-1063.613] * [-1055.511] (-1065.507) (-1076.382) (-1070.996) -- 0:00:06
979000 -- [-1058.738] (-1063.803) (-1071.887) (-1065.842) * (-1058.797) (-1068.503) [-1069.483] (-1060.609) -- 0:00:05
979500 -- [-1059.158] (-1054.539) (-1068.999) (-1064.789) * [-1062.059] (-1062.843) (-1057.282) (-1057.608) -- 0:00:05
980000 -- (-1065.854) [-1064.827] (-1073.639) (-1067.171) * (-1061.701) (-1070.367) (-1069.651) [-1061.082] -- 0:00:05
Average standard deviation of split frequencies: 0.005486
980500 -- [-1067.144] (-1059.919) (-1062.996) (-1070.840) * (-1077.880) (-1064.443) (-1060.473) [-1060.920] -- 0:00:05
981000 -- (-1073.660) (-1066.972) (-1063.477) [-1066.116] * (-1066.136) [-1058.814] (-1067.244) (-1074.067) -- 0:00:05
981500 -- [-1067.479] (-1070.540) (-1068.664) (-1068.018) * (-1065.195) [-1071.273] (-1070.117) (-1063.391) -- 0:00:05
982000 -- (-1061.767) (-1066.883) (-1075.130) [-1058.109] * (-1067.861) (-1074.653) [-1062.890] (-1077.254) -- 0:00:05
982500 -- (-1069.418) (-1069.726) (-1059.751) [-1064.781] * (-1061.277) [-1062.930] (-1070.164) (-1056.883) -- 0:00:04
983000 -- [-1063.581] (-1070.832) (-1065.675) (-1062.577) * [-1058.209] (-1062.112) (-1076.496) (-1058.631) -- 0:00:04
983500 -- (-1067.982) (-1063.026) (-1067.368) [-1069.012] * [-1059.670] (-1065.766) (-1062.469) (-1072.040) -- 0:00:04
984000 -- (-1067.221) (-1074.126) [-1064.788] (-1066.541) * (-1068.205) (-1061.632) (-1069.076) [-1061.604] -- 0:00:04
984500 -- (-1068.357) (-1078.617) (-1060.666) [-1062.456] * [-1063.885] (-1066.620) (-1072.984) (-1067.240) -- 0:00:04
985000 -- (-1061.193) [-1065.675] (-1069.977) (-1069.199) * (-1070.521) (-1065.535) (-1065.755) [-1067.463] -- 0:00:04
Average standard deviation of split frequencies: 0.005428
985500 -- [-1066.926] (-1059.720) (-1063.006) (-1061.603) * (-1063.812) [-1059.731] (-1063.734) (-1067.989) -- 0:00:04
986000 -- [-1062.052] (-1077.414) (-1064.032) (-1063.092) * (-1065.251) (-1068.473) (-1070.594) [-1065.435] -- 0:00:03
986500 -- (-1066.953) (-1059.950) [-1057.449] (-1070.828) * (-1076.850) (-1079.623) [-1063.981] (-1063.995) -- 0:00:03
987000 -- (-1064.803) (-1064.611) [-1066.430] (-1072.095) * [-1066.602] (-1063.044) (-1066.448) (-1062.181) -- 0:00:03
987500 -- (-1061.801) (-1067.066) (-1072.031) [-1060.496] * (-1070.401) (-1061.823) (-1073.269) [-1057.926] -- 0:00:03
988000 -- (-1065.590) (-1062.888) [-1064.874] (-1064.429) * (-1066.765) [-1061.845] (-1060.241) (-1070.230) -- 0:00:03
988500 -- (-1073.750) [-1066.755] (-1060.003) (-1072.722) * (-1065.609) (-1068.861) [-1065.139] (-1071.219) -- 0:00:03
989000 -- (-1063.631) [-1063.185] (-1067.089) (-1059.287) * (-1072.414) (-1073.202) (-1067.578) [-1067.127] -- 0:00:03
989500 -- (-1066.255) [-1060.072] (-1064.683) (-1067.315) * (-1070.567) (-1066.980) [-1064.363] (-1076.296) -- 0:00:02
990000 -- [-1062.940] (-1065.794) (-1063.435) (-1070.893) * (-1070.991) [-1068.370] (-1061.128) (-1065.717) -- 0:00:02
Average standard deviation of split frequencies: 0.005178
990500 -- (-1081.017) (-1061.496) [-1064.703] (-1069.590) * (-1071.599) (-1075.828) (-1070.268) [-1071.853] -- 0:00:02
991000 -- (-1069.135) (-1076.487) (-1078.719) [-1057.014] * (-1069.758) [-1066.480] (-1064.062) (-1071.251) -- 0:00:02
991500 -- [-1065.922] (-1074.636) (-1070.188) (-1065.476) * [-1064.850] (-1063.259) (-1070.805) (-1077.919) -- 0:00:02
992000 -- [-1063.055] (-1070.060) (-1065.505) (-1062.231) * (-1064.146) (-1064.086) (-1069.559) [-1066.066] -- 0:00:02
992500 -- (-1070.331) (-1065.132) [-1063.007] (-1061.988) * [-1067.616] (-1076.582) (-1062.858) (-1062.022) -- 0:00:02
993000 -- [-1062.458] (-1061.651) (-1065.658) (-1066.321) * [-1057.751] (-1058.041) (-1066.250) (-1061.329) -- 0:00:01
993500 -- [-1062.235] (-1069.711) (-1065.654) (-1069.433) * (-1058.947) (-1063.304) [-1064.116] (-1059.210) -- 0:00:01
994000 -- (-1068.427) [-1060.150] (-1067.264) (-1075.598) * [-1058.164] (-1072.014) (-1068.777) (-1059.131) -- 0:00:01
994500 -- (-1069.050) [-1059.214] (-1068.869) (-1085.251) * (-1071.898) (-1076.415) (-1074.327) [-1056.568] -- 0:00:01
995000 -- [-1066.185] (-1067.839) (-1064.273) (-1069.964) * (-1063.788) (-1072.418) (-1061.086) [-1058.533] -- 0:00:01
Average standard deviation of split frequencies: 0.005429
995500 -- (-1057.526) (-1070.290) [-1070.605] (-1070.739) * (-1061.937) (-1076.159) [-1065.042] (-1058.556) -- 0:00:01
996000 -- (-1058.125) (-1078.629) [-1065.591] (-1065.879) * (-1069.770) (-1060.565) (-1063.843) [-1061.516] -- 0:00:01
996500 -- [-1056.562] (-1060.384) (-1067.049) (-1069.179) * (-1071.975) [-1055.102] (-1066.547) (-1062.625) -- 0:00:00
997000 -- (-1074.979) (-1060.654) [-1055.319] (-1067.430) * (-1062.143) [-1064.256] (-1073.635) (-1062.937) -- 0:00:00
997500 -- (-1070.255) [-1055.082] (-1060.230) (-1057.967) * (-1065.354) [-1060.050] (-1071.108) (-1068.111) -- 0:00:00
998000 -- [-1063.246] (-1068.029) (-1064.326) (-1071.384) * [-1060.200] (-1062.342) (-1068.226) (-1061.589) -- 0:00:00
998500 -- (-1070.817) (-1064.451) [-1064.805] (-1060.578) * (-1080.993) (-1064.118) (-1067.224) [-1063.738] -- 0:00:00
999000 -- (-1076.389) [-1058.520] (-1062.085) (-1061.765) * (-1069.765) [-1059.150] (-1065.384) (-1066.109) -- 0:00:00
999500 -- (-1064.465) [-1064.111] (-1063.503) (-1061.792) * [-1059.936] (-1065.268) (-1062.259) (-1057.322) -- 0:00:00
1000000 -- (-1062.395) [-1070.547] (-1066.885) (-1065.348) * (-1064.718) (-1073.474) (-1073.561) [-1059.882] -- 0:00:00
Average standard deviation of split frequencies: 0.005376
Final log likelihoods and log prior probs for run 1 (stored and calculated):
Chain 1 -- -1062.395070 -- 19.388725
Chain 1 -- -1062.395068 -- 19.388725
Chain 2 -- -1070.546881 -- 16.459964
Chain 2 -- -1070.546878 -- 16.459964
Chain 3 -- -1066.884682 -- 20.811258
Chain 3 -- -1066.884673 -- 20.811258
Chain 4 -- -1065.348276 -- 18.761723
Chain 4 -- -1065.348283 -- 18.761723
Final log likelihoods and log prior probs for run 2 (stored and calculated):
Chain 1 -- -1064.717631 -- 17.560138
Chain 1 -- -1064.717630 -- 17.560138
Chain 2 -- -1073.474164 -- 16.323671
Chain 2 -- -1073.474178 -- 16.323671
Chain 3 -- -1073.560749 -- 17.485800
Chain 3 -- -1073.560747 -- 17.485800
Chain 4 -- -1059.882361 -- 21.492799
Chain 4 -- -1059.882355 -- 21.492799
Analysis completed in 4 mins 42 seconds
Analysis used 282.14 seconds of CPU time
Likelihood of best state for "cold" chain of run 1 was -1050.66
Likelihood of best state for "cold" chain of run 2 was -1050.75
Acceptance rates for the moves in the "cold" chain of run 1:
With prob. (last 100) chain accepted proposals by move
53.6 % ( 42 %) Dirichlet(Revmat{all})
68.8 % ( 60 %) Slider(Revmat{all})
33.0 % ( 34 %) Dirichlet(Pi{all})
34.2 % ( 27 %) Slider(Pi{all})
35.7 % ( 18 %) Multiplier(Alpha{1,2})
46.7 % ( 25 %) Multiplier(Alpha{3})
58.2 % ( 29 %) Slider(Pinvar{all})
24.8 % ( 29 %) ExtSPR(Tau{all},V{all})
6.7 % ( 4 %) ExtTBR(Tau{all},V{all})
27.8 % ( 24 %) NNI(Tau{all},V{all})
25.4 % ( 20 %) ParsSPR(Tau{all},V{all})
26.9 % ( 21 %) Multiplier(V{all})
51.0 % ( 52 %) Nodeslider(V{all})
26.2 % ( 27 %) TLMultiplier(V{all})
Acceptance rates for the moves in the "cold" chain of run 2:
With prob. (last 100) chain accepted proposals by move
53.4 % ( 43 %) Dirichlet(Revmat{all})
68.4 % ( 57 %) Slider(Revmat{all})
32.6 % ( 27 %) Dirichlet(Pi{all})
33.8 % ( 32 %) Slider(Pi{all})
36.1 % ( 25 %) Multiplier(Alpha{1,2})
46.4 % ( 20 %) Multiplier(Alpha{3})
58.2 % ( 28 %) Slider(Pinvar{all})
24.8 % ( 22 %) ExtSPR(Tau{all},V{all})
6.8 % ( 3 %) ExtTBR(Tau{all},V{all})
27.7 % ( 23 %) NNI(Tau{all},V{all})
25.2 % ( 17 %) ParsSPR(Tau{all},V{all})
26.9 % ( 25 %) Multiplier(V{all})
51.2 % ( 61 %) Nodeslider(V{all})
25.9 % ( 31 %) TLMultiplier(V{all})
Chain swap information for run 1:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166847 0.75 0.55
3 | 166522 166803 0.77
4 | 166522 166498 166808
Chain swap information for run 2:
1 2 3 4
----------------------------------
1 | 0.74 0.52 0.35
2 | 166193 0.76 0.55
3 | 166665 166754 0.77
4 | 166434 166662 167292
Upper diagonal: Proportion of successful state exchanges between chains
Lower diagonal: Number of attempted state exchanges between chains
Chain information:
ID -- Heat
-----------
1 -- 1.00 (cold chain)
2 -- 0.91
3 -- 0.83
4 -- 0.77
Heat = 1 / (1 + T * (ID - 1))
(where T = 0.10 is the temperature and ID is the chain number)
Setting burn-in to 2500
Summarizing parameters in files /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p and /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p
Writing summary statistics to file /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat
Using relative burnin ('relburnin=yes'), discarding the first 25 % of samples
Below are rough plots of the generation (x-axis) versus the log
probability of observing the data (y-axis). You can use these
graphs to determine what the burn in for your analysis should be.
When the log probability starts to plateau you may be at station-
arity. Sample trees and parameters after the log probability
plateaus. Of course, this is not a guarantee that you are at sta-
tionarity. Also examine the convergence diagnostics provided by
the 'sump' and 'sumt' commands for all the parameters in your
model. Remember that the burn in is the number of samples to dis-
card. There are a total of ngen / samplefreq samples taken during
a MCMC analysis.
Overlay plot for both runs:
(1 = Run number 1; 2 = Run number 2; * = Both runs)
+------------------------------------------------------------+ -1060.26
| 2 |
| 1 |
| 2 |
| 2 1 |
| 212 1 1 2 2 122 2 |
| 2 1 1 1 1 2 1 11 1 2 1 1 *|
|2 2 1 2 2 2 2 *1 1 *1 22 22 2 1 |
| 1* 121 22 * 2 22 12 11 1 11 12 2 |
| 2 2* 1 1 2 1 2 * 11 212 *11 |
|1 1 1* * 1 2 |
| 1 22 2* 12 11 2 2 2 |
| 2 2 |
| 1 |
| |
| 1 |
+------+-----+-----+-----+-----+-----+-----+-----+-----+-----+ -1066.43
^ ^
250000 1000000
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1057.86 -1073.03
2 -1057.71 -1072.87
--------------------------------------
TOTAL -1057.78 -1072.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.134575 0.036748 0.778742 1.515409 1.117591 1343.68 1363.32 1.000
r(A<->C){all} 0.081645 0.000928 0.025294 0.139950 0.077888 665.25 718.81 1.000
r(A<->G){all} 0.191549 0.002997 0.096250 0.301956 0.188149 776.33 793.34 1.000
r(A<->T){all} 0.073866 0.001583 0.002931 0.149883 0.067723 645.00 653.76 1.001
r(C<->G){all} 0.049810 0.000358 0.016507 0.086660 0.047638 921.00 992.98 1.000
r(C<->T){all} 0.566748 0.006083 0.420874 0.720081 0.566933 686.52 813.62 1.002
r(G<->T){all} 0.036383 0.000430 0.003987 0.078604 0.032885 811.75 972.83 1.000
pi(A){all} 0.225153 0.000556 0.179157 0.271622 0.224436 1030.33 1080.56 1.000
pi(C){all} 0.306555 0.000578 0.258590 0.350077 0.305942 1180.87 1188.32 1.000
pi(G){all} 0.284778 0.000630 0.231761 0.329885 0.284209 1095.09 1143.90 1.001
pi(T){all} 0.183514 0.000392 0.146280 0.224131 0.182361 1023.28 1046.15 1.000
alpha{1,2} 0.139686 0.001483 0.072609 0.228715 0.136936 1129.43 1145.04 1.000
alpha{3} 1.849847 0.555182 0.638544 3.311391 1.732669 1238.27 1369.64 1.000
pinvar{all} 0.384036 0.008597 0.184943 0.544266 0.396876 884.55 956.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
Setting urn-in to 2500
Summarizing trees in files "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" and "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.t"
Using relative burnin ('relburnin=yes'), discarding the first 25 % of sampled trees
Writing statistics to files /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.<parts|tstat|vstat|trprobs|con>
Examining first file ...
Found one tree block in file "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.t" with 2001 trees in last block
Expecting the same number of trees in the last tree block of all files
Tree reading status:
0 10 20 30 40 50 60 70 80 90 100
v-------v-------v-------v-------v-------v-------v-------v-------v-------v-------v
*********************************************************************************
Read a total of 4002 trees in 2 files (sampling 3002 of them)
(Each file contained 2001 trees of which 1501 were sampled)
General explanation:
In an unrooted tree, a taxon bipartition (split) is specified by removing a
branch, thereby dividing the species into those to the left and those to the
right of the branch. Here, taxa to one side of the removed branch are denoted
'.' and those to the other side are denoted '*'. Specifically, the '.' symbol
is used for the taxa on the same side as the outgroup.
In a rooted or clock tree, the tree is rooted using the model and not by
reference to an outgroup. Each bipartition therefore corresponds to a clade,
that is, a group that includes all the descendants of a particular branch in
the tree. Taxa that are included in each clade are denoted using '*', and
taxa that are not included are denoted using the '.' symbol.
The output first includes a key to all the bipartitions with frequency larger
or equual to (Minpartfreq) in at least one run. Minpartfreq is a paramiter to
sumt command and currently it is set to 0.10. This is followed by a table
with statistics for the informative bipartitions (those including at least
two taxa), sorted from highest to lowest probability. For each bipartition,
the table gives the number of times the partition or split was observed in all
runs (#obs) and the posterior probability of the bipartition (Probab.), which
is the same as the split frequency. If several runs are summarized, this is
followed by the minimum split frequency (Min(s)), the maximum frequency
(Max(s)), and the standard deviation of frequencies (Stddev(s)) across runs.
The latter value should approach 0 for all bipartitions as MCMC runs converge.
This is followed by a table summarizing branch lengths, node heights (if a
clock model was used) and relaxed clock parameters (if a relaxed clock model
was used). The mean, variance, and 95 % credible interval are given for each
of these parameters. If several runs are summarized, the potential scale
reduction factor (PSRF) is also given; it should approach 1 as runs converge.
Node heights will take calibration points into account, if such points were
used in the analysis.
Note that Stddev may be unreliable if the partition is not present in all
runs (the last column indicates the number of runs that sampled the partition
if more than one run is summarized). The PSRF is not calculated at all if
the partition is not present in all runs.The PSRF is also sensitive to small
sample sizes and it should only be considered a rough guide to convergence
since some of the assumptions allowing one to interpret it as a true potential
scale reduction factor are violated in MrBayes.
List of taxa in bipartitions:
1 -- C1
2 -- C2
3 -- C3
4 -- C4
5 -- C5
6 -- C6
7 -- C7
8 -- C8
9 -- C9
10 -- C10
11 -- C11
Key to taxon bipartitions (saved to file "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.parts"):
ID -- Partition
-----------------
1 -- .**********
2 -- .*.........
3 -- ..*........
4 -- ...*.......
5 -- ....*......
6 -- .....*.....
7 -- ......*....
8 -- .......*...
9 -- ........*..
10 -- .........*.
11 -- ..........*
12 -- .........**
13 -- .....******
14 -- .**........
15 -- .....***.**
16 -- .....*.*...
17 -- .....***...
18 -- ...**......
19 -- .***.......
20 -- ...********
21 -- .***.******
22 -- ......*..**
23 -- ......**...
24 -- ......**.**
25 -- ....*******
26 -- .**..******
27 -- .****......
28 -- .....*.*.**
-----------------
Summary statistics for informative taxon bipartitions
(saved to file "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.tstat"):
ID #obs Probab. Sd(s)+ Min(s) Max(s) Nruns
----------------------------------------------------------------
12 2964 0.987342 0.000942 0.986676 0.988008 2
13 2894 0.964024 0.000942 0.963358 0.964690 2
14 2664 0.887408 0.006595 0.882745 0.892072 2
15 2618 0.872085 0.003769 0.869420 0.874750 2
16 1617 0.538641 0.002355 0.536975 0.540306 2
17 1217 0.405396 0.008951 0.399067 0.411726 2
18 1217 0.405396 0.008009 0.399734 0.411059 2
19 1067 0.355430 0.000471 0.355097 0.355763 2
20 889 0.296136 0.002355 0.294470 0.297801 2
21 849 0.282811 0.007066 0.277815 0.287808 2
22 802 0.267155 0.015075 0.256496 0.277815 2
23 765 0.254830 0.008009 0.249167 0.260493 2
24 613 0.204197 0.006124 0.199867 0.208528 2
25 513 0.170886 0.003298 0.168554 0.173218 2
26 497 0.165556 0.009893 0.158561 0.172552 2
27 487 0.162225 0.007066 0.157229 0.167222 2
28 383 0.127582 0.000471 0.127249 0.127915 2
----------------------------------------------------------------
+ Convergence diagnostic (standard deviation of split frequencies)
should approach 0.0 as runs converge.
Summary statistics for branch and node parameters
(saved to file "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.vstat"):
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median PSRF+ Nruns
-------------------------------------------------------------------------------------------
length{all}[1] 0.075615 0.000855 0.027402 0.132881 0.070545 1.002 2
length{all}[2] 0.012116 0.000083 0.000109 0.029715 0.009806 1.000 2
length{all}[3] 0.009790 0.000067 0.000002 0.025976 0.007788 1.000 2
length{all}[4] 0.042823 0.000488 0.006651 0.084471 0.038512 1.000 2
length{all}[5] 0.049499 0.000566 0.010076 0.097283 0.045109 1.000 2
length{all}[6] 0.189032 0.003463 0.087636 0.307633 0.181509 1.000 2
length{all}[7] 0.111929 0.001697 0.041166 0.195855 0.107092 1.001 2
length{all}[8] 0.053440 0.000855 0.001853 0.108164 0.049274 1.000 2
length{all}[9] 0.179706 0.003291 0.073457 0.290107 0.171314 1.000 2
length{all}[10] 0.048786 0.000651 0.006716 0.099095 0.044348 1.000 2
length{all}[11] 0.045918 0.000605 0.006166 0.094981 0.041869 1.000 2
length{all}[12] 0.073354 0.001239 0.012311 0.141551 0.068684 1.001 2
length{all}[13] 0.064556 0.001270 0.009004 0.135408 0.058652 1.000 2
length{all}[14] 0.024479 0.000245 0.000024 0.055665 0.021531 1.000 2
length{all}[15] 0.058811 0.001332 0.000038 0.129024 0.051864 1.000 2
length{all}[16] 0.038988 0.000731 0.000065 0.090993 0.033094 0.999 2
length{all}[17] 0.040569 0.000769 0.000334 0.094628 0.036334 1.001 2
length{all}[18] 0.023800 0.000292 0.000087 0.057612 0.019663 1.001 2
length{all}[19] 0.018190 0.000173 0.000616 0.044278 0.015211 0.999 2
length{all}[20] 0.022062 0.000300 0.000015 0.053525 0.019061 1.000 2
length{all}[21] 0.017566 0.000214 0.000049 0.045727 0.013847 0.999 2
length{all}[22] 0.030056 0.000507 0.000142 0.073957 0.024919 1.000 2
length{all}[23] 0.033529 0.000615 0.000008 0.079637 0.028099 1.003 2
length{all}[24] 0.032609 0.000699 0.000030 0.083940 0.026002 1.003 2
length{all}[25] 0.014754 0.000210 0.000026 0.046123 0.010385 1.000 2
length{all}[26] 0.014468 0.000176 0.000021 0.042772 0.010488 0.998 2
length{all}[27] 0.011589 0.000091 0.000007 0.030021 0.009445 0.998 2
length{all}[28] 0.023580 0.000427 0.000034 0.059816 0.017944 0.998 2
-------------------------------------------------------------------------------------------
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge. NA is reported when
deviation of parameter values within all runs is 0 or when a parameter
value (a branch length, for instance) is not sampled in all runs.
Summary statistics for partitions with frequency >= 0.10 in at least one run:
Average standard deviation of split frequencies = 0.005376
Maximum standard deviation of split frequencies = 0.015075
Average PSRF for parameter values ( excluding NA and >10.0 ) = 1.000
Maximum PSRF for parameter values = 1.003
Clade credibility values:
/---------------------------------------------------------------------- C1 (1)
|
|---------------------------------------------------------------------- C4 (4)
|
|---------------------------------------------------------------------- C5 (5)
|
| /----------------- C6 (6)
| /--------54-------+
| | \----------------- C8 (8)
| |
+ /-------87-------+----------------------------------- C7 (7)
| | |
| | | /----------------- C10 (10)
|--------96-------+ \--------99-------+
| | \----------------- C11 (11)
| |
| \---------------------------------------------------- C9 (9)
|
| /----------------- C2 (2)
\-------------------------89-------------------------+
\----------------- C3 (3)
Phylogram (based on average branch lengths):
/---------------- C1 (1)
|
|--------- C4 (4)
|
|---------- C5 (5)
|
| /---------------------------------------- C6 (6)
| /-------+
| | \----------- C8 (8)
| |
+ /----------+------------------------ C7 (7)
| | |
| | | /---------- C10 (10)
|------------+ \---------------+
| | \--------- C11 (11)
| |
| \-------------------------------------- C9 (9)
|
| /-- C2 (2)
\----+
\- C3 (3)
|----------| 0.050 expected changes per site
Calculating tree probabilities...
Credible sets of trees (646 trees sampled):
50 % credible set contains 36 trees
90 % credible set contains 346 trees
95 % credible set contains 496 trees
99 % credible set contains 616 trees
Exiting mrbayes block
Reached end of file
Tasks completed, exiting program because mode is noninteractive
To return control to the command line after completion of file processing,
set mode to interactive with 'mb -i <filename>' (i is for interactive)
or use 'set mode=interactive'
MrBayes output code: 0
CODONML in paml version 4.8, March 2014
----------------------------------------------
Phe F TTT | Ser S TCT | Tyr Y TAT | Cys C TGT
TTC | TCC | TAC | TGC
Leu L TTA | TCA | *** * TAA | *** * TGA
TTG | TCG | TAG | Trp W TGG
----------------------------------------------
Leu L CTT | Pro P CCT | His H CAT | Arg R CGT
CTC | CCC | CAC | CGC
CTA | CCA | Gln Q CAA | CGA
CTG | CCG | CAG | CGG
----------------------------------------------
Ile I ATT | Thr T ACT | Asn N AAT | Ser S AGT
ATC | ACC | AAC | AGC
ATA | ACA | Lys K AAA | Arg R AGA
Met M ATG | ACG | AAG | AGG
----------------------------------------------
Val V GTT | Ala A GCT | Asp D GAT | Gly G GGT
GTC | GCC | GAC | GGC
GTA | GCA | Glu E GAA | GGA
GTG | GCG | GAG | GGG
----------------------------------------------
Nice code, uuh?
NSsites batch run (ncatG as in YNGP2000): 0 1 2 3 7 8
seq file is not paml/phylip format. Trying nexus format.
ns = 11 ls = 321
Reading sequences, sequential format..
Reading seq # 1: C1
Reading seq # 2: C2
Reading seq # 3: C3
Reading seq # 4: C4
Reading seq # 5: C5
Reading seq # 6: C6
Reading seq # 7: C7
Reading seq # 8: C8
Reading seq # 9: C9
Reading seq #10: C10
Reading seq #11: C11
Sites with gaps or missing data are removed.
6 ambiguity characters in seq. 1
6 ambiguity characters in seq. 2
6 ambiguity characters in seq. 3
6 ambiguity characters in seq. 4
6 ambiguity characters in seq. 5
3 ambiguity characters in seq. 6
6 ambiguity characters in seq. 7
6 ambiguity characters in seq. 8
6 ambiguity characters in seq. 9
6 ambiguity characters in seq. 10
6 ambiguity characters in seq. 11
2 sites are removed. 26 107
Sequences read..
Counting site patterns.. 0:00
86 patterns at 105 / 105 sites (100.0%), 0:00
Counting codons..
NG distances for seqs.:
1 2 3 4 5 6 7 8 9 10 11
440 bytes for distance
83936 bytes for conP
11696 bytes for fhK
5000000 bytes for space
Model 0: one-ratio
TREE # 1
(1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
251808 bytes for conP, adjusted
0.098030 0.067621 0.075178 0.064199 0.047752 0.027887 0.193000 0.099000 0.153078 0.065592 0.067478 0.044930 0.229345 0.037355 0.014870 0.004515 0.300000 1.300000
ntime & nrate & np: 16 2 18
Bounds (np=18):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000100
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 999.000000
np = 18
lnL0 = -1257.050609
Iterating by ming2
Initial: fx= 1257.050609
x= 0.09803 0.06762 0.07518 0.06420 0.04775 0.02789 0.19300 0.09900 0.15308 0.06559 0.06748 0.04493 0.22934 0.03736 0.01487 0.00452 0.30000 1.30000
1 h-m-p 0.0000 0.0004 271.9480 +++ 1243.075041 m 0.0004 24 | 0/18
2 h-m-p 0.0000 0.0000 14330.3177 +YCYC 1219.269935 3 0.0000 50 | 0/18
3 h-m-p 0.0005 0.0024 224.7666 +YCYCCC 1178.133610 5 0.0022 81 | 0/18
4 h-m-p 0.0001 0.0006 682.1349 ++ 1145.356870 m 0.0006 102 | 0/18
5 h-m-p 0.0000 0.0000 1569.0709 +YYYCCC 1143.636347 5 0.0000 131 | 0/18
6 h-m-p 0.0001 0.0014 223.0588 ++ 1134.957713 m 0.0014 152 | 0/18
7 h-m-p 0.0000 0.0000 819.4688
h-m-p: 9.76005785e-20 4.88002893e-19 8.19468849e+02 1134.957713
.. | 0/18
8 h-m-p 0.0000 0.0004 3102.8338 +YYYYC 1111.383053 4 0.0000 196 | 0/18
9 h-m-p 0.0001 0.0004 202.6288 +YYCYCCC 1100.847176 6 0.0003 228 | 0/18
10 h-m-p 0.0000 0.0000 2543.5860 +CYCYCCC 1091.692573 6 0.0000 260 | 0/18
11 h-m-p 0.0000 0.0000 28901.6198 +YYCYCCC 1053.018855 6 0.0000 292 | 0/18
12 h-m-p 0.0000 0.0001 1238.1068 YCYCCCC 1046.533879 6 0.0000 323 | 0/18
13 h-m-p 0.0001 0.0004 142.1753 YCCC 1045.616567 3 0.0001 349 | 0/18
14 h-m-p 0.0001 0.0014 134.2470 +CYCCC 1041.805722 4 0.0008 378 | 0/18
15 h-m-p 0.0003 0.0015 63.5304 CYCCC 1040.989448 4 0.0006 406 | 0/18
16 h-m-p 0.0016 0.0078 23.0912 CCCCC 1040.533152 4 0.0020 435 | 0/18
17 h-m-p 0.0009 0.0225 49.4355 +CYC 1039.093186 2 0.0038 460 | 0/18
18 h-m-p 0.0014 0.0068 102.0251 +YCYCCC 1035.831948 5 0.0038 490 | 0/18
19 h-m-p 0.0021 0.0104 181.3144 CCC 1032.425204 2 0.0028 515 | 0/18
20 h-m-p 0.0024 0.0118 65.5202 CCCCC 1031.273369 4 0.0027 544 | 0/18
21 h-m-p 0.0029 0.0143 33.2286 YCC 1031.039789 2 0.0013 568 | 0/18
22 h-m-p 0.0037 0.0221 11.7574 YCC 1030.965805 2 0.0016 592 | 0/18
23 h-m-p 0.0051 0.0894 3.6498 YCC 1030.922596 2 0.0038 616 | 0/18
24 h-m-p 0.0073 0.1509 1.9152 +YCC 1030.618731 2 0.0216 641 | 0/18
25 h-m-p 0.0061 0.0474 6.7470 +YYYYCCCC 1027.321008 7 0.0247 673 | 0/18
26 h-m-p 0.0018 0.0091 26.9599 CCCC 1026.736496 3 0.0019 700 | 0/18
27 h-m-p 0.2882 2.4024 0.1759 YCC 1025.352627 2 0.6273 724 | 0/18
28 h-m-p 0.7782 4.6370 0.1418 CYC 1024.795149 2 0.6975 766 | 0/18
29 h-m-p 1.6000 8.0000 0.0506 YCC 1024.593496 2 1.1849 808 | 0/18
30 h-m-p 1.6000 8.0000 0.0099 CCC 1024.500871 2 1.5766 851 | 0/18
31 h-m-p 0.7922 8.0000 0.0197 +CCC 1024.422397 2 2.8238 895 | 0/18
32 h-m-p 1.6000 8.0000 0.0278 YC 1024.361607 1 2.7280 935 | 0/18
33 h-m-p 1.6000 8.0000 0.0083 CCC 1024.332283 2 2.2086 978 | 0/18
34 h-m-p 0.6562 8.0000 0.0279 +CC 1024.313392 1 3.5274 1020 | 0/18
35 h-m-p 1.6000 8.0000 0.0067 YC 1024.296449 1 3.5366 1060 | 0/18
36 h-m-p 1.6000 8.0000 0.0045 +YC 1024.278432 1 4.3430 1101 | 0/18
37 h-m-p 1.0932 8.0000 0.0181 CC 1024.271959 1 1.7369 1142 | 0/18
38 h-m-p 1.6000 8.0000 0.0006 C 1024.271559 0 1.4668 1181 | 0/18
39 h-m-p 1.6000 8.0000 0.0004 C 1024.271481 0 1.9414 1220 | 0/18
40 h-m-p 1.6000 8.0000 0.0005 C 1024.271439 0 2.4925 1259 | 0/18
41 h-m-p 1.6000 8.0000 0.0001 C 1024.271433 0 1.8118 1298 | 0/18
42 h-m-p 1.6000 8.0000 0.0001 ++ 1024.271415 m 8.0000 1337 | 0/18
43 h-m-p 1.6000 8.0000 0.0002 C 1024.271395 0 1.4222 1376 | 0/18
44 h-m-p 1.4587 8.0000 0.0002 C 1024.271393 0 1.4271 1415 | 0/18
45 h-m-p 1.6000 8.0000 0.0000 Y 1024.271393 0 1.1652 1454 | 0/18
46 h-m-p 1.6000 8.0000 0.0000 Y 1024.271393 0 1.1751 1493 | 0/18
47 h-m-p 1.6000 8.0000 0.0000 ---------------Y 1024.271393 0 0.0000 1547
Out..
lnL = -1024.271393
1548 lfun, 1548 eigenQcodon, 24768 P(t)
Time used: 0:06
Model 1: NearlyNeutral
TREE # 1
(1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
0.098030 0.067621 0.075178 0.064199 0.047752 0.027887 0.193000 0.099000 0.153078 0.065592 0.067478 0.044930 0.229345 0.037355 0.014870 0.004515 3.258659 0.816750 0.136540
ntime & nrate & np: 16 2 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 1.000000
Qfactor_NS = 7.006486
np = 19
lnL0 = -1048.353068
Iterating by ming2
Initial: fx= 1048.353068
x= 0.09803 0.06762 0.07518 0.06420 0.04775 0.02789 0.19300 0.09900 0.15308 0.06559 0.06748 0.04493 0.22934 0.03736 0.01487 0.00452 3.25866 0.81675 0.13654
1 h-m-p 0.0000 0.0009 235.3351 +++YYYCCCCC 1029.189411 7 0.0007 38 | 0/19
2 h-m-p 0.0001 0.0007 123.7511 CCCCC 1028.080514 4 0.0002 68 | 0/19
3 h-m-p 0.0002 0.0009 129.3105 +YYCCCC 1024.992021 5 0.0006 99 | 0/19
4 h-m-p 0.0002 0.0010 102.9132 CYCC 1024.644837 3 0.0001 126 | 0/19
5 h-m-p 0.0008 0.0097 20.4469 +YC 1024.283199 1 0.0019 150 | 0/19
6 h-m-p 0.0048 0.0252 7.9568 CCC 1024.231722 2 0.0018 176 | 0/19
7 h-m-p 0.0032 0.0480 4.4449 YC 1024.210537 1 0.0021 199 | 0/19
8 h-m-p 0.0057 0.1011 1.6627 CCC 1024.182820 2 0.0068 225 | 0/19
9 h-m-p 0.0023 0.0358 4.9577 +YYC 1024.048104 2 0.0079 250 | 0/19
10 h-m-p 0.0021 0.0204 18.2939 +YYCC 1023.517336 3 0.0072 277 | 0/19
11 h-m-p 0.0006 0.0029 51.2315 YCCCC 1023.226022 4 0.0014 306 | 0/19
12 h-m-p 0.0046 0.0232 10.6920 CCC 1023.194419 2 0.0011 332 | 0/19
13 h-m-p 0.0020 0.0186 5.7150 YC 1023.176767 1 0.0016 355 | 0/19
14 h-m-p 0.0033 0.0871 2.6830 YC 1023.168343 1 0.0022 378 | 0/19
15 h-m-p 0.0043 0.1592 1.4002 CC 1023.156238 1 0.0049 402 | 0/19
16 h-m-p 0.0041 0.1615 1.6712 YC 1023.103761 1 0.0088 425 | 0/19
17 h-m-p 0.0045 0.1121 3.2660 +YYC 1022.740435 2 0.0160 450 | 0/19
18 h-m-p 0.0038 0.0211 13.8048 YYC 1022.488290 2 0.0032 474 | 0/19
19 h-m-p 0.0171 0.1050 2.5799 YC 1022.480787 1 0.0022 497 | 0/19
20 h-m-p 0.0100 0.1905 0.5769 CC 1022.479970 1 0.0037 521 | 0/19
21 h-m-p 0.0053 2.6271 1.2867 ++YCCC 1022.395690 3 0.1860 569 | 0/19
22 h-m-p 1.6000 8.0000 0.0176 YC 1022.383910 1 0.9361 592 | 0/19
23 h-m-p 1.6000 8.0000 0.0071 YC 1022.382004 1 0.9919 634 | 0/19
24 h-m-p 1.6000 8.0000 0.0018 YC 1022.381879 1 0.9646 676 | 0/19
25 h-m-p 1.6000 8.0000 0.0001 Y 1022.381873 0 0.8939 717 | 0/19
26 h-m-p 1.6000 8.0000 0.0001 Y 1022.381872 0 0.7962 758 | 0/19
27 h-m-p 1.1956 8.0000 0.0000 Y 1022.381872 0 0.8416 799 | 0/19
28 h-m-p 1.6000 8.0000 0.0000 Y 1022.381872 0 0.6883 840 | 0/19
29 h-m-p 1.6000 8.0000 0.0000 Y 1022.381872 0 1.6000 881 | 0/19
30 h-m-p 1.6000 8.0000 0.0000 ----------C 1022.381872 0 0.0000 932
Out..
lnL = -1022.381872
933 lfun, 2799 eigenQcodon, 29856 P(t)
Time used: 0:13
Model 2: PositiveSelection
TREE # 1
(1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
initial w for M2:NSpselection reset.
0.098030 0.067621 0.075178 0.064199 0.047752 0.027887 0.193000 0.099000 0.153078 0.065592 0.067478 0.044930 0.229345 0.037355 0.014870 0.004515 3.365769 1.098208 0.580294 0.458835 2.948231
ntime & nrate & np: 16 3 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 1.000000 999.000000
Qfactor_NS = 2.955861
np = 21
lnL0 = -1121.903528
Iterating by ming2
Initial: fx= 1121.903528
x= 0.09803 0.06762 0.07518 0.06420 0.04775 0.02789 0.19300 0.09900 0.15308 0.06559 0.06748 0.04493 0.22934 0.03736 0.01487 0.00452 3.36577 1.09821 0.58029 0.45883 2.94823
1 h-m-p 0.0000 0.0017 199.4270 +++YYCCC 1114.845398 4 0.0009 35 | 0/21
2 h-m-p 0.0007 0.0037 151.8931 ++ 1067.369848 m 0.0037 59 | 0/21
3 h-m-p 0.0008 0.0040 67.9568 +CCC 1062.305620 2 0.0032 88 | 0/21
4 h-m-p 0.0001 0.0004 157.6659 ++ 1060.011957 m 0.0004 112 | 1/21
5 h-m-p 0.0017 0.0134 31.7966 +CYCCC 1056.661050 4 0.0081 144 | 1/21
6 h-m-p 0.0060 0.0322 43.3487 CYC 1054.287581 2 0.0063 171 | 1/21
7 h-m-p 0.0048 0.0242 33.6931 CC 1052.753184 1 0.0062 197 | 1/21
8 h-m-p 0.0037 0.0185 25.4632 YCYCCC 1051.142454 5 0.0083 229 | 1/21
9 h-m-p 0.0235 0.1174 5.7818 CCCC 1049.653180 3 0.0357 259 | 1/21
10 h-m-p 0.0064 0.0318 26.3497 YCCCC 1047.069385 4 0.0127 290 | 1/21
11 h-m-p 0.0057 0.0285 40.3511 +YYYYCCC 1037.253395 6 0.0220 323 | 0/21
12 h-m-p 0.0001 0.0005 485.0077 +YCYCCC 1036.367521 5 0.0003 356 | 0/21
13 h-m-p 0.0001 0.0005 209.1441 +YYCYCC 1035.541226 5 0.0003 388 | 0/21
14 h-m-p 0.0034 0.0246 20.6689 YCCCC 1034.687327 4 0.0064 419 | 0/21
15 h-m-p 0.0075 0.0400 17.7838 YCYC 1034.348122 3 0.0041 447 | 0/21
16 h-m-p 0.0097 0.0496 7.5793 YCCC 1034.152832 3 0.0064 476 | 0/21
17 h-m-p 0.0074 0.2213 6.5145 ++YCC 1031.828712 2 0.0755 505 | 0/21
18 h-m-p 0.0061 0.0306 59.0061 YCCC 1029.241769 3 0.0097 534 | 0/21
19 h-m-p 0.0067 0.0335 24.7336 CCYC 1028.540046 3 0.0066 563 | 0/21
20 h-m-p 0.0073 0.0367 9.2906 YYCC 1028.382435 3 0.0054 591 | 0/21
21 h-m-p 0.0287 0.1813 1.7423 YCCC 1028.157557 3 0.0505 620 | 0/21
22 h-m-p 0.0053 0.0762 16.5083 +CYCCCC 1026.386943 5 0.0342 654 | 0/21
23 h-m-p 0.3125 1.5623 1.4463 CCCCC 1025.137601 4 0.4689 686 | 0/21
24 h-m-p 0.4270 2.1348 1.0975 CCCCC 1024.135191 4 0.6536 718 | 0/21
25 h-m-p 0.6661 3.3304 1.0609 YCCC 1023.653592 3 0.4860 747 | 0/21
26 h-m-p 0.4863 2.4314 0.9826 CCCC 1023.347756 3 0.5225 777 | 0/21
27 h-m-p 0.4228 2.1142 1.1891 CCCC 1023.043374 3 0.6221 828 | 0/21
28 h-m-p 0.5503 2.7515 1.2840 YYYC 1022.843464 3 0.5221 855 | 0/21
29 h-m-p 0.8423 4.6864 0.7959 YCC 1022.735513 2 0.6009 882 | 0/21
30 h-m-p 0.5382 6.6265 0.8886 CCC 1022.679083 2 0.5544 931 | 0/21
31 h-m-p 0.4683 8.0000 1.0519 YC 1022.602630 1 0.7761 977 | 0/21
32 h-m-p 0.8417 8.0000 0.9699 CC 1022.529493 1 1.0030 1003 | 0/21
33 h-m-p 0.7767 8.0000 1.2524 YCC 1022.485623 2 0.5912 1051 | 0/21
34 h-m-p 0.6581 8.0000 1.1251 CCC 1022.440481 2 1.0194 1079 | 0/21
35 h-m-p 0.9903 8.0000 1.1582 YC 1022.420373 1 0.6792 1104 | 0/21
36 h-m-p 0.8892 8.0000 0.8847 CC 1022.408037 1 0.8694 1130 | 0/21
37 h-m-p 0.8789 8.0000 0.8752 CC 1022.401395 1 0.8342 1177 | 0/21
38 h-m-p 0.9166 8.0000 0.7965 CC 1022.396179 1 1.1453 1224 | 0/21
39 h-m-p 0.6614 8.0000 1.3792 YC 1022.388778 1 1.1519 1270 | 0/21
40 h-m-p 1.5747 8.0000 1.0089 YC 1022.386151 1 0.8937 1295 | 0/21
41 h-m-p 0.8294 8.0000 1.0870 CY 1022.384375 1 0.9202 1321 | 0/21
42 h-m-p 1.0151 8.0000 0.9854 C 1022.383575 0 1.1126 1345 | 0/21
43 h-m-p 0.8895 8.0000 1.2326 CC 1022.382762 1 1.2182 1392 | 0/21
44 h-m-p 1.3968 8.0000 1.0750 YC 1022.382396 1 0.9128 1417 | 0/21
45 h-m-p 0.9204 8.0000 1.0662 CC 1022.382157 1 1.2626 1443 | 0/21
46 h-m-p 1.4259 8.0000 0.9440 C 1022.382050 0 1.2619 1467 | 0/21
47 h-m-p 0.8643 8.0000 1.3784 C 1022.381969 0 0.9820 1512 | 0/21
48 h-m-p 1.6000 8.0000 0.7598 C 1022.381924 0 1.4893 1536 | 0/21
49 h-m-p 1.1152 8.0000 1.0146 C 1022.381908 0 1.1011 1581 | 0/21
50 h-m-p 1.6000 8.0000 0.6377 Y 1022.381894 0 1.1792 1605 | 0/21
51 h-m-p 0.7688 8.0000 0.9782 +C 1022.381883 0 3.0750 1651 | 0/21
52 h-m-p 1.6000 8.0000 0.7757 C 1022.381876 0 1.3151 1696 | 0/21
53 h-m-p 1.3524 8.0000 0.7543 Y 1022.381875 0 0.8548 1741 | 0/21
54 h-m-p 0.8061 8.0000 0.7998 +C 1022.381873 0 3.2246 1787 | 0/21
55 h-m-p 1.6000 8.0000 0.9454 C 1022.381873 0 1.7900 1832 | 0/21
56 h-m-p 1.6000 8.0000 0.6885 C 1022.381873 0 2.3558 1877 | 0/21
57 h-m-p 1.6000 8.0000 0.9432 C 1022.381873 0 2.4068 1922 | 0/21
58 h-m-p 1.6000 8.0000 1.0277 C 1022.381872 0 1.6000 1967 | 0/21
59 h-m-p 0.9990 8.0000 1.6459 ----Y 1022.381872 0 0.0007 1995 | 0/21
60 h-m-p 0.0577 8.0000 0.0198 +C 1022.381872 0 0.3504 2020 | 0/21
61 h-m-p 1.6000 8.0000 0.0001 C 1022.381872 0 0.5096 2065 | 0/21
62 h-m-p 0.6334 8.0000 0.0001 C 1022.381872 0 0.6334 2110 | 0/21
63 h-m-p 1.5964 8.0000 0.0000 C 1022.381872 0 0.3991 2155 | 0/21
64 h-m-p 0.3149 8.0000 0.0000 Y 1022.381872 0 0.0787 2200 | 0/21
65 h-m-p 0.0426 8.0000 0.0001 C 1022.381872 0 0.0426 2245 | 0/21
66 h-m-p 0.0933 8.0000 0.0000 ------------C 1022.381872 0 0.0000 2302
Out..
lnL = -1022.381872
2303 lfun, 9212 eigenQcodon, 110544 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 21 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1032.447198 S = -991.172205 -33.051127
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 86 patterns 0:39
did 20 / 86 patterns 0:39
did 30 / 86 patterns 0:39
did 40 / 86 patterns 0:39
did 50 / 86 patterns 0:39
did 60 / 86 patterns 0:40
did 70 / 86 patterns 0:40
did 80 / 86 patterns 0:40
did 86 / 86 patterns 0:40
Time used: 0:40
Model 3: discrete
TREE # 1
(1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
0.098030 0.067621 0.075178 0.064199 0.047752 0.027887 0.193000 0.099000 0.153078 0.065592 0.067478 0.044930 0.229345 0.037355 0.014870 0.004515 3.365769 0.923969 0.634343 0.029596 0.074065 0.103457
ntime & nrate & np: 16 4 22
Bounds (np=22):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 -99.000000 -99.000000 0.000001 0.000001 0.000001
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000 999.000000 999.000000 999.000000
Qfactor_NS = 11.606767
np = 22
lnL0 = -1026.183842
Iterating by ming2
Initial: fx= 1026.183842
x= 0.09803 0.06762 0.07518 0.06420 0.04775 0.02789 0.19300 0.09900 0.15308 0.06559 0.06748 0.04493 0.22934 0.03736 0.01487 0.00452 3.36577 0.92397 0.63434 0.02960 0.07407 0.10346
1 h-m-p 0.0000 0.0006 128.7283 +++ 1023.747926 m 0.0006 28 | 1/22
2 h-m-p 0.0002 0.0043 286.9767 CYCCC 1023.375000 4 0.0000 60 | 1/22
3 h-m-p 0.0001 0.0014 83.4334 +CYCCC 1021.306221 4 0.0009 94 | 1/22
4 h-m-p 0.0015 0.0077 20.4478 CCCC 1020.951607 3 0.0018 125 | 1/22
5 h-m-p 0.0014 0.0069 22.7025 YCYCCC 1020.467389 5 0.0030 158 | 1/22
6 h-m-p 0.0003 0.0015 58.0798 YCCCC 1020.186456 4 0.0007 190 | 1/22
7 h-m-p 0.0019 0.0095 14.7448 YC 1020.123578 1 0.0011 216 | 1/22
8 h-m-p 0.0046 0.0537 3.5138 CC 1020.112757 1 0.0017 243 | 1/22
9 h-m-p 0.0016 0.2374 3.6626 +YC 1020.044400 1 0.0124 270 | 1/22
10 h-m-p 0.0021 0.0659 22.0785 +YCCC 1019.860819 3 0.0057 301 | 1/22
11 h-m-p 0.0028 0.0561 45.4161 YCCC 1019.481782 3 0.0055 331 | 1/22
12 h-m-p 0.0021 0.0104 99.9173 YYCC 1019.189649 3 0.0019 360 | 1/22
13 h-m-p 0.0053 0.0264 27.9858 CC 1019.116509 1 0.0018 387 | 1/22
14 h-m-p 0.0079 0.0611 6.3521 C 1019.099666 0 0.0020 412 | 1/22
15 h-m-p 0.0108 0.1878 1.1762 YC 1019.090418 1 0.0062 438 | 1/22
16 h-m-p 0.0016 0.0965 4.5279 +CCC 1019.046516 2 0.0068 468 | 1/22
17 h-m-p 0.0019 0.0333 16.5830 +CYC 1018.876459 2 0.0069 497 | 1/22
18 h-m-p 0.0020 0.0100 32.4767 CCCC 1018.726638 3 0.0030 528 | 1/22
19 h-m-p 0.0051 0.0253 6.3811 CC 1018.713075 1 0.0016 555 | 1/22
20 h-m-p 0.0677 1.6682 0.1542 +YCCC 1018.587106 3 0.1749 586 | 1/22
21 h-m-p 0.0040 0.0336 6.6634 CCCC 1018.344840 3 0.0067 638 | 1/22
22 h-m-p 0.3110 8.0000 0.1426 +CC 1018.269002 1 1.3280 666 | 1/22
23 h-m-p 0.8103 8.0000 0.2337 YCC 1018.189576 2 1.5745 715 | 1/22
24 h-m-p 1.3570 8.0000 0.2712 CCC 1018.151072 2 1.1093 765 | 1/22
25 h-m-p 1.4559 8.0000 0.2066 YC 1018.133676 1 1.1178 812 | 1/22
26 h-m-p 1.1585 8.0000 0.1994 YC 1018.109831 1 2.2690 859 | 1/22
27 h-m-p 1.4652 8.0000 0.3087 YC 1018.091487 1 1.1069 906 | 1/22
28 h-m-p 0.8538 8.0000 0.4002 YCC 1018.061653 2 1.7777 955 | 1/22
29 h-m-p 1.6000 8.0000 0.3885 CY 1018.046491 1 1.5126 1003 | 1/22
30 h-m-p 1.6000 8.0000 0.1689 CC 1018.043103 1 1.2946 1051 | 1/22
31 h-m-p 1.5236 8.0000 0.1435 CC 1018.040972 1 2.3561 1099 | 1/22
32 h-m-p 1.6000 8.0000 0.1734 CC 1018.039276 1 2.2102 1147 | 1/22
33 h-m-p 1.3465 8.0000 0.2847 CC 1018.037979 1 2.0321 1195 | 1/22
34 h-m-p 1.6000 8.0000 0.2677 YC 1018.037387 1 1.1242 1242 | 1/22
35 h-m-p 1.0305 8.0000 0.2920 YC 1018.037072 1 1.9550 1289 | 1/22
36 h-m-p 1.6000 8.0000 0.2330 C 1018.036936 0 2.0062 1335 | 1/22
37 h-m-p 1.6000 8.0000 0.2295 C 1018.036879 0 1.5844 1381 | 1/22
38 h-m-p 1.6000 8.0000 0.1798 C 1018.036857 0 2.4605 1427 | 1/22
39 h-m-p 1.6000 8.0000 0.1639 C 1018.036849 0 1.5661 1473 | 1/22
40 h-m-p 1.6000 8.0000 0.1204 C 1018.036846 0 2.4701 1519 | 1/22
41 h-m-p 1.6000 8.0000 0.0750 C 1018.036846 0 1.4334 1565 | 1/22
42 h-m-p 1.6000 8.0000 0.0442 C 1018.036846 0 1.8240 1611 | 1/22
43 h-m-p 1.6000 8.0000 0.0087 Y 1018.036846 0 1.0472 1657 | 1/22
44 h-m-p 1.6000 8.0000 0.0021 Y 1018.036846 0 1.6000 1703 | 1/22
45 h-m-p 1.6000 8.0000 0.0007 C 1018.036846 0 1.6000 1749 | 1/22
46 h-m-p 1.6000 8.0000 0.0001 C 1018.036846 0 0.4154 1795 | 1/22
47 h-m-p 0.0214 8.0000 0.0025 ---C 1018.036846 0 0.0001 1844 | 1/22
48 h-m-p 0.0160 8.0000 0.0000 ------Y 1018.036846 0 0.0000 1896 | 1/22
49 h-m-p 0.0160 8.0000 0.0000 -------------.. | 1/22
50 h-m-p 0.0160 8.0000 0.0001 ------------- | 1/22
51 h-m-p 0.0160 8.0000 0.0001 -------------
Out..
lnL = -1018.036846
2068 lfun, 8272 eigenQcodon, 99264 P(t)
Time used: 1:03
Model 7: beta
TREE # 1
(1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
0.098030 0.067621 0.075178 0.064199 0.047752 0.027887 0.193000 0.099000 0.153078 0.065592 0.067478 0.044930 0.229345 0.037355 0.014870 0.004515 3.308444 1.091300 1.180709
ntime & nrate & np: 16 1 19
Bounds (np=19):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.005000 0.005000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 99.000000 99.000000
Qfactor_NS = 5.248223
np = 19
lnL0 = -1076.737301
Iterating by ming2
Initial: fx= 1076.737301
x= 0.09803 0.06762 0.07518 0.06420 0.04775 0.02789 0.19300 0.09900 0.15308 0.06559 0.06748 0.04493 0.22934 0.03736 0.01487 0.00452 3.30844 1.09130 1.18071
1 h-m-p 0.0000 0.0008 157.7799 ++YCCCC 1074.403316 4 0.0003 52 | 0/19
2 h-m-p 0.0003 0.0015 111.7285 +CYYC 1069.409976 3 0.0012 98 | 0/19
3 h-m-p 0.0001 0.0007 97.0019 +YYCYC 1067.584366 4 0.0005 145 | 0/19
4 h-m-p 0.0001 0.0010 340.6208 ++ 1055.240021 m 0.0010 186 | 0/19
5 h-m-p 0.0002 0.0009 957.2946 +YYCYCCC 1034.069202 6 0.0006 237 | 0/19
6 h-m-p 0.0001 0.0004 485.9165 YCCC 1032.186129 3 0.0002 283 | 0/19
7 h-m-p 0.0007 0.0036 48.5926 CYC 1031.715986 2 0.0007 327 | 0/19
8 h-m-p 0.0010 0.0058 33.9691 YCCCC 1030.955595 4 0.0020 375 | 0/19
9 h-m-p 0.0011 0.0090 62.3994 +YYCC 1029.068745 3 0.0034 421 | 0/19
10 h-m-p 0.0005 0.0026 198.3957 YCCC 1027.292327 3 0.0011 467 | 0/19
11 h-m-p 0.0031 0.0218 69.5126 YCCC 1024.454657 3 0.0059 513 | 0/19
12 h-m-p 0.0032 0.0160 48.1135 YCCC 1023.809263 3 0.0021 559 | 0/19
13 h-m-p 0.0042 0.0210 11.8979 YCC 1023.680622 2 0.0026 603 | 0/19
14 h-m-p 0.0077 0.0450 3.9473 CC 1023.651961 1 0.0025 646 | 0/19
15 h-m-p 0.0067 0.1505 1.4819 +CCC 1023.424005 2 0.0240 692 | 0/19
16 h-m-p 0.0058 0.0341 6.0994 +YYCCC 1021.647379 4 0.0197 740 | 0/19
17 h-m-p 0.0040 0.0199 9.0398 YCC 1021.537183 2 0.0024 784 | 0/19
18 h-m-p 0.0061 0.1296 3.5101 C 1021.459265 0 0.0061 825 | 0/19
19 h-m-p 0.0077 0.1371 2.7784 YCCC 1021.119117 3 0.0174 871 | 0/19
20 h-m-p 0.0087 0.0509 5.5864 CCCC 1020.278561 3 0.0126 918 | 0/19
21 h-m-p 0.4220 2.1098 0.1427 CYCCC 1018.742330 4 0.6892 966 | 0/19
22 h-m-p 0.5203 6.5440 0.1890 CCC 1018.601102 2 0.8004 1011 | 0/19
23 h-m-p 1.6000 8.0000 0.0827 YCC 1018.566453 2 1.0115 1055 | 0/19
24 h-m-p 1.6000 8.0000 0.0461 YC 1018.557739 1 0.8544 1097 | 0/19
25 h-m-p 1.6000 8.0000 0.0117 YC 1018.555868 1 1.2086 1139 | 0/19
26 h-m-p 1.2100 8.0000 0.0117 YC 1018.555370 1 0.8337 1181 | 0/19
27 h-m-p 0.9325 8.0000 0.0105 YC 1018.554604 1 2.1310 1223 | 0/19
28 h-m-p 1.4892 8.0000 0.0150 YC 1018.553188 1 3.0701 1265 | 0/19
29 h-m-p 1.5014 8.0000 0.0307 CC 1018.551031 1 2.3862 1308 | 0/19
30 h-m-p 1.6000 8.0000 0.0266 C 1018.549732 0 1.6117 1349 | 0/19
31 h-m-p 1.6000 8.0000 0.0053 YC 1018.549483 1 1.0702 1391 | 0/19
32 h-m-p 1.6000 8.0000 0.0007 C 1018.549427 0 1.5650 1432 | 0/19
33 h-m-p 1.6000 8.0000 0.0004 Y 1018.549421 0 1.1273 1473 | 0/19
34 h-m-p 1.6000 8.0000 0.0001 Y 1018.549421 0 1.0443 1514 | 0/19
35 h-m-p 1.6000 8.0000 0.0000 C 1018.549421 0 1.4310 1555 | 0/19
36 h-m-p 1.6000 8.0000 0.0000 Y 1018.549421 0 0.9547 1596 | 0/19
37 h-m-p 1.6000 8.0000 0.0000 Y 1018.549421 0 0.9358 1637 | 0/19
38 h-m-p 1.6000 8.0000 0.0000 C 1018.549421 0 1.6000 1678 | 0/19
39 h-m-p 1.6000 8.0000 0.0000 C 1018.549421 0 1.4789 1719 | 0/19
40 h-m-p 1.6000 8.0000 0.0000 ----Y 1018.549421 0 0.0016 1764
Out..
lnL = -1018.549421
1765 lfun, 19415 eigenQcodon, 282400 P(t)
Time used: 2:09
Model 8: beta&w>1
TREE # 1
(1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
initial w for M8:NSbetaw>1 reset.
0.098030 0.067621 0.075178 0.064199 0.047752 0.027887 0.193000 0.099000 0.153078 0.065592 0.067478 0.044930 0.229345 0.037355 0.014870 0.004515 3.302867 0.900000 0.318342 1.765725 2.851152
ntime & nrate & np: 16 2 21
Bounds (np=21):
0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000004 0.000100 0.000010 0.005000 0.005000 1.000000
50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 50.000000 999.000000 0.999990 99.000000 99.000000 999.000000
Qfactor_NS = 5.708665
np = 21
lnL0 = -1054.049176
Iterating by ming2
Initial: fx= 1054.049176
x= 0.09803 0.06762 0.07518 0.06420 0.04775 0.02789 0.19300 0.09900 0.15308 0.06559 0.06748 0.04493 0.22934 0.03736 0.01487 0.00452 3.30287 0.90000 0.31834 1.76572 2.85115
1 h-m-p 0.0000 0.0004 333.9201 +++ 1026.863336 m 0.0004 48 | 1/21
2 h-m-p 0.0001 0.0006 91.9160 +YYYYCC 1024.660276 5 0.0004 100 | 1/21
3 h-m-p 0.0000 0.0002 460.4211 +YYYYC 1021.995651 4 0.0001 149 | 1/21
4 h-m-p 0.0009 0.0043 64.0750 CYCCC 1020.130395 4 0.0013 200 | 1/21
5 h-m-p 0.0041 0.0206 16.0023 CYC 1020.002103 2 0.0012 247 | 1/21
6 h-m-p 0.0037 0.0550 4.9450 YC 1019.976654 1 0.0022 292 | 0/21
7 h-m-p 0.0015 0.0264 7.5721 YC 1019.971473 1 0.0002 337 | 0/21
8 h-m-p 0.0002 0.0048 6.7874 ++YC 1019.944827 1 0.0026 385 | 0/21
9 h-m-p 0.0010 0.0048 4.9980 ++ 1019.896075 m 0.0048 430 | 1/21
10 h-m-p 0.0006 0.0288 39.4838 ++YYC 1019.486550 2 0.0082 479 | 1/21
11 h-m-p 0.0011 0.0053 161.9113 YCCCC 1019.033047 4 0.0022 530 | 1/21
12 h-m-p 0.0018 0.0092 59.5449 CCC 1018.903212 2 0.0018 578 | 1/21
13 h-m-p 0.0088 0.0562 12.2771 CYC 1018.875541 2 0.0021 625 | 1/21
14 h-m-p 0.0113 0.1100 2.3209 YC 1018.871710 1 0.0021 670 | 1/21
15 h-m-p 0.0018 0.1917 2.5994 +CC 1018.859287 1 0.0064 717 | 1/21
16 h-m-p 0.0012 0.1127 13.4221 +CC 1018.792734 1 0.0067 764 | 1/21
17 h-m-p 0.0032 0.0478 28.5287 YC 1018.664936 1 0.0061 809 | 1/21
18 h-m-p 0.0094 0.0470 12.7917 CC 1018.646789 1 0.0020 855 | 1/21
19 h-m-p 0.0163 0.1276 1.5901 -YC 1018.645421 1 0.0018 901 | 1/21
20 h-m-p 0.0085 3.2330 0.3345 ++YC 1018.630338 1 0.1145 948 | 1/21
21 h-m-p 0.0018 0.1466 21.7107 +CYC 1018.570014 2 0.0070 996 | 1/21
22 h-m-p 1.4173 8.0000 0.1067 YC 1018.559258 1 0.7650 1041 | 1/21
23 h-m-p 1.5541 8.0000 0.0525 C 1018.552627 0 1.5541 1085 | 1/21
24 h-m-p 1.6000 8.0000 0.0291 CC 1018.551104 1 1.4383 1131 | 1/21
25 h-m-p 1.4657 8.0000 0.0286 C 1018.550458 0 1.3831 1175 | 1/21
26 h-m-p 1.6000 8.0000 0.0114 YC 1018.550218 1 0.9769 1220 | 1/21
27 h-m-p 1.6000 8.0000 0.0009 Y 1018.550211 0 0.8709 1264 | 1/21
28 h-m-p 1.6000 8.0000 0.0003 Y 1018.550211 0 1.0636 1308 | 1/21
29 h-m-p 1.6000 8.0000 0.0001 C 1018.550211 0 2.1128 1352 | 1/21
30 h-m-p 1.3313 8.0000 0.0001 ++ 1018.550210 m 8.0000 1396 | 1/21
31 h-m-p 0.3955 8.0000 0.0028 +++ 1018.550207 m 8.0000 1441 | 1/21
32 h-m-p 1.1294 8.0000 0.0201 ++ 1018.550156 m 8.0000 1485 | 1/21
33 h-m-p 0.1659 8.0000 0.9713 -------------Y 1018.550156 0 0.0000 1542 | 1/21
34 h-m-p 0.0019 0.9741 0.8091 +++++ 1018.549877 m 0.9741 1589 | 2/21
35 h-m-p 0.9575 8.0000 0.0273 C 1018.549723 0 0.9992 1633 | 2/21
36 h-m-p 1.6000 8.0000 0.0002 Y 1018.549722 0 0.7980 1676 | 2/21
37 h-m-p 1.6000 8.0000 0.0001 Y 1018.549722 0 0.9804 1719 | 2/21
38 h-m-p 1.6000 8.0000 0.0000 ----------------.. | 2/21
39 h-m-p 0.0160 8.0000 0.0002 -C 1018.549722 0 0.0010 1820 | 2/21
40 h-m-p 0.0160 8.0000 0.0004 ------C 1018.549722 0 0.0000 1869
Out..
lnL = -1018.549722
1870 lfun, 22440 eigenQcodon, 329120 P(t)
BEBing (dim = 4). This may take several minutes.
Calculating f(x_h|w): 10 categories 20 w sets.
Calculating f(X), the marginal probability of data.
log(fX) = -1032.743727 S = -991.793658 -33.730247
Calculating f(w|X), posterior probabilities of site classes.
did 10 / 86 patterns 3:27
did 20 / 86 patterns 3:27
did 30 / 86 patterns 3:27
did 40 / 86 patterns 3:27
did 50 / 86 patterns 3:27
did 60 / 86 patterns 3:28
did 70 / 86 patterns 3:28
did 80 / 86 patterns 3:28
did 86 / 86 patterns 3:28
Time used: 3:28
CodeML output code: -1
CLUSTAL FORMAT for T-COFFEE Version_10.00.r1613 [http://www.tcoffee.org] [MODE: ], CPU=0.00 sec, SCORE=100, Nseq=11, Len=107
D_melanogaster_Acp65Aa-PA MMKLMLVVGSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
D_sechellia_Acp65Aa-PA MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
D_simulans_Acp65Aa-PA MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
D_yakuba_Acp65Aa-PA MMKLMLVVSSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
D_erecta_Acp65Aa-PA MMKLMLVVSSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
D_takahashii_Acp65Aa-PA MMKLMLVVGSMALILALASARPQNDAVEVLEYESENTGLGGYKFSYKLSD
D_biarmipes_Acp65Aa-PA MMKLMLVVGSMALLLALASARPQND-VEILESESENIGIGGYKFSYKLSD
D_suzukii_Acp65Aa-PA MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGLGGYKFSYKLSD
D_eugracilis_Acp65Aa-PA MMKLMLVVGSMALLFALASARPQND-VEVLEYESENTGLGGYKFSYKLSD
D_rhopaloa_Acp65Aa-PA MMKLMLVVGSMALLLALASARPQND-VEVLEYDSENIGIGGYKFSYKLSD
D_elegans_Acp65Aa-PA MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGIGGYKFSYKLSD
********.*:*:::********** **:** :*** *:***********
D_melanogaster_Acp65Aa-PA GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
D_sechellia_Acp65Aa-PA GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
D_simulans_Acp65Aa-PA GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
D_yakuba_Acp65Aa-PA GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
D_erecta_Acp65Aa-PA GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE
D_takahashii_Acp65Aa-PA GTSRTEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPQ
D_biarmipes_Acp65Aa-PA GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYSINFVADENGFQPE
D_suzukii_Acp65Aa-PA GTTRSEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
D_eugracilis_Acp65Aa-PA GTSRTEEGVVNNAGTDNESISIRGSVSWVAPDGQTYTINFVADENGFQPE
D_rhopaloa_Acp65Aa-PA GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
D_elegans_Acp65Aa-PA GTSRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE
**:*:***.******:**********:*********:************:
D_melanogaster_Acp65Aa-PA GAHLPKo
D_sechellia_Acp65Aa-PA GAHLPKo
D_simulans_Acp65Aa-PA GAHLPKo
D_yakuba_Acp65Aa-PA GAHLPKo
D_erecta_Acp65Aa-PA GAHLPKo
D_takahashii_Acp65Aa-PA GDHLPK-
D_biarmipes_Acp65Aa-PA GAHLPKo
D_suzukii_Acp65Aa-PA GAHLPKo
D_eugracilis_Acp65Aa-PA GAHLPKo
D_rhopaloa_Acp65Aa-PA GAHLPKo
D_elegans_Acp65Aa-PA GAHLPKo
* ****
>D_melanogaster_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATAGCCCTTCTCCTGGCCCT GGCCAGTGCCCGGCCGCAAAATGAT---GTGGAAGTTCTTGAGTACGAAT CGGAGAACACCGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT GGCACCAGTCGAACAGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA CGAATCCATATCCATTCGGGGATCCGTCACCTGGGTGGCTCCCGATGGCC AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG GGTGCCCATCTGCCCAAG--- >D_sechellia_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCGTGCTCCTGGCGCT GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAATGCGGGCACCGACAA CGAATCCATATCCATTCGGGGGTCCGTCACCTGGGTGGCTCCCGATGGCC AAACTTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG GGCGCCCATCTGCCCAAG--- >D_simulans_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCGTGCTCCTGGCGCT GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAACTGAGCGAT GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAATGCGGGCACCGATAA CGAATCCATATCCATTCGGGGATCCGTCACCTGGGTGGCTCCCGATGGCC AAACTTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG GGCGCCCATCTGCCCAAG--- >D_yakuba_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTAGCTCGATGGCCGTGCTCCTGGCCCT GGCCAGTGCCCGTCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT CGGAGAACACTGGCCTCGGCGGCTACAAGTTCAGCTACAAATTAAGCGAT GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA CGAATCCATATCCATCCGCGGATCCGTCACCTGGGTGGCTCCCGATGGTC AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG GGCGCCCATCTGCCCAAG--- >D_erecta_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTAGCTCGATAGCCCTGCTCCTGGCGCT GGCCAGTGCCCGGCCCCAAAATGAT---GTGGAAGTTCTGGAGTACGAAT CGGAGAACACTGGCCTCGGTGGCTACAAGTTCAGCTACAAATTAAGCGAT GGCACCAGTCGCACCGAGGAGGGCGTGGTCAACAACGCGGGCACCGACAA CGAATCTATATCCATCCGGGGATCTGTCACCTGGGTGGCTCCCGATGGCC AAACCTACACCATTAACTTTGTGGCCGACGAGAACGGTTTTCAGCCGGAG GGCGCCCATCTGCCAAAG--- >D_takahashii_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGATCCTGGCGCT GGCCAGTGCCCGGCCCCAAAACGATGCTGTCGAGGTTCTGGAATACGAAT CGGAGAACACCGGCCTAGGCGGCTACAAGTTCAGCTATAAACTAAGCGAT GGCACTTCCCGCACGGAGGAGGGCACAGTGAACAATGCGGGCACCGAAAA CGAATCGATATCCATTCGAGGATCCGTCAGTTGGGTGGCTCCCGACGGAC AGACCTACACCATTAACTTCGTGGCCGACGAGAACGGTTTCCAGCCGCAG GGCGACCATCTGCCCAAG--- >D_biarmipes_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAAATTCTGGAGTCCGAGT CCGAAAACATCGGCATCGGTGGCTACAAGTTCAGCTACAAACTGAGCGAT GGCACCACCCGCACGGAGGAGGGCGTGGTCAACAACGCGGGCACCGAAAA TGAATCGATATCCATCCGGGGATCCGTCAGTTGGGTGGCTCCCGACGGCC AGACCTACTCCATTAACTTTGTGGCCGACGAGAATGGCTTCCAGCCGGAG GGCGCCCACCTGCCCAAG--- >D_suzukii_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTCCTGGAGTACGAAT CGGAGAACATCGGCCTCGGTGGCTACAAGTTCAGCTATAAATTGAGCGAC GGCACCACCCGCTCGGAGGAGGGCACGGTTAACAACGCGGGCACCGAAAA CGAATCGATATCCATCCGGGGATCCGTCAGTTGGGTGGCTCCCGATGGCC AGACCTACACCATTAACTTTGTGGCCGACGAGAATGGTTTCCAGCCAGAG GGCGCCCACCTGCCCAAG--- >D_eugracilis_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTACTCTTCGCACT GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAAGTTCTGGAGTACGAAT CGGAGAACACTGGCCTTGGCGGCTATAAGTTCAGCTATAAATTAAGCGAT GGCACTAGCCGTACAGAGGAGGGCGTGGTCAACAACGCTGGCACCGATAA CGAATCGATATCCATCCGTGGATCCGTCAGTTGGGTGGCACCCGATGGCC AAACATATACCATTAACTTTGTGGCCGACGAGAACGGTTTCCAGCCAGAG GGCGCACATCTGCCCAAG--- >D_rhopaloa_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTATTGGAGTACGACT CGGAGAACATTGGCATCGGCGGCTACAAGTTCAGCTATAAACTGAGTGAC GGCACCACTCGCACGGAGGAGGGCGTGGTTAACAACGCGGGCACCGAGAA CGAATCGATATCCATCCGAGGCTCCGTCAGCTGGGTGGCTCCCGATGGCC AGACCTACACCATCAACTTTGTGGCCGACGAGAACGGTTTCCAGCCGGAG GGTGCCCATCTGCCCAAG--- >D_elegans_Acp65Aa-PA ATGATGAAATTGATGCTAGTCGTTGGCTCGATGGCCCTGCTCCTGGCGCT GGCCAGTGCCCGGCCCCAAAACGAT---GTGGAGGTGCTGGAGTACGAGT CGGAGAACATTGGCATCGGAGGCTACAAGTTCAGCTACAAACTGAGTGAC GGCACCAGTCGCACGGAGGAGGGCGTGGTCAACAACGCAGGCACCGAGAA CGAATCGATATCCATCCGAGGATCCGTCAGCTGGGTGGCTCCCGATGGCC AGACCTACACCATTAACTTTGTGGCCGACGAGAACGGCTTCCAGCCGGAG GGTGCCCATCTGCCCAAG---
>D_melanogaster_Acp65Aa-PA MMKLMLVVGSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE GAHLPK >D_sechellia_Acp65Aa-PA MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE GAHLPK >D_simulans_Acp65Aa-PA MMKLMLVVGSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE GAHLPK >D_yakuba_Acp65Aa-PA MMKLMLVVSSMAVLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE GAHLPK >D_erecta_Acp65Aa-PA MMKLMLVVSSIALLLALASARPQND-VEVLEYESENTGLGGYKFSYKLSD GTSRTEEGVVNNAGTDNESISIRGSVTWVAPDGQTYTINFVADENGFQPE GAHLPK >D_takahashii_Acp65Aa-PA MMKLMLVVGSMALILALASARPQNDAVEVLEYESENTGLGGYKFSYKLSD GTSRTEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPQ GDHLPK >D_biarmipes_Acp65Aa-PA MMKLMLVVGSMALLLALASARPQND-VEILESESENIGIGGYKFSYKLSD GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYSINFVADENGFQPE GAHLPK >D_suzukii_Acp65Aa-PA MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGLGGYKFSYKLSD GTTRSEEGTVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE GAHLPK >D_eugracilis_Acp65Aa-PA MMKLMLVVGSMALLFALASARPQND-VEVLEYESENTGLGGYKFSYKLSD GTSRTEEGVVNNAGTDNESISIRGSVSWVAPDGQTYTINFVADENGFQPE GAHLPK >D_rhopaloa_Acp65Aa-PA MMKLMLVVGSMALLLALASARPQND-VEVLEYDSENIGIGGYKFSYKLSD GTTRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE GAHLPK >D_elegans_Acp65Aa-PA MMKLMLVVGSMALLLALASARPQND-VEVLEYESENIGIGGYKFSYKLSD GTSRTEEGVVNNAGTENESISIRGSVSWVAPDGQTYTINFVADENGFQPE GAHLPK
#NEXUS
[ID: 4862698291]
begin taxa;
dimensions ntax=11;
taxlabels
D_melanogaster_Acp65Aa-PA
D_sechellia_Acp65Aa-PA
D_simulans_Acp65Aa-PA
D_yakuba_Acp65Aa-PA
D_erecta_Acp65Aa-PA
D_takahashii_Acp65Aa-PA
D_biarmipes_Acp65Aa-PA
D_suzukii_Acp65Aa-PA
D_eugracilis_Acp65Aa-PA
D_rhopaloa_Acp65Aa-PA
D_elegans_Acp65Aa-PA
;
end;
begin trees;
translate
1 D_melanogaster_Acp65Aa-PA,
2 D_sechellia_Acp65Aa-PA,
3 D_simulans_Acp65Aa-PA,
4 D_yakuba_Acp65Aa-PA,
5 D_erecta_Acp65Aa-PA,
6 D_takahashii_Acp65Aa-PA,
7 D_biarmipes_Acp65Aa-PA,
8 D_suzukii_Acp65Aa-PA,
9 D_eugracilis_Acp65Aa-PA,
10 D_rhopaloa_Acp65Aa-PA,
11 D_elegans_Acp65Aa-PA
;
[Note: This tree contains information on the topology,
branch lengths (if present), and the probability
of the partition indicated by the branch.]
tree con_50_majrule = (1:0.07054453,4:0.0385121,5:0.04510855,(((6:0.1815088,8:0.04927397)0.539:0.03309372,7:0.107092,(10:0.04434826,11:0.04186903)0.987:0.0686839)0.872:0.0518639,9:0.1713143)0.964:0.05865161,(2:0.009806419,3:0.007787918)0.887:0.02153114);
[Note: This tree contains information only on the topology
and branch lengths (median of the posterior probability density).]
tree con_50_majrule = (1:0.07054453,4:0.0385121,5:0.04510855,(((6:0.1815088,8:0.04927397):0.03309372,7:0.107092,(10:0.04434826,11:0.04186903):0.0686839):0.0518639,9:0.1713143):0.05865161,(2:0.009806419,3:0.007787918):0.02153114);
end;
Estimated marginal likelihoods for runs sampled in files
"/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
(Use the harmonic mean for Bayes factor comparisons of models)
(Values are saved to the file /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.lstat)
Run Arithmetic mean Harmonic mean
--------------------------------------
1 -1057.86 -1073.03
2 -1057.71 -1072.87
--------------------------------------
TOTAL -1057.78 -1072.95
--------------------------------------
Model parameter summaries over the runs sampled in files
"/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run1.p" and "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.run2.p":
Summaries are based on a total of 3002 samples from 2 runs.
Each run produced 2001 samples of which 1501 samples were included.
Parameter summaries saved to file "/opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/mrbayes/input.fasta.fasta.mrb.pstat".
95% HPD Interval
--------------------
Parameter Mean Variance Lower Upper Median min ESS* avg ESS PSRF+
------------------------------------------------------------------------------------------------------
TL{all} 1.134575 0.036748 0.778742 1.515409 1.117591 1343.68 1363.32 1.000
r(A<->C){all} 0.081645 0.000928 0.025294 0.139950 0.077888 665.25 718.81 1.000
r(A<->G){all} 0.191549 0.002997 0.096250 0.301956 0.188149 776.33 793.34 1.000
r(A<->T){all} 0.073866 0.001583 0.002931 0.149883 0.067723 645.00 653.76 1.001
r(C<->G){all} 0.049810 0.000358 0.016507 0.086660 0.047638 921.00 992.98 1.000
r(C<->T){all} 0.566748 0.006083 0.420874 0.720081 0.566933 686.52 813.62 1.002
r(G<->T){all} 0.036383 0.000430 0.003987 0.078604 0.032885 811.75 972.83 1.000
pi(A){all} 0.225153 0.000556 0.179157 0.271622 0.224436 1030.33 1080.56 1.000
pi(C){all} 0.306555 0.000578 0.258590 0.350077 0.305942 1180.87 1188.32 1.000
pi(G){all} 0.284778 0.000630 0.231761 0.329885 0.284209 1095.09 1143.90 1.001
pi(T){all} 0.183514 0.000392 0.146280 0.224131 0.182361 1023.28 1046.15 1.000
alpha{1,2} 0.139686 0.001483 0.072609 0.228715 0.136936 1129.43 1145.04 1.000
alpha{3} 1.849847 0.555182 0.638544 3.311391 1.732669 1238.27 1369.64 1.000
pinvar{all} 0.384036 0.008597 0.184943 0.544266 0.396876 884.55 956.89 1.000
------------------------------------------------------------------------------------------------------
* Convergence diagnostic (ESS = Estimated Sample Size); min and avg values
correspond to minimal and average ESS among runs.
ESS value below 100 may indicate that the parameter is undersampled.
+ Convergence diagnostic (PSRF = Potential Scale Reduction Factor; Gelman
and Rubin, 1992) should approach 1.0 as runs converge.
Setting sumt conformat to Simple
CODONML (in paml version 4.8, March 2014) /opt/ADOPS/3/Acp65Aa-PA/batch/allfiles/codeml/input.fasta.fasta.pnxs
Model: One dN/dS ratio for branches,
Codon frequency model: F3x4
Site-class models:
ns = 11 ls = 105
Codon usage in sequences
--------------------------------------------------------------------------------------------------------------------------------------
Phe TTT 2 2 2 2 2 0 | Ser TCT 0 0 0 0 2 0 | Tyr TAT 0 0 0 0 0 1 | Cys TGT 0 0 0 0 0 0
TTC 1 1 1 1 1 3 | TCC 3 3 3 3 1 3 | TAC 4 4 4 4 4 3 | TGC 0 0 0 0 0 0
Leu TTA 0 0 0 1 1 0 | TCA 0 0 0 0 0 0 | *** TAA 0 0 0 0 0 0 | *** TGA 0 0 0 0 0 0
TTG 1 1 1 1 1 1 | TCG 2 2 2 2 2 3 | TAG 0 0 0 0 0 0 | Trp TGG 1 1 1 1 1 1
--------------------------------------------------------------------------------------------------------------------------------------
Leu CTT 2 0 0 0 0 0 | Pro CCT 0 0 0 0 0 0 | His CAT 1 1 1 1 1 1 | Arg CGT 0 0 0 1 0 0
CTC 2 2 2 2 2 0 | CCC 2 3 3 3 2 3 | CAC 0 0 0 0 0 0 | CGC 0 1 1 2 1 1
CTA 1 1 1 1 1 3 | CCA 0 0 0 0 1 0 | Gln CAA 2 2 2 2 2 1 | CGA 1 0 0 0 0 1
CTG 4 5 5 4 5 5 | CCG 2 1 1 1 1 1 | CAG 1 1 1 1 1 3 | CGG 2 2 2 0 2 1
--------------------------------------------------------------------------------------------------------------------------------------
Ile ATT 2 2 2 1 1 2 | Thr ACT 0 2 2 1 1 1 | Asn AAT 1 2 2 1 1 1 | Ser AGT 2 2 2 2 2 2
ATC 0 0 0 1 1 1 | ACC 6 4 4 5 6 4 | AAC 6 5 5 6 6 6 | AGC 2 2 2 3 3 2
ATA 2 1 1 1 2 1 | ACA 1 0 0 0 0 1 | Lys AAA 2 2 2 2 2 2 | Arg AGA 0 0 0 0 0 0
Met ATG 3 4 4 4 3 4 | ACG 0 1 1 1 0 1 | AAG 2 2 2 2 2 2 | AGG 0 0 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
Val GTT 2 2 2 2 2 2 | Ala GCT 1 1 1 1 1 1 | Asp GAT 3 3 4 3 3 2 | Gly GGT 2 1 1 2 2 1
GTC 3 3 3 3 3 3 | GCC 6 5 5 6 5 4 | GAC 2 2 1 2 2 3 | GGC 8 9 9 7 7 8
GTA 0 0 0 0 0 0 | GCA 0 0 0 0 0 0 | Glu GAA 3 3 3 3 3 4 | GGA 1 0 1 1 1 2
GTG 4 5 5 5 4 3 | GCG 1 2 2 1 2 2 | GAG 6 6 6 6 6 5 | GGG 0 1 0 0 0 0
--------------------------------------------------------------------------------------------------------------------------------------
----------------------------------------------------------------------------------------------------------------------
Phe TTT 1 1 1 1 1 | Ser TCT 0 0 0 0 0 | Tyr TAT 0 1 3 1 0 | Cys TGT 0 0 0 0 0
TTC 2 2 3 2 2 | TCC 5 2 2 2 2 | TAC 3 3 1 3 4 | TGC 0 0 0 0 0
Leu TTA 0 0 1 0 0 | TCA 0 0 0 0 0 | *** TAA 0 0 0 0 0 | *** TGA 0 0 0 0 0
TTG 1 2 1 2 1 | TCG 2 4 3 3 3 | TAG 0 0 0 0 0 | Trp TGG 1 1 1 1 1
----------------------------------------------------------------------------------------------------------------------
Leu CTT 0 0 1 0 0 | Pro CCT 0 0 0 0 0 | His CAT 0 0 1 1 1 | Arg CGT 0 0 2 0 0
CTC 1 2 1 1 1 | CCC 3 3 3 3 3 | CAC 1 1 0 0 0 | CGC 1 1 0 1 1
CTA 1 1 2 1 1 | CCA 0 1 1 0 0 | Gln CAA 1 1 2 1 1 | CGA 0 0 0 1 1
CTG 6 5 3 5 6 | CCG 1 0 0 1 1 | CAG 2 2 1 2 2 | CGG 2 2 1 1 1
----------------------------------------------------------------------------------------------------------------------
Ile ATT 2 1 1 1 2 | Thr ACT 0 0 2 1 0 | Asn AAT 2 1 0 0 0 | Ser AGT 2 2 2 2 3
ATC 3 2 1 3 2 | ACC 4 5 2 4 4 | AAC 5 6 7 7 7 | AGC 2 2 3 2 2
ATA 1 1 1 1 1 | ACA 0 0 2 0 0 | Lys AAA 2 2 2 2 2 | Arg AGA 0 0 0 0 0
Met ATG 4 4 4 4 4 | ACG 1 1 0 1 1 | AAG 2 2 2 2 2 | AGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Val GTT 1 2 2 2 1 | Ala GCT 1 1 1 1 1 | Asp GAT 2 2 4 2 2 | Gly GGT 1 2 1 2 1
GTC 3 3 3 2 3 | GCC 5 5 4 5 5 | GAC 2 2 1 3 2 | GGC 9 8 9 9 8
GTA 0 0 0 1 0 | GCA 0 0 3 0 1 | Glu GAA 4 3 3 1 1 | GGA 1 1 1 0 2
GTG 4 3 4 4 5 | GCG 2 2 0 2 1 | GAG 6 7 6 8 9 | GGG 0 0 0 0 0
----------------------------------------------------------------------------------------------------------------------
Codon position x base (3x4) table for each sequence.
#1: D_melanogaster_Acp65Aa-PA
position 1: T:0.13333 C:0.19048 A:0.27619 G:0.40000
position 2: T:0.27619 C:0.22857 A:0.31429 G:0.18095
position 3: T:0.17143 C:0.42857 A:0.12381 G:0.27619
Average T:0.19365 C:0.28254 A:0.23810 G:0.28571
#2: D_sechellia_Acp65Aa-PA
position 1: T:0.13333 C:0.18095 A:0.27619 G:0.40952
position 2: T:0.27619 C:0.22857 A:0.31429 G:0.18095
position 3: T:0.17143 C:0.41905 A:0.08571 G:0.32381
Average T:0.19365 C:0.27619 A:0.22540 G:0.30476
#3: D_simulans_Acp65Aa-PA
position 1: T:0.13333 C:0.18095 A:0.27619 G:0.40952
position 2: T:0.27619 C:0.22857 A:0.31429 G:0.18095
position 3: T:0.18095 C:0.40952 A:0.09524 G:0.31429
Average T:0.19683 C:0.27302 A:0.22857 G:0.30159
#4: D_yakuba_Acp65Aa-PA
position 1: T:0.14286 C:0.17143 A:0.28571 G:0.40000
position 2: T:0.27619 C:0.22857 A:0.31429 G:0.18095
position 3: T:0.16190 C:0.45714 A:0.10476 G:0.27619
Average T:0.19365 C:0.28571 A:0.23492 G:0.28571
#5: D_erecta_Acp65Aa-PA
position 1: T:0.14286 C:0.18095 A:0.28571 G:0.39048
position 2: T:0.27619 C:0.22857 A:0.31429 G:0.18095
position 3: T:0.17143 C:0.41905 A:0.12381 G:0.28571
Average T:0.19683 C:0.27619 A:0.24127 G:0.28571
#6: D_takahashii_Acp65Aa-PA
position 1: T:0.14286 C:0.19048 A:0.28571 G:0.38095
position 2: T:0.26667 C:0.22857 A:0.32381 G:0.18095
position 3: T:0.13333 C:0.41905 A:0.14286 G:0.30476
Average T:0.18095 C:0.27937 A:0.25079 G:0.28889
#7: D_biarmipes_Acp65Aa-PA
position 1: T:0.14286 C:0.18095 A:0.28571 G:0.39048
position 2: T:0.28571 C:0.22857 A:0.30476 G:0.18095
position 3: T:0.11429 C:0.46667 A:0.09524 G:0.32381
Average T:0.18095 C:0.29206 A:0.22857 G:0.29841
#8: D_suzukii_Acp65Aa-PA
position 1: T:0.15238 C:0.18095 A:0.27619 G:0.39048
position 2: T:0.27619 C:0.22857 A:0.31429 G:0.18095
position 3: T:0.12381 C:0.44762 A:0.09524 G:0.33333
Average T:0.18413 C:0.28571 A:0.22857 G:0.30159
#9: D_eugracilis_Acp65Aa-PA
position 1: T:0.15238 C:0.17143 A:0.27619 G:0.40000
position 2: T:0.27619 C:0.21905 A:0.31429 G:0.19048
position 3: T:0.20000 C:0.38095 A:0.17143 G:0.24762
Average T:0.20952 C:0.25714 A:0.25397 G:0.27937
#10: D_rhopaloa_Acp65Aa-PA
position 1: T:0.14286 C:0.17143 A:0.28571 G:0.40000
position 2: T:0.28571 C:0.21905 A:0.31429 G:0.18095
position 3: T:0.13333 C:0.44762 A:0.07619 G:0.34286
Average T:0.18730 C:0.27937 A:0.22540 G:0.30794
#11: D_elegans_Acp65Aa-PA
position 1: T:0.13333 C:0.18095 A:0.28571 G:0.40000
position 2: T:0.28571 C:0.20952 A:0.31429 G:0.19048
position 3: T:0.11429 C:0.43810 A:0.09524 G:0.35238
Average T:0.17778 C:0.27619 A:0.23175 G:0.31429
Sums of codon usage counts
------------------------------------------------------------------------------
Phe F TTT 15 | Ser S TCT 2 | Tyr Y TAT 6 | Cys C TGT 0
TTC 19 | TCC 29 | TAC 37 | TGC 0
Leu L TTA 3 | TCA 0 | *** * TAA 0 | *** * TGA 0
TTG 13 | TCG 28 | TAG 0 | Trp W TGG 11
------------------------------------------------------------------------------
Leu L CTT 3 | Pro P CCT 0 | His H CAT 9 | Arg R CGT 3
CTC 16 | CCC 31 | CAC 2 | CGC 10
CTA 14 | CCA 3 | Gln Q CAA 17 | CGA 4
CTG 53 | CCG 10 | CAG 17 | CGG 16
------------------------------------------------------------------------------
Ile I ATT 17 | Thr T ACT 10 | Asn N AAT 11 | Ser S AGT 23
ATC 14 | ACC 48 | AAC 66 | AGC 25
ATA 13 | ACA 4 | Lys K AAA 22 | Arg R AGA 0
Met M ATG 42 | ACG 8 | AAG 22 | AGG 0
------------------------------------------------------------------------------
Val V GTT 20 | Ala A GCT 11 | Asp D GAT 30 | Gly G GGT 16
GTC 32 | GCC 55 | GAC 22 | GGC 91
GTA 1 | GCA 4 | Glu E GAA 31 | GGA 11
GTG 46 | GCG 17 | GAG 71 | GGG 1
------------------------------------------------------------------------------
Codon position x base (3x4) table, overall
position 1: T:0.14113 C:0.18009 A:0.28139 G:0.39740
position 2: T:0.27792 C:0.22511 A:0.31429 G:0.18268
position 3: T:0.15238 C:0.43030 A:0.10996 G:0.30736
Average T:0.19048 C:0.27850 A:0.23521 G:0.29582
Nei & Gojobori 1986. dN/dS (dN, dS)
(Note: This matrix is not used in later ML. analysis.
Use runmode = -2 for ML pairwise comparison.)
D_melanogaster_Acp65Aa-PA
D_sechellia_Acp65Aa-PA 0.0538 (0.0085 0.1574)
D_simulans_Acp65Aa-PA 0.0538 (0.0085 0.1573)-1.0000 (0.0000 0.0264)
D_yakuba_Acp65Aa-PA 0.0659 (0.0127 0.1926) 0.0291 (0.0042 0.1444) 0.0291 (0.0042 0.1443)
D_erecta_Acp65Aa-PA 0.0188 (0.0042 0.2242) 0.0802 (0.0127 0.1585) 0.0803 (0.0127 0.1584) 0.0654 (0.0084 0.1287)
D_takahashii_Acp65Aa-PA 0.0949 (0.0441 0.4644) 0.1237 (0.0440 0.3558) 0.1314 (0.0440 0.3350) 0.1192 (0.0483 0.4050) 0.1090 (0.0485 0.4446)
D_biarmipes_Acp65Aa-PA 0.1028 (0.0389 0.3780) 0.1218 (0.0388 0.3187) 0.1299 (0.0388 0.2989) 0.1180 (0.0431 0.3650) 0.1356 (0.0432 0.3189) 0.1362 (0.0485 0.3558)
D_suzukii_Acp65Aa-PA 0.0860 (0.0344 0.4006) 0.1012 (0.0344 0.3396) 0.1077 (0.0344 0.3192) 0.1121 (0.0386 0.3447) 0.1293 (0.0388 0.3000) 0.0803 (0.0256 0.3192) 0.1566 (0.0300 0.1916)
D_eugracilis_Acp65Aa-PA 0.0252 (0.0127 0.5028) 0.0263 (0.0127 0.4815) 0.0293 (0.0127 0.4327) 0.0405 (0.0169 0.4166) 0.0390 (0.0169 0.4334) 0.0895 (0.0416 0.4647) 0.0642 (0.0342 0.5332) 0.0727 (0.0299 0.4109)
D_rhopaloa_Acp65Aa-PA 0.1016 (0.0344 0.3386) 0.1063 (0.0300 0.2817) 0.1064 (0.0300 0.2815) 0.1051 (0.0342 0.3255) 0.1006 (0.0343 0.3413) 0.1041 (0.0395 0.3794) 0.0443 (0.0170 0.3833) 0.0867 (0.0213 0.2452) 0.0474 (0.0255 0.5373)
D_elegans_Acp65Aa-PA 0.0631 (0.0213 0.3381) 0.0756 (0.0213 0.2814) 0.0811 (0.0213 0.2625) 0.0836 (0.0255 0.3050) 0.0851 (0.0256 0.3008) 0.0933 (0.0395 0.4234) 0.0703 (0.0191 0.2719) 0.0754 (0.0213 0.2820) 0.0315 (0.0169 0.5364) 0.0657 (0.0084 0.1283)
Model 0: one-ratio
TREE # 1: (1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
lnL(ntime: 16 np: 18): -1024.271393 +0.000000
12..1 12..4 12..5 12..13 13..14 14..15 15..6 15..8 14..7 14..16 16..10 16..11 13..9 12..17 17..2 17..3
0.116270 0.069445 0.078966 0.074881 0.086319 0.039015 0.225635 0.075893 0.158950 0.123249 0.058700 0.066252 0.205367 0.052608 0.010685 0.008166 3.258659 0.059192
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.45040
(1: 0.116270, 4: 0.069445, 5: 0.078966, (((6: 0.225635, 8: 0.075893): 0.039015, 7: 0.158950, (10: 0.058700, 11: 0.066252): 0.123249): 0.086319, 9: 0.205367): 0.074881, (2: 0.010685, 3: 0.008166): 0.052608);
(D_melanogaster_Acp65Aa-PA: 0.116270, D_yakuba_Acp65Aa-PA: 0.069445, D_erecta_Acp65Aa-PA: 0.078966, (((D_takahashii_Acp65Aa-PA: 0.225635, D_suzukii_Acp65Aa-PA: 0.075893): 0.039015, D_biarmipes_Acp65Aa-PA: 0.158950, (D_rhopaloa_Acp65Aa-PA: 0.058700, D_elegans_Acp65Aa-PA: 0.066252): 0.123249): 0.086319, D_eugracilis_Acp65Aa-PA: 0.205367): 0.074881, (D_sechellia_Acp65Aa-PA: 0.010685, D_simulans_Acp65Aa-PA: 0.008166): 0.052608);
Detailed output identifying parameters
kappa (ts/tv) = 3.25866
omega (dN/dS) = 0.05919
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.116 245.9 69.1 0.0592 0.0086 0.1460 2.1 10.1
12..4 0.069 245.9 69.1 0.0592 0.0052 0.0872 1.3 6.0
12..5 0.079 245.9 69.1 0.0592 0.0059 0.0991 1.4 6.8
12..13 0.075 245.9 69.1 0.0592 0.0056 0.0940 1.4 6.5
13..14 0.086 245.9 69.1 0.0592 0.0064 0.1084 1.6 7.5
14..15 0.039 245.9 69.1 0.0592 0.0029 0.0490 0.7 3.4
15..6 0.226 245.9 69.1 0.0592 0.0168 0.2833 4.1 19.6
15..8 0.076 245.9 69.1 0.0592 0.0056 0.0953 1.4 6.6
14..7 0.159 245.9 69.1 0.0592 0.0118 0.1995 2.9 13.8
14..16 0.123 245.9 69.1 0.0592 0.0092 0.1547 2.3 10.7
16..10 0.059 245.9 69.1 0.0592 0.0044 0.0737 1.1 5.1
16..11 0.066 245.9 69.1 0.0592 0.0049 0.0832 1.2 5.7
13..9 0.205 245.9 69.1 0.0592 0.0153 0.2578 3.8 17.8
12..17 0.053 245.9 69.1 0.0592 0.0039 0.0660 1.0 4.6
17..2 0.011 245.9 69.1 0.0592 0.0008 0.0134 0.2 0.9
17..3 0.008 245.9 69.1 0.0592 0.0006 0.0103 0.1 0.7
tree length for dN: 0.1078
tree length for dS: 1.8209
Time used: 0:06
Model 1: NearlyNeutral (2 categories)
TREE # 1: (1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
lnL(ntime: 16 np: 19): -1022.381872 +0.000000
12..1 12..4 12..5 12..13 13..14 14..15 15..6 15..8 14..7 14..16 16..10 16..11 13..9 12..17 17..2 17..3
0.119363 0.071420 0.081276 0.076878 0.085587 0.035520 0.233121 0.081175 0.164163 0.125287 0.060360 0.067531 0.211777 0.054101 0.010849 0.008361 3.365769 0.959835 0.042808
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.48677
(1: 0.119363, 4: 0.071420, 5: 0.081276, (((6: 0.233121, 8: 0.081175): 0.035520, 7: 0.164163, (10: 0.060360, 11: 0.067531): 0.125287): 0.085587, 9: 0.211777): 0.076878, (2: 0.010849, 3: 0.008361): 0.054101);
(D_melanogaster_Acp65Aa-PA: 0.119363, D_yakuba_Acp65Aa-PA: 0.071420, D_erecta_Acp65Aa-PA: 0.081276, (((D_takahashii_Acp65Aa-PA: 0.233121, D_suzukii_Acp65Aa-PA: 0.081175): 0.035520, D_biarmipes_Acp65Aa-PA: 0.164163, (D_rhopaloa_Acp65Aa-PA: 0.060360, D_elegans_Acp65Aa-PA: 0.067531): 0.125287): 0.085587, D_eugracilis_Acp65Aa-PA: 0.211777): 0.076878, (D_sechellia_Acp65Aa-PA: 0.010849, D_simulans_Acp65Aa-PA: 0.008361): 0.054101);
Detailed output identifying parameters
kappa (ts/tv) = 3.36577
dN/dS (w) for site classes (K=2)
p: 0.95984 0.04016
w: 0.04281 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.119 245.7 69.3 0.0813 0.0114 0.1404 2.8 9.7
12..4 0.071 245.7 69.3 0.0813 0.0068 0.0840 1.7 5.8
12..5 0.081 245.7 69.3 0.0813 0.0078 0.0956 1.9 6.6
12..13 0.077 245.7 69.3 0.0813 0.0073 0.0904 1.8 6.3
13..14 0.086 245.7 69.3 0.0813 0.0082 0.1007 2.0 7.0
14..15 0.036 245.7 69.3 0.0813 0.0034 0.0418 0.8 2.9
15..6 0.233 245.7 69.3 0.0813 0.0223 0.2742 5.5 19.0
15..8 0.081 245.7 69.3 0.0813 0.0078 0.0955 1.9 6.6
14..7 0.164 245.7 69.3 0.0813 0.0157 0.1931 3.9 13.4
14..16 0.125 245.7 69.3 0.0813 0.0120 0.1474 2.9 10.2
16..10 0.060 245.7 69.3 0.0813 0.0058 0.0710 1.4 4.9
16..11 0.068 245.7 69.3 0.0813 0.0065 0.0794 1.6 5.5
13..9 0.212 245.7 69.3 0.0813 0.0202 0.2491 5.0 17.3
12..17 0.054 245.7 69.3 0.0813 0.0052 0.0636 1.3 4.4
17..2 0.011 245.7 69.3 0.0813 0.0010 0.0128 0.3 0.9
17..3 0.008 245.7 69.3 0.0813 0.0008 0.0098 0.2 0.7
Time used: 0:13
Model 2: PositiveSelection (3 categories)
TREE # 1: (1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
lnL(ntime: 16 np: 21): -1022.381872 +0.000000
12..1 12..4 12..5 12..13 13..14 14..15 15..6 15..8 14..7 14..16 16..10 16..11 13..9 12..17 17..2 17..3
0.119363 0.071421 0.081276 0.076878 0.085587 0.035520 0.233121 0.081175 0.164163 0.125288 0.060360 0.067531 0.211777 0.054101 0.010849 0.008361 3.365769 0.959835 0.040165 0.042808 36.055101
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.48677
(1: 0.119363, 4: 0.071421, 5: 0.081276, (((6: 0.233121, 8: 0.081175): 0.035520, 7: 0.164163, (10: 0.060360, 11: 0.067531): 0.125288): 0.085587, 9: 0.211777): 0.076878, (2: 0.010849, 3: 0.008361): 0.054101);
(D_melanogaster_Acp65Aa-PA: 0.119363, D_yakuba_Acp65Aa-PA: 0.071421, D_erecta_Acp65Aa-PA: 0.081276, (((D_takahashii_Acp65Aa-PA: 0.233121, D_suzukii_Acp65Aa-PA: 0.081175): 0.035520, D_biarmipes_Acp65Aa-PA: 0.164163, (D_rhopaloa_Acp65Aa-PA: 0.060360, D_elegans_Acp65Aa-PA: 0.067531): 0.125288): 0.085587, D_eugracilis_Acp65Aa-PA: 0.211777): 0.076878, (D_sechellia_Acp65Aa-PA: 0.010849, D_simulans_Acp65Aa-PA: 0.008361): 0.054101);
Detailed output identifying parameters
kappa (ts/tv) = 3.36577
dN/dS (w) for site classes (K=3)
p: 0.95984 0.04016 0.00000
w: 0.04281 1.00000 36.05510
(note that p[2] is zero)
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.119 245.7 69.3 0.0813 0.0114 0.1404 2.8 9.7
12..4 0.071 245.7 69.3 0.0813 0.0068 0.0840 1.7 5.8
12..5 0.081 245.7 69.3 0.0813 0.0078 0.0956 1.9 6.6
12..13 0.077 245.7 69.3 0.0813 0.0073 0.0904 1.8 6.3
13..14 0.086 245.7 69.3 0.0813 0.0082 0.1007 2.0 7.0
14..15 0.036 245.7 69.3 0.0813 0.0034 0.0418 0.8 2.9
15..6 0.233 245.7 69.3 0.0813 0.0223 0.2742 5.5 19.0
15..8 0.081 245.7 69.3 0.0813 0.0078 0.0955 1.9 6.6
14..7 0.164 245.7 69.3 0.0813 0.0157 0.1931 3.9 13.4
14..16 0.125 245.7 69.3 0.0813 0.0120 0.1474 2.9 10.2
16..10 0.060 245.7 69.3 0.0813 0.0058 0.0710 1.4 4.9
16..11 0.068 245.7 69.3 0.0813 0.0065 0.0794 1.6 5.5
13..9 0.212 245.7 69.3 0.0813 0.0202 0.2491 5.0 17.3
12..17 0.054 245.7 69.3 0.0813 0.0052 0.0636 1.3 4.4
17..2 0.011 245.7 69.3 0.0813 0.0010 0.0128 0.3 0.9
17..3 0.008 245.7 69.3 0.0813 0.0008 0.0098 0.2 0.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp65Aa-PA)
Pr(w>1) post mean +- SE for w
The grid (see ternary graph for p0-p1)
w0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
w2: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
w0: 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
w2: 0.382 0.115 0.074 0.065 0.062 0.061 0.061 0.060 0.060 0.060
Posterior for p0-p1 (see the ternary graph)
0.000
0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.010
0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.014 0.976
sum of density on p0-p1 = 1.000000
Time used: 0:40
Model 3: discrete (3 categories)
TREE # 1: (1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
check convergence..
lnL(ntime: 16 np: 22): -1018.036846 +0.000000
12..1 12..4 12..5 12..13 13..14 14..15 15..6 15..8 14..7 14..16 16..10 16..11 13..9 12..17 17..2 17..3
0.117870 0.070018 0.079430 0.077290 0.085455 0.038180 0.232527 0.078923 0.163328 0.124534 0.058281 0.067216 0.210060 0.053547 0.010791 0.008179 3.308444 0.710588 0.000148 0.000001 0.226242 0.226244
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.47563
(1: 0.117870, 4: 0.070018, 5: 0.079430, (((6: 0.232527, 8: 0.078923): 0.038180, 7: 0.163328, (10: 0.058281, 11: 0.067216): 0.124534): 0.085455, 9: 0.210060): 0.077290, (2: 0.010791, 3: 0.008179): 0.053547);
(D_melanogaster_Acp65Aa-PA: 0.117870, D_yakuba_Acp65Aa-PA: 0.070018, D_erecta_Acp65Aa-PA: 0.079430, (((D_takahashii_Acp65Aa-PA: 0.232527, D_suzukii_Acp65Aa-PA: 0.078923): 0.038180, D_biarmipes_Acp65Aa-PA: 0.163328, (D_rhopaloa_Acp65Aa-PA: 0.058281, D_elegans_Acp65Aa-PA: 0.067216): 0.124534): 0.085455, D_eugracilis_Acp65Aa-PA: 0.210060): 0.077290, (D_sechellia_Acp65Aa-PA: 0.010791, D_simulans_Acp65Aa-PA: 0.008179): 0.053547);
Detailed output identifying parameters
kappa (ts/tv) = 3.30844
dN/dS (w) for site classes (K=3)
p: 0.71059 0.00015 0.28926
w: 0.00000 0.22624 0.22624
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.118 245.8 69.2 0.0655 0.0095 0.1451 2.3 10.0
12..4 0.070 245.8 69.2 0.0655 0.0056 0.0862 1.4 6.0
12..5 0.079 245.8 69.2 0.0655 0.0064 0.0978 1.6 6.8
12..13 0.077 245.8 69.2 0.0655 0.0062 0.0952 1.5 6.6
13..14 0.085 245.8 69.2 0.0655 0.0069 0.1052 1.7 7.3
14..15 0.038 245.8 69.2 0.0655 0.0031 0.0470 0.8 3.3
15..6 0.233 245.8 69.2 0.0655 0.0187 0.2863 4.6 19.8
15..8 0.079 245.8 69.2 0.0655 0.0064 0.0972 1.6 6.7
14..7 0.163 245.8 69.2 0.0655 0.0132 0.2011 3.2 13.9
14..16 0.125 245.8 69.2 0.0655 0.0100 0.1533 2.5 10.6
16..10 0.058 245.8 69.2 0.0655 0.0047 0.0718 1.2 5.0
16..11 0.067 245.8 69.2 0.0655 0.0054 0.0828 1.3 5.7
13..9 0.210 245.8 69.2 0.0655 0.0169 0.2586 4.2 17.9
12..17 0.054 245.8 69.2 0.0655 0.0043 0.0659 1.1 4.6
17..2 0.011 245.8 69.2 0.0655 0.0009 0.0133 0.2 0.9
17..3 0.008 245.8 69.2 0.0655 0.0007 0.0101 0.2 0.7
Naive Empirical Bayes (NEB) analysis
Time used: 1:03
Model 7: beta (10 categories)
TREE # 1: (1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
lnL(ntime: 16 np: 19): -1018.549421 +0.000000
12..1 12..4 12..5 12..13 13..14 14..15 15..6 15..8 14..7 14..16 16..10 16..11 13..9 12..17 17..2 17..3
0.117925 0.069979 0.079400 0.076999 0.085396 0.037552 0.231728 0.078991 0.162612 0.124279 0.058485 0.067048 0.209455 0.053649 0.010774 0.008178 3.302867 0.194977 2.605260
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.47245
(1: 0.117925, 4: 0.069979, 5: 0.079400, (((6: 0.231728, 8: 0.078991): 0.037552, 7: 0.162612, (10: 0.058485, 11: 0.067048): 0.124279): 0.085396, 9: 0.209455): 0.076999, (2: 0.010774, 3: 0.008178): 0.053649);
(D_melanogaster_Acp65Aa-PA: 0.117925, D_yakuba_Acp65Aa-PA: 0.069979, D_erecta_Acp65Aa-PA: 0.079400, (((D_takahashii_Acp65Aa-PA: 0.231728, D_suzukii_Acp65Aa-PA: 0.078991): 0.037552, D_biarmipes_Acp65Aa-PA: 0.162612, (D_rhopaloa_Acp65Aa-PA: 0.058485, D_elegans_Acp65Aa-PA: 0.067048): 0.124279): 0.085396, D_eugracilis_Acp65Aa-PA: 0.209455): 0.076999, (D_sechellia_Acp65Aa-PA: 0.010774, D_simulans_Acp65Aa-PA: 0.008178): 0.053649);
Detailed output identifying parameters
kappa (ts/tv) = 3.30287
Parameters in M7 (beta):
p = 0.19498 q = 2.60526
dN/dS (w) for site classes (K=10)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000
w: 0.00000 0.00002 0.00024 0.00135 0.00491 0.01390 0.03363 0.07394 0.15691 0.36392
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.118 245.8 69.2 0.0649 0.0094 0.1455 2.3 10.1
12..4 0.070 245.8 69.2 0.0649 0.0056 0.0863 1.4 6.0
12..5 0.079 245.8 69.2 0.0649 0.0064 0.0979 1.6 6.8
12..13 0.077 245.8 69.2 0.0649 0.0062 0.0950 1.5 6.6
13..14 0.085 245.8 69.2 0.0649 0.0068 0.1053 1.7 7.3
14..15 0.038 245.8 69.2 0.0649 0.0030 0.0463 0.7 3.2
15..6 0.232 245.8 69.2 0.0649 0.0185 0.2858 4.6 19.8
15..8 0.079 245.8 69.2 0.0649 0.0063 0.0974 1.6 6.7
14..7 0.163 245.8 69.2 0.0649 0.0130 0.2006 3.2 13.9
14..16 0.124 245.8 69.2 0.0649 0.0099 0.1533 2.4 10.6
16..10 0.058 245.8 69.2 0.0649 0.0047 0.0721 1.2 5.0
16..11 0.067 245.8 69.2 0.0649 0.0054 0.0827 1.3 5.7
13..9 0.209 245.8 69.2 0.0649 0.0168 0.2584 4.1 17.9
12..17 0.054 245.8 69.2 0.0649 0.0043 0.0662 1.1 4.6
17..2 0.011 245.8 69.2 0.0649 0.0009 0.0133 0.2 0.9
17..3 0.008 245.8 69.2 0.0649 0.0007 0.0101 0.2 0.7
Time used: 2:09
Model 8: beta&w>1 (11 categories)
TREE # 1: (1, 4, 5, (((6, 8), 7, (10, 11)), 9), (2, 3)); MP score: 124
lnL(ntime: 16 np: 21): -1018.549722 +0.000000
12..1 12..4 12..5 12..13 13..14 14..15 15..6 15..8 14..7 14..16 16..10 16..11 13..9 12..17 17..2 17..3
0.117927 0.069980 0.079401 0.077000 0.085396 0.037552 0.231730 0.078992 0.162613 0.124280 0.058485 0.067048 0.209457 0.053650 0.010774 0.008178 3.302883 0.999990 0.194982 2.605472 1.000000
Note: Branch length is defined as number of nucleotide substitutions per codon (not per neucleotide site).
tree length = 1.47246
(1: 0.117927, 4: 0.069980, 5: 0.079401, (((6: 0.231730, 8: 0.078992): 0.037552, 7: 0.162613, (10: 0.058485, 11: 0.067048): 0.124280): 0.085396, 9: 0.209457): 0.077000, (2: 0.010774, 3: 0.008178): 0.053650);
(D_melanogaster_Acp65Aa-PA: 0.117927, D_yakuba_Acp65Aa-PA: 0.069980, D_erecta_Acp65Aa-PA: 0.079401, (((D_takahashii_Acp65Aa-PA: 0.231730, D_suzukii_Acp65Aa-PA: 0.078992): 0.037552, D_biarmipes_Acp65Aa-PA: 0.162613, (D_rhopaloa_Acp65Aa-PA: 0.058485, D_elegans_Acp65Aa-PA: 0.067048): 0.124280): 0.085396, D_eugracilis_Acp65Aa-PA: 0.209457): 0.077000, (D_sechellia_Acp65Aa-PA: 0.010774, D_simulans_Acp65Aa-PA: 0.008178): 0.053650);
Detailed output identifying parameters
kappa (ts/tv) = 3.30288
Parameters in M8 (beta&w>1):
p0 = 0.99999 p = 0.19498 q = 2.60547
(p1 = 0.00001) w = 1.00000
dN/dS (w) for site classes (K=11)
p: 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.10000 0.00001
w: 0.00000 0.00002 0.00024 0.00135 0.00491 0.01390 0.03363 0.07394 0.15690 0.36389 1.00000
dN & dS for each branch
branch t N S dN/dS dN dS N*dN S*dS
12..1 0.118 245.8 69.2 0.0649 0.0094 0.1455 2.3 10.1
12..4 0.070 245.8 69.2 0.0649 0.0056 0.0863 1.4 6.0
12..5 0.079 245.8 69.2 0.0649 0.0064 0.0979 1.6 6.8
12..13 0.077 245.8 69.2 0.0649 0.0062 0.0950 1.5 6.6
13..14 0.085 245.8 69.2 0.0649 0.0068 0.1053 1.7 7.3
14..15 0.038 245.8 69.2 0.0649 0.0030 0.0463 0.7 3.2
15..6 0.232 245.8 69.2 0.0649 0.0185 0.2858 4.6 19.8
15..8 0.079 245.8 69.2 0.0649 0.0063 0.0974 1.6 6.7
14..7 0.163 245.8 69.2 0.0649 0.0130 0.2006 3.2 13.9
14..16 0.124 245.8 69.2 0.0649 0.0099 0.1533 2.4 10.6
16..10 0.058 245.8 69.2 0.0649 0.0047 0.0721 1.2 5.0
16..11 0.067 245.8 69.2 0.0649 0.0054 0.0827 1.3 5.7
13..9 0.209 245.8 69.2 0.0649 0.0168 0.2584 4.1 17.9
12..17 0.054 245.8 69.2 0.0649 0.0043 0.0662 1.1 4.6
17..2 0.011 245.8 69.2 0.0649 0.0009 0.0133 0.2 0.9
17..3 0.008 245.8 69.2 0.0649 0.0007 0.0101 0.2 0.7
Naive Empirical Bayes (NEB) analysis
Bayes Empirical Bayes (BEB) analysis (Yang, Wong & Nielsen 2005. Mol. Biol. Evol. 22:1107-1118)
Positively selected sites (*: P>95%; **: P>99%)
(amino acids refer to 1st sequence: D_melanogaster_Acp65Aa-PA)
Pr(w>1) post mean +- SE for w
The grid
p0: 0.050 0.150 0.250 0.350 0.450 0.550 0.650 0.750 0.850 0.950
p : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
q : 0.100 0.300 0.500 0.700 0.900 1.100 1.300 1.500 1.700 1.900
ws: 1.500 2.500 3.500 4.500 5.500 6.500 7.500 8.500 9.500 10.500
Posterior on the grid
p0: 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 1.000
p : 1.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000 0.000
q : 0.000 0.000 0.000 0.002 0.016 0.053 0.115 0.192 0.273 0.349
ws: 0.357 0.113 0.076 0.068 0.065 0.064 0.064 0.064 0.064 0.064
Time used: 3:28
Model 1: NearlyNeutral -1022.381872 Model 2: PositiveSelection -1022.381872 Model 0: one-ratio -1024.271393 Model 3: discrete -1018.036846 Model 7: beta -1018.549421 Model 8: beta&w>1 -1018.549722 Model 0 vs 1 3.7790419999998903 Model 2 vs 1 0.0 Model 8 vs 7 6.019999998443382E-4
Phone: +351 220 408 800
Email: info@i3s.up.pt
Address: Rua Alfredo Allen, 208
4200-135 Porto, Portugal
If you use B+, please cite us:
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2018) Large Scale Analyses and Visualization of Adaptive Amino Acid Changes Projects. Interdisciplinary Sciences: Computational Life Sciences. https://doi.org/10.1007/s12539-018-0282-7
N. Vázquez, C.P. Vieira, B.S.R. Amorin, A. Torres, H. López-Fernández, F. Fdez-Riverola, J.L.R. Sousa, M. Reboiro-Jato, J. Vieira (2017) Automated Collection and Sharing of Adaptive Amino Acid Changes Data. 11th International Conference on Practical Applications of Computational Biology & Bioinformatics. Porto, Portugal. https://doi.org/10.1007/978-3-319-60816-7_3
